3AWWB

Crystal structure of streptomyces tyrosinase in a complex with caddie soaked in a cu(ii)-containing solution for 80 hr: occupancy of cua is high
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
77
Chain Sequence
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 77
sequence length 83
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awwB01
3AWVB 2ZWFB 1WXCB 3AWTB 3AWUB 2AHLB 2ZMYB 2ZWDB 3AWYB 2ZMXB 1WX2B 2ZWGB 2ZMZB 3AWSB 3AWXB 3AWZB 2ZWEB 1WX4B 3AWWB 1WX5B 3AX0B 2AHKB 2JV8A
chains in the Genus database with same CATH superfamily
4NB8A 3GKQA 3AWVB 2ZWFB 1WW9A 1WXCB 3AWTB 3AWUB 4NBDA 1Z03A 2AHLB 2ZMYB 4NBAA 2ZWDB 1Z02A 2DE5A 4NBEA 3VMIA 3AWYB 4NB9A 1Z01A 2ZMXB 1WX2B 2ZWGB 4NBGA 2ZMZB 3GCFA 3VMGA 3AWSB 2DE7A 3AWXB 4NBHA 4NBFA 4NBBA 3AWZB 2ZWEB 1WX4B 3AWWB 1WX5B 3AX0B 4NBCA 3VMHA 2DE6A 2AHKB 2JV8A
chains in the Genus database with same CATH topology
3AWVB 2ZWFB 1WXCB 3AWTB 3AWUB 2AHLB 2ZMYB 2ZWDB 3AWYB 2ZMXB 1WX2B 2ZWGB 2ZMZB 3AWSB 3AWXB 3AWZB 2ZWEB 1WX4B 3AWWB 1WX5B 3AX0B 2AHKB 2JV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWV B;  2ZWF B;  1WXC B;  3AWT B;  3AWU B;  2AHL B;  2ZMY B;  2ZWD B;  3AWY B;  2ZMX B;  1WX2 B;  2ZWG B;  2ZMZ B;  3AWS B;  3AWX B;  3AWZ B;  2ZWE B;  1WX4 B;  3AWW B;  1WX5 B;  3AX0 B;  2AHK B;  2JV8 A; 
#chains in the Genus database with same CATH topology
 4NB8 A;  3GKQ A;  3AWV B;  2ZWF B;  1WW9 A;  1WXC B;  3AWT B;  3AWU B;  4NBD A;  1Z03 A;  2AHL B;  2ZMY B;  4NBA A;  2ZWD B;  1Z02 A;  2DE5 A;  4NBE A;  3VMI A;  3AWY B;  4NB9 A;  1Z01 A;  2ZMX B;  1WX2 B;  2ZWG B;  4NBG A;  2ZMZ B;  3GCF A;  3VMG A;  3AWS B;  2DE7 A;  3AWX B;  4NBH A;  4NBF A;  4NBB A;  3AWZ B;  2ZWE B;  1WX4 B;  3AWW B;  1WX5 B;  3AX0 B;  4NBC A;  3VMH A;  2DE6 A;  2AHK B;  2JV8 A; 
#chains in the Genus database with same CATH homology
 3AWV B;  2ZWF B;  1WXC B;  3AWT B;  3AWU B;  2AHL B;  2ZMY B;  2ZWD B;  3AWY B;  2ZMX B;  1WX2 B;  2ZWG B;  2ZMZ B;  3AWS B;  3AWX B;  3AWZ B;  2ZWE B;  1WX4 B;  3AWW B;  1WX5 B;  3AX0 B;  2AHK B;  2JV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...