The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
92
|
sequence length |
311
|
structure length |
307
|
Chain Sequence |
AELACFCYPHLENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKVAMLICEALNSLKVTQANVSNVLSRVVSIRHLENLVIRKENPQDILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQNAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKPISDVHVKELVAELRWQYNKFAVITHGKGAYRIVKYSSVANHADRVYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQKMKPFKGLSTDRKMDEV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystallographic and Biochemical Analysis of Rotavirus NSP2 with Nucleotides Reveals a Nucleoside Diphosphate Kinase-Like Activity
pubmed doi rcsb |
| molecule tags |
Rna binding protein
|
| source organism |
Simian 11 rotavirus (serotype 3 / strain sa11-ramig)
|
| molecule keywords |
Non-structural RNA-binding protein 35
|
| total genus |
92
|
| structure length |
307
|
| sequence length |
311
|
| ec nomenclature | |
| pdb deposition date | 2007-09-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02509 | Rota_NS35 | Rotavirus non-structural protein 35 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | HIT family, subunit A | Rotavirus NSP2 fragment, C-terminal domain | ||
| Alpha Beta | Alpha-Beta Complex | Rotavirus NSP2 fragment, N-terminal domain | Rotavirus NSP2 fragment, N-terminal domain |
#chains in the Genus database with same CATH superfamily 2R7P A; 4G0J A; 2R7C A; 1L9V A; 4G0A A; 2R7J A; 2R8F A; 2GU0 A; #chains in the Genus database with same CATH topology 4YKL B; 2POF A; 4NDI A; 1XML A; 3KSV A; 1ST0 A; 1RZY A; 4G0J A; 4I5T A; 3SPD A; 6RHN A; 1ZWJ A; 1KPB A; 5I2E A; 1FIT A; 5IN3 A; 2R7J A; 1AV5 A; 4EGU A; 2Q4H A; 3N1T A; 1GUP A; 3OJ7 A; 4EQH A; 5IPD A; 1VLR A; 2GU0 A; 3R6F A; 3SZQ A; 4RHN A; 2H39 A; 3P0T A; 4XBA A; 4EQG A; 3I4S A; 3OMF A; 4NJZ A; 4ZGL A; 2R7C A; 5CS2 A; 1GUQ A; 3SP4 A; 4INC A; 4ZKV A; 1KPA A; 2R8F A; 4I5W A; 4NJX A; 1HXQ A; 4FIT A; 5IPC A; 4QDE A; 1KPE A; 5ED6 A; 2EO4 A; 3O1X A; 5EMT A; 1FHI A; 5BV3 A; 3O0M A; 4G0A A; 1Y23 A; 5RHN A; 4I5V A; 3NRD A; 3O1Z A; 4NDH A; 4NJY A; 3IMI A; 4QEB A; 1Z84 A; 3O1C A; 3I24 A; 5FIT A; 4NDG A; 1EMS A; 4QDV A; 2OIK A; 3WO5 A; 6FIT A; 2LJW A; 4EQE A; 3TW2 A; 3BL7 A; 5ED3 A; 3L7X A; 3QGZ A; 4NDF A; 2Q4L A; 5IPB A; 3BLA A; 2FIT A; 3OHE A; 1XMM A; 3N1S A; 3SPL A; 3FIT A; 3ANO A; 3BL9 A; 3OXK A; 3RHN A; 5IPE A; 5I2F A; 2R7P A; 1HXP A; 1ST4 A; 1L9V A; 3LB5 A; 4ZKL A; 2FHI A; 4NK0 A; 1KPC A; 4INI A; 1KPF A; #chains in the Genus database with same CATH homology 2R7P A; 4G0J A; 2R7C A; 1L9V A; 4G0A A; 2R7J A; 2R8F A; 2GU0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
