The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
84
|
structure length |
73
|
Chain Sequence |
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVLRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb |
| molecule keywords |
Tyrosinase
|
| molecule tags |
Oxidoreductase/metal transport
|
| source organism |
Streptomyces castaneoglobisporus
|
| total genus |
16
|
| structure length |
73
|
| sequence length |
84
|
| ec nomenclature | |
| pdb deposition date | 2011-03-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF06236 | MelC1 | Tyrosinase co-factor MelC1 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | protein ne1242 fold | protein ne1242 domain like |
#chains in the Genus database with same CATH superfamily 2ZWF B; 2JV8 A; 3AWY B; 3AWU B; 2ZWE B; 3AWX B; 2AHL B; 3AWV B; 2ZMZ B; 3AWT B; 3AX0 B; 3AWZ B; 1WX5 B; 1WX4 B; 2ZWG B; 3AWS B; 2AHK B; 2ZWD B; 1WX2 B; 3AWW B; 2ZMX B; 2ZMY B; 1WXC B; #chains in the Genus database with same CATH topology 4NB9 A; 2ZWF B; 3VMG A; 2JV8 A; 4NBB A; 4NBF A; 3AWY B; 1Z02 A; 3AWU B; 2ZWE B; 3AWX B; 2AHL B; 3AWV B; 4NBC A; 2ZMZ B; 3AWT B; 3AWZ B; 3AX0 B; 3VMI A; 2DE7 A; 4NB8 A; 1WW9 A; 4NBA A; 4NBG A; 1WX5 B; 1WX4 B; 2ZWG B; 1Z03 A; 3AWS B; 2AHK B; 2DE5 A; 2ZWD B; 2DE6 A; 1WX2 B; 3AWW B; 4NBE A; 4NBD A; 1Z01 A; 2ZMX B; 2ZMY B; 3VMH A; 4NBH A; 3GCF A; 1WXC B; 3GKQ A; #chains in the Genus database with same CATH homology 2ZWF B; 2JV8 A; 3AWY B; 3AWU B; 2ZWE B; 3AWX B; 2AHL B; 3AWV B; 2ZMZ B; 3AWT B; 3AX0 B; 3AWZ B; 1WX5 B; 1WX4 B; 2ZWG B; 3AWS B; 2AHK B; 2ZWD B; 1WX2 B; 3AWW B; 2ZMX B; 2ZMY B; 1WXC B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...