The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
245
|
structure length |
209
|
Chain Sequence |
FIYEPFQIPSGSMMPTLLIGDFILVEKFAHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSACENALPVTYSNVEPSDFVQTFTSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDLRLSRIGGIH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Synthesis and characterization of the arylomycin lipoglycopeptide antibiotics and the crystallographic analysis of their complex with signal peptidase.
pubmed doi rcsb |
| molecule tags |
Hydrolase/antibiotic
|
| source organism |
Escherichia coli
|
| molecule keywords |
Signal peptidase I
|
| total genus |
47
|
| structure length |
209
|
| sequence length |
245
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.4.21.89: Signal peptidase I. |
| pdb deposition date | 2011-05-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00717 | Peptidase_S24 | Peptidase S24-like |
| A | PF10502 | Peptidase_S26 | Signal peptidase, peptidase S26 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Umud Fragment, subunit A | Umud Fragment, subunit A | ||
| Mainly Beta | Beta Complex | Signal Peptidase I; Chain: A, domain 2 | Signal Peptidase I; Chain: A, domain 2 |
#chains in the Genus database with same CATH superfamily 1B12 A; 3JSP A; 1JHF A; 4N31 A; 3IIQ A; 1KN9 A; 1JHH A; 1F39 A; 2HNF A; 2FJR A; 1JHC A; 1KCA A; 1UMU A; 1JHE A; 4NV4 A; 1AY9 A; 1I4V A; 2FKD A; 4K8W A; 2HO0 A; 4ME8 A; 3JSO A; 3S04 A; 3BDN A; 1T7D A; 3K2Z A; #chains in the Genus database with same CATH topology 1B12 A; 3JSP A; 1JHF A; 4N31 A; 3IIQ A; 1KN9 A; 1JHH A; 1F39 A; 2HNF A; 2FJR A; 1JHC A; 1KCA A; 1UMU A; 1JHE A; 4NV4 A; 1AY9 A; 1I4V A; 2FKD A; 4K8W A; 2HO0 A; 4ME8 A; 3JSO A; 3S04 A; 3BDN A; 1T7D A; 3K2Z A; #chains in the Genus database with same CATH homology 1B12 A; 3JSP A; 1JHF A; 4N31 A; 3IIQ A; 1KN9 A; 1JHH A; 1F39 A; 2HNF A; 2FJR A; 1JHC A; 1KCA A; 1UMU A; 1JHE A; 4NV4 A; 1AY9 A; 1I4V A; 2FKD A; 4K8W A; 2HO0 A; 4ME8 A; 3JSO A; 3S04 A; 3BDN A; 1T7D A; 3K2Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
