4LIIA

Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (aifm1) from homo sapiens at 1.88 a resolution
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
487
structure length
474
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, apoptosis
total genus 147
structure length 474
sequence length 487
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4liiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4liiA01
4FDCB 4H4PA 1PBEA 4E0VA 1V59A 2X50A 4H4RA 4BK3A 2NVKX 1VG9A 3DK4A 1TDEA 1NDAA 3UKHA 4H4TA 4P9SA 1YQZA 5IQ4A 3NNEA 4J56A 2QAEA 2J3NA 3C4NA 2WETA 4I59A 2VOUA 4JDRA 5FS9A 3NLCA 3L8KA 3ICRA 1JOAA 4Z44A 5J60A 1F8SA 1DXLA 3LADA 5IPYA 4Y4LA 2B7RA 1E1LA 2XVFA 4APNA 3S5WA 1RYIA 2DKHA 1QJDA 2OLNA 1PBCA 2V60A 2Q6UA 2YG6A 5JCIA 1O94A 2C73A 3KA7A 2GV8A 3NN0X 4K5SA 5KRQA 3BHFA 1IJHA 1GT8A 1L9CA 1M64A 2W0HA 2GB0A 3DJDA 1PBDA 3G5QA 4J34A 3ALLA 2YQUA 1VQWA 4B68A 4X9MA 3NG7X 4BJZA 4LU6A 3AE3A 4EQRA 1D4CA 1S2QA 2WP6A 3ICTA 4YTPA 3FG2P 3KU9A 3WE0A 3GYJA 5CKUA 5C3JA 2B76A 5KWFA 2WPEA 2FJEA 3CTYA 4CNJA 2XYOA 2GQFA 2V61A 1F8WA 2WDRA 4EQSA 1NAAA 2YG7A 3H8IA 4XXGA 2A87A 1VG0A 4A9WA 4C3XA 2YR4A 3AE1A 3NK2X 3UKKA 3AEDA 2JBVA 4YTNA 2WOVA 1VRQB 2OAMA 2WS3A 3IHMA 2QA1A 3K7TA 2CFYA 1BF3A 1O95A 3CPJG 1ZOYA 1W4XA 4H4ZA 1F6MA 3GWDA 1YKJA 2FJAA 4H50A 2XVHA 1GXFA 4J36A 4IVMB 4UDQA 4J31A 4CBQA 5FS8A 1YQ4A 1LPFA 3RP8A 2WBAA 3NK0X 5HHFA 5U25A 2YG5A 2C76A 1LQUA 3SGLA 3R9UA 1N4UA 4WCTA 1CHUA 2C64A 4Z2TA 2ACZA 3FIMB 5U63A 2AAQA 3E1TA 2VRLA 3LJPA 4TM1A 4B65A 3UOZA 1AOGA 4B63A 1NHPA 1N4WA 3CPIG 3UP4A 3AYJA 3CGCA 1OJDA 4YKGA 2Y6RA 1DJQA 3BI2A 2R9ZA 1K0LA 2QA2A 3ATRA 4J2WA 4B1BA 4OPGA 1JRYA 1PHHA 2X8CA 2WDQA 1Q1WA 3PVCA 2EQ9A 2YM1A 3C4AA 1PJ5A 2WU2A 3T37A 3FPZA 3BNUA 3BNMA 2YVGA 3VRBA 1TDFA 1IUUA 2BCPA 2VZ2A 2R4JA 1CC6A 3DK8A 1D4EA 1L9EA 3HZLA 3UTHA 1TYTA 4A79A 2CDUA 3AD9B 2VVLA 2VVLG 3K30A 1B5QA 4OCGA 4I58A 2IVDA 4N9XA 1FECA 1GRHA 2B9WA 1CL0A 3SQPA 3OC4A 2OLOA 4PABA 4K22A 1FEAA 3UTGA 5HYMA 4H4SA 4RSLA 2XFUA 2WOIA 1E7PA 2WQYA 3CNPA 3UKQA 1JNRA 5U1OA 1KF6A 1E1KA 3K7MX 3UOXA 4DNAA 3V3OA 4EMIA 3PS9A 4ADWA 4YTMA 4NTEA 3DJEA 5EOWA 3K7QX 3DMEA 5HXIA 2CVJA 4B69A 2C66A 1CJ2A 2GH5A 1VDCA 1EL7A 3NN6X 2JK6A 2BS4A 3G5RA 1K4QA 4HB9A 3V76A 1FOHA 1XPQA 1LVLA 1COYA 2OA1A 2IVEA 2R46A 3CIRA 4U8NA 3LOVA 4AT2A 1GESA 1CC2A 1KDGA 2GQWA 4U2TA 3DK9A 2V3BA 3QSMA 4JY2A 1GRFA 1NPXA 1TDNA 3AE5A 4U8MA 1ZDLA 1TYPA 2BXRA 1CBOA 3UP5A 4YXDA 2YLWA 2XLRA 4H2QA 3ADAB 3DGHA 5HY5A 3CNDA 2XFNA 3GYIA 3NKSA 2YLSA 5LV9A 1Y0PA 2NPXA 5BVAA 2EQ8A 1E6EA 2APGA 2GAGB 2C3CA 3ALJA 1UKVG 2X8HA 1KNPA 4GF7A 3DGZA 1DJNA 1GRTA 1ZX9A 1P2EA 4GUVA 2AQJA 3AD8B 2YR6A 3ZDNA 3UKAA 1IUXA 4YT0A 2BK5A 2EQ6A 2WPCA 4USQA 4ZN0A 2WEUA 1BGNA 1M6IA 3CGEA 4H4XA 2JB2A 1CJ4A 3QJ4A 1TDOA 3CNTA 4U8IA 4NEVA 1KFYA 2ZZ0A 1DNCA 3NGCX 4LA1A 4Z25A 4OPIA 1IUWA 5BRTA 4XWRA 4Y4NA 4LIIA 3P4PA 1MO9A 2WPFA 2Q0KA 1LQTA 4H4QA 2BYBA 2YLZA 3VR9A 1NG4A 4EMJA 2GR0A 1JU2A 1Q9IA 4A65A 4C74A 1Q1RA 3UKFA 3DJGX 2GMJA 2YR5A 3DJJA 1GRGA 2YM2A 4UP3A 1D7YA 2WDVA 4K2XA 1SEZA 1QO8A 1MOKA 2YLXA 3AE7A 3CGDA 4RG3A 3CNJA 1H7XA 2WP5A 3NIXA 3EAOA 1Y56B 3S61A 3QFBA 2BXSA 4DGKA 2UZZA 3JSKA 4Y4MA 1GOSA 2XLPA 2XCGA 3V3NA 2VRMA 4CY6A 2GR1A 3M13A 4KPRA 1DOBA 1ZP0A 1TRBA 1KSUA 1D4DA 1GREA 3UKPA 1OJTA 1D5TA 3G5SA 3IF9A 2FBWA 4NTCA 3EPTA 4A5LA 1S3BA 4U2SA 3D8XA 5FS6A 2C3DA 4GDEA 4EQXA 4CNKA 2GR3A 1GSNA 1NHQA 1GALA 2XLSA 2YG3A 2C67A 1PBFA 3CNSA 3GRSA 3RP6A 4H4VA 2A8XA 2X8GA 1RP0A 3M0OA 1H84A 2BABA 2FJBA 5KVIA 1PXAA 2IIDA 2WESA 4B64A 2RGHA 3ALMA 5KOXA 3KLJA 2V3AA 4OPDA 1NHRA 3NHOX 3AWIA 2HQMA 2XFQA 3GD4A 1ZY8A 1JRZA 4C5OA 4CY8A 2R0PA 3I6DA 4GR1A 4EQWA 2XVIA 3QSEA 4U8PA 4K8DA 4BV6A 4CCRA 3PO7A 3NTDA 3CPHG 3LXDA 1NENA 1CC4A 2YG4A 4O5UA 1O5WA 1H81A 3NK1X 2GF3A 3B3RA 4RG4A 1Y56A 4TM0A 1NEKA 5JCNA 5FS7A 3GDPA 4NEWA 3SM8A 1JNZA 5M0ZA 4U8JA 1FCDA 3GDNA 1B37A 1PJ7A 2BA9A 3FMWA 4O5QA 4Z2UA 2JKCA 4REKA 5GRTA 2X3NA 4AP1A 3EANA 4D04A 3ABVA 4OPLA 1GTHA 2H89A 2C75A 4AT0A 3REDA 2XLUA 4H7UA 2RABA 3ICSA 1BKWA 1PS9A 2C72A 4YSYA 2XDOA 4UDRA 2Z5YA 1ZKQA 3F8DA 2RGOA 3IHGA 3F8PA 3AXBA 2BC1A 3KPFA 3ATQA 1S3EA 2B9YA 3ZYXA 4AP3A 2R0CA 1PBBA 1LTXR 3RHAA 3P4RA 4Z43A 2DKIA 3DA1A 5IQ1A 2E5VA 3AEAA 3VRDB 3GWFA 3QVPA 3UKLA 1IUVA 1H86A 4XWZA 3CGBA 5ER0A 3SFDA 3UOVA 5EB5A 4AOSA 1ONFA 5JCKA 4GCMA 4TLZA 3URHA 2X99A 1GTEA 1ZOVA 1LV0A 3NYEA 1DOCA 2XLTA 2V6OA 3NYFA 2JB3A 1H82A 4X9NA 4FK1C 5TR3A 1CJCA 2F5ZA 4CCQA 1F3PA 1PDHA 1BWCA 3GD3A 1YQ3A 2VQBA 2Q7VA 4GRTA 4USRA 2JAEA 4BURA 4ZCDA 2VVMA 1GERA 1RSGA 3LZWA 1IUSA 2FJDA 1E1NA 2YVJA 1NHSA 1S2YA 3KKJA 1IUTA 2Z5XA 5BUKA 3VRAA 1BZLA 3COXA 3ITJA 3FBSA 3GRTA 4U8LA 1LJ1A 1F8RA 1L9DA 4X4JA 5C2TA 3RNMA 3GMBA 4YKFA 3UOYA 2XFPA 1GV4A 4K5RA 4WX1A 3QSSA 2ZZBA 1Z6LA 2WOWA 4JQ9A 4B67A 1NG3A 4U8KA 1ZMDA 1B4VA 3F8RA 4J33A 1JRXA 4ICYA 2C7GA 2O9ZA 4EM3A 3AB1A 2R45A 1FL2A 1GRAA 3AECA 5GSNA 4JNQA 5M10A 4Z24A 4YSZA 1ZMCA 2Y6QA 4TLXA 1X31B 4EMWA 1CF3A 2C70A 3GMCA 5CQFA 1E1MA 4BJYA 1JEHA 4YWOA 3C96A 3UCLA 2YVFA 5J7XA 2OALA 1N1PA 4DSHA 3DH9A 3M12A 2BS2A 3NT6A 4U2LA 1N4VA 5JCLA 3P4SA 4U8OA 2ZBWA 1ELIA 2R0GA 2YLTA 2WU5A 4OVIA 3QFAA 5KXJA 4C77A 1FEBA 4OPUA 2C65A 3L1RA 4J57A 3P1WA 2WHDA 1EL9A 1E39A 3LB8A 4Z26A 2A89A 1XANA 4A6NB 1OJCA 4FK1A 3P4QA 4KX6A 1BGJA 1PJ6A 2BK4A 3GSIA 3I3LA 1KNRA 1PXBA 2BS3A 3Q9TA 2VQ7A 4IA5A 4YSXA 2EQ7A 3KVEA 3O0HA 2XVJA 3VQRA 3RP7A 1PN0A 2QCUA 3AEGA 2PHHA 4FX9A 3II4A 2R4EA 3AD7B 4H2RA 4JY3A 4IVOB 1D7LA 3BI5A 4M52A 2JB1A 4A7AA 3H8LA 1XHCA 2GEWA 1REOA 4UDPA 2B7SA 2V5ZA 4A99A 3QVRA 4H4YA 1K0IA 2BCGG 2E4GA 3LZXA 4H2PA 1L0VA 3AE2A 4MJWA 4D03A 2GRTA 4TM4A 1B8SA 5L46A 4K7ZA 1H83A 3IC9A 3AE6A 1HYUA 4Z2RA 3IWAA 4GDPA 4OPCA 5EBKA 1GPEA 1QLBA 2TMDA 3BHKA 1DODA 4ECHA 4EM4A 1DOEA 3BI4A 4IA6A 1ZK7A 3EF6A 2ARDA 2CULA 2GAHB 2XVEA 2XFOA 1GNDA 2YLRA 3UTEA 2H88A 4C3YA 1K0JA 4ZCCA 4IV9A 1OJ9A 4EIPA 4H4UA 1H7WA 2BACA 3AYLA 5JCMA 2GR2A 3KD9A 5FMHA 2ZZCA 2GMHA 3NH3X 2YWLA 4PAAA 1EL5A 1EL8A 3D1CA 5BULA 1GEUA 3AEFA 4JN9A 3AE8A 5KVHA 1H6VA 3B6DA 4DSGA 2GVCA 3AYIA 1YY5A 3VR8A 3H4KA 4CRTA 4NTDA 4A6NA 3AEBA 1GETA 1P2HA 4NZHA 1KSSA 2BK3A 2E1MA 4HA6A 4BK2A 2TPRA 4BK1A 2YAUA 4H2NA 3NTAA 3UTFA 2PYXA 4B66A 4JNAA 3AE9A 3NYCA 1XDIA 3NRNA 1MXTA 3P9UA 5EB4A 4OPTA 4EIQA 3ISHA 2AR8A 3SFEA 1CJ3A 1PXCA 2B9XA 2BC0A 3AEEA 3OZ2A 2Q0LA 3AE4A 1GRBA 4TM3A 4H4WA 4YSHA 3CN8A 2WP9A 1OJAA 1EBDA 3Q6JA 5KOWA 4AOXA 2I0ZA 5DBJA 1TDKA 2RGJA
chains in the Genus database with same CATH superfamily
3HYWA 3SY4A 2X50A 3MKCA 4BK3A 2NVKX 2RDXA 1TDEA 3HYVA 2QAEA 3MQTA 1EC7A 2OQYA 4I59A 1N5WC 4JDRA 3TTEA 4Z44A 1F8SA 1NU5A 2XVFA 4G6GA 1QJDA 2OLNA 3JZUA 1O94A 4MGGA 2OLAA 2PP1A 1WYGA 3BHFA 3JW7A 3DJDA 4Z1YA 3PK7A 4E8GA 3ALLA 2YQUA 4B68A 4BJZA 1S2QA 4YTPA 3MWCA 1V97A 2FJEA 2OVLA 2XYOA 2GQFA 2V61A 4EQSA 2A87A 2PMQA 3AE1A 3UKKA 2JBVA 3DG3A 2WOVA 2QJNA 3IHMA 3SR6B 4H4ZA 3MZNA 4J31A 1YEYA 3V5CA 2WBAA 3VDGA 1ZXIC 5U25A 4Z2TA 1CHUA 3FIMB 5U63A 3E1TA 3UXLA 3MSYA 4TM1A 4B65A 1AOGA 4B63A 3CPIG 3AYJA 2QA2A 1K0LA 4J2WA 4OPGA 2X8CA 2WDQA 3DDMA 2WU2A 3T37A 3VCNA 4A35A 3VRBA 3HZLA 2R4JA 1D4EA 4A79A 2CDUA 1B5QA 3T8QA 2HXTA 1GRHA 4PABA 2HZGA 3NVVB 5G5GB 3UKQA 4H4SA 1N61C 1FFUC 3QLDA 3PS9A 3MY9A 4B69A 4HNLA 3G5RA 4E5TA 1LVLA 2IVEA 3CIRA 1CC2A 4JY2A 1GRFA 3N6HA 1TDNA 2BXRA 3TOYA 2YLWA 2QGYA 3DGHA 3OPSA 5HY5A 3CNDA 4KPLA 1KD0A 3TWBA 3PG6A 1DJNA 3AD8B 4ZN0A 2EQ6A 2WPCA 4USQA 2AKMA 2I5QA 4NEVA 1KFYA 1DNCA 3HRDC 3NGCX 3L5OA 4Y4NA 4YWSA 4LIIA 1MO9A 1LQTA 1JU2A 1EC8A 1Q1RA 3SN0A 3BJSA 3DJJA 1D7YA 1SEZA 3CGDA 3CNJA 2C4CA 5EU9A 3BOXA 2XCGA 2VRMA 3M13A 1D4DA 1MDRA 3A7AA 3D8XA 2C3DA 5G5HB 1NHQA 2DW7A 2OFJA 3B97A 3CNSA 3RP6A 2P8CA 2GGJA 1H84A 2BABA 1PXAA 5FJOA 3KLJA 4G73A 3NHOX 1ZY8A 3DIPA 4BV6A 4ENLA 3DG7A 3H7VA 3NK1X 4RG4A 1NEKA 4K2SA 4NEWA 3FVDA 4IZGA 1FCDA 3T14A 3TWAA 2GSHA 2JKCA 3ABVA 2AKZA 3ICSA 3T2YA 1JCTA 1PS9A 2XDOA 3ATQA 3HW2A 1TKKA 3ZYXA 1STZA 1FHUA 5IQ1A 3GWFA 3QVPA 3CGBA 5ER0A 5JCKA 4TLZA 2MNRA 3NYEA 2V6OA 3NYFA 4CCQA 2F5ZA 3GD3A 1YQ3A 2Q7VA 2JAEA 3LZWA 4HYRA 2FJDA 1E1NA 3KKJA 1IUTA 3VRAA 3COXA 1LJ1A 3SJNA 1L9DA 4H83A 3UOYA 2XFPA 1GV4A 4WX1A 2ZZBA 1Z6LA 1R0MA 4J33A 4ICYA 4GYPA 3AB1A 2R45A 3AECA 1X31B 4EMWA 3NS1B 3GMCA 1JEHA 4YWOA 2OALA 4U2LA 2ZBWA 1N5XA 2YLTA 4C77A 3P1WA 3LB8A 3KUMA 3A7UA 4HN8A 3I3LA 2XVJA 2ONEA 1PN0A 3AEGA 3SX6A 1N63C 3AD7B 2R4EA 4UDPA 3KPKA 1L0VA 1FFVC 3RO6A 4TM4A 1H83A 4Z2RA 2PPGA 3D47A 2TMDA 1DOEA 4IA6A 3EF6A 2GAHB 3UTEA 2CHRA 1K0JA 4ZCCA 4H4UA 3NO1A 1SJDA 3V3WA 3KD9A 4PAAA 2E3TA 5KMSA 3K1GA 5BULA 3AE8A 3VR8A 3AYIA 2AL1A 1P2HA 4II3A 4NZHA 2PTZA 1WUEA 5FJTA 1MXTA 4G74A 5BOFA 1WUFA 2Q0LA 1GRBA 2QJMA 4YSHA 3CN8A 3Q6JA 5KOWA 3P93A 2GGEA 4KWSA 3S47A 4FDCB 4H4PA 1V59A 1TE6A 4ZOHB 1VG9A 3DK4A 4P9SA 1YQZA 3T0KA 3C4NA 3ICRA 5J60A 3LADA 3TJIA 5IPYA 2B7RA 1RYIA 2DKHA 2QVHA 1KKOA 4DN1A 2V60A 2Q6UA 3KA7A 3NN0X 2GV8A 4K5SA 1L9CA 4J34A 2PP0A 1P43A 2W0HA 4M6UA 3G5QA 3FXGA 4LU6A 1FHVA 4DYEA 4EQRA 3SXIA 2WP6A 3ICTA 1ECQA 3H8AA 5C3JA 2B76A 2OZ3A 3CTYA 4CNJA 3H8IA 2WDRA 1P48A 1RM6B 2PCEA 3ZLGA 3DFYA 3T2KA 2OAMA 2WS3A 2QA1A 2CFYA 1O95A 3CPJG 1ZOYA 1W4XA 2PA6A 3QPEA 4HPNA 3GYXA 4H50A 1VDVA 2XVHA 3IJQA 4J36A 4CBQA 5FS8A 1N60C 1LPFA 3R9UA 1N4UA 4WCTA 2C64A 1L8PA 3UOZA 1NHPA 1N4WA 3CGCA 2R9ZA 3ATRA 1JRYA 1Q1WA 2EQ9A 2YM1A 1PJ5A 2YVGA 3CB3A 4DHGA 1IUUA 2VZ2A 1CC6A 2MUCA 2VVLG 4OCGA 2IVDA 1IYXA 4N9XA 1FECA 2OLOA 2PODA 4RSLA 2XFUA 3CNPA 1E1KA 4J3ZA 3U4FA 3K7MX 3UOXA 4DNAA 4ADWA 3SZCA 3DJEA 5EOWA 3K7QX 1CJ2A 2GH5A 1EL7A 2JK6A 1K4QA 3A7RA 4HB9A 1FOHA 5BOEA 1XPQA 2OA1A 1GESA 1KDGA 4U2TA 4MKSA 3AE5A 4U8MA 2OZTA 3UP5A 4YXDA 4H2QA 2XLRA 1TZZA 3ADAB 3CXBA 5LV9A 5BVAA 1E6EA 3DGZA 1GRTA 1ZX9A 4GAPA 1FIQB 2W3SA 2WEUA 3QJ4A 1CJ4A 3CNTA 1JRPA 5KMRA 2QDDA 4FI4A 3UJEA 4XWRA 4H4QA 2YLZA 3VR9A 1NG4A 4EMJA 2GR0A 1Q9IA 1KN0A 2YR5A 2YLXA 1MOKA 3NIXA 2XH4A 2BXSA 2UZZA 3JSKA 4TVWA 2GR1A 1ZP0A 1KSUA 3T6CA 3IF9A 3VA8A 4A5LA 2XLSA 2C67A 1PBFA 3M0OA 3CYJA 2WESA 5KOXA 1NHRA 3SN1A 2HQMA 1JRZA 4H1ZA 4CY8A 4U8PA 4K8DA 3SZ0A 3CPHG 4O5UA 1O5WA 3B3RA 5JCNA 3OZMA 3SM8A 1JNZA 3CXOA 2BA9A 4O5QA 4D04A 1GTHA 2H89A 3GC2A 4F4RA 3UCCA 3CMMA 3IHGA 3F8PA 3DESA 2BC1A 3D46A 1S3EA 1PBBA 3RHAA 3P4RA 2DKIA 3DA1A 4XWZA 4AOSA 1ONFA 4GYPC 3URHA 2XLTA 1F3PA 3D9XA 1BWCA 1W6TA 4ZCDA 2VVMA 3DERA 1IUSA 1NHSA 3ITJA 3T4WA 3FBSA 1F8RA 3RNMA 3UJSA 3QSSA 2P0IA 3B9JB 1ZMDA 2C7GA 2O9ZA 4EM3A 4IL0A 1GRAA 4YSZA 2Y6QA 3H12A 4BJYA 3AM9A 2C70A 4ZCWA 3UCLA 2GDQA 5J7XA 5KMQA 1N1PA 3DH9A 3M12A 2BS2A 4KEMA 1ELIA 2R0GA 1BKHA 2WU5A 4OPUA 5KNLA 1EL9A 1XS2A 4FK1A 3P4QA 3EUB3 1PJ6A 2BK4A 3GSIA 4YSXA 3KVEA 3VQRA 1BQGA 4JN7A 2QCUA 4FX9A 4GAVA 3II4A 4H2RA 2JB1A 1XHCA 2B7SA 2V5ZA 4GGBA 1K0IA 3MUCA 3AE2A 2GRTA 1B8SA 4OPCA 1GPEA 1H2IA 4ECHA 3BI4A 1ZK7A 2CULA 3AMZA 2XFOA 4C3YA 1OJ9A 3TCSA 3NH3X 5FMHA 2ZZCA 2GMHA 2YWLA 1EL5A 5FJRA 3UGVA 2XSXA 4DSGA 4H19A 1YY5A 1PDYA 4CRTA 4NTDA 1GETA 1KSSA 4BK2A 2TPRA 2YAUA 3UTFA 2OKTA 4JNAA 2ZADA 3NRNA 3P9UA 1EBHA 5EB4A 4OPTA 4EIQA 1RVKA 3OZ2A 3AE4A 3ETRB 4AOXA 5DBJA 3SYIA 4E0VA 1NDAA 4H4TA 4J56A 3DEQA 2WETA 2VOUA 5FS9A 1JOAA 1DXLA 1R6WA 4APNA 1PBCA 2C73A 5KRQA 1GT8A 2HXUA 1PBDA 3DGBA 3SN4A 4NWZA 3AE3A 2QQ6A 3KU9A 3GYJA 1JDFA 5FJUA 3TW9A 2WPEA 1F8WA 3NZGA 4XXGA 2PTYA 1VG0A 2XH2A 3N4EA 3AEDA 4YTNA 4GMEA 1VRQB 3K7TA 3VCCA 4TVYA 2GGHA 3T31A 1GXFA 4IVMB 1YQ4A 3PFRA 2YG5A 2C76A 2ACZA 3P3BA 3UP4A 2PS2A 1ONEA 1OJDA 2Y6RA 3PVCA 3C4AA 3BNMA 4HCDA 3P0WA 3NVWB 2BCPA 3FV9A 3DK8A 3UTHA 1VQZA 3AD9B 3K30A 1X2GA 4I58A 5ENLA 2B9WA 3ZVIA 6ENLA 1CL0A 3UTGA 1FEAA 3ENLA 1E7PA 2WQYA 4G9KA 5U1OA 4GFIA 3V3OA 4NTEA 5HXIA 2CVJA 1VDCA 3ZVHB 3BSMA 3V76A 4U8NA 1COYA 2R46A 3LOVA 3DK9A 2V3BA 1ZDLA 1TYPA 4GIRA 3HYXA 1FO4A 1EC9A 2PTXA 2XFNA 2YLSA 3ALJA 1UKVG 2X8HA 4GUVA 2AQJA 4YT0A 3Q45A 2BK5A 1PDZA 4Z25A 5BRTA 3P4PA 4C74A 4A65A 3UJ2A 3IJIA 3UKFA 1GRGA 4UP3A 4K2XA 1QO8A 3OZYA 2WP5A 3R10A 1Y56B 3S61A 3QFBA 4Y4MA 1GOSA 4KPRA 1DOBA 1TRBA 2GGGA 3UKPA 1OJTA 1D5TA 3G5SA 2W54A 5KMPA 2FBWA 3EPTA 1S3BA 4CNKA 5FS6A 2GR3A 2YG3A 3GRSA 4H4VA 2X8GA 2FJBA 5KVIA 3ALMA 3RR1A 2V3AA 3AWIA 2XFQA 4M0XA 4GR1A 4CCRA 4A6GA 3FCPA 4DXKA 2YG4A 2GGIA 1H81A 4E4UA 3TJ4A 3IK4A 2P8BA 1B37A 3GY1A 1PJ7A 4FP1A 4KT2A 2X3NA 4AP1A 4G6HA 1NELA 4AT0A 2C75A 3REDA 2RABA 2C72A 4YSYA 1ZKQA 3F8DA 2RGOA 3AXBA 3KPFA 3ES7A 4Z43A 1LTXR 3V5FA 1MNSA 1IUVA 1H86A 3SFDA 3R11A 5EB5A 4GCMA 2XH0A 3VFCA 2X99A 1ZOVA 1LV0A 2JB3A 3S5SA 2QJJA 1H82A 5TR3A 1PDHA 2VQBA 4USRA 4BURA 3AN1A 1GERA 1RSGA 2YVJA 1BZLA 3RGTA 3GRTA 4U8LA 4X4JA 3TQPA 4K5RA 1XPYA 2WOWA 4U8KA 3F8RA 2PSNA 3NFUA 1FL2A 1N62C 4JNQA 3SQSA 4Z24A 1ELSA 4TLXA 1CF3A 1E1MA 2YVFA 3OTRA 3QKEA 1N4VA 4U8OA 3P4SA 3N4FA 3QTPA 4OVIA 3QFAA 1FEBA 2C65A 3L1RA 4J57A 1E39A 4H2HA 1XANA 4A6NB 1OJCA 4KX6A 4IA5A 1KNRA 2EQ7A 3O0HA 1JPDX 2PHHA 4JHMA 1D7LA 4M52A 7ENLA 3H8LA 2GEWA 1REOA 4A99A 4H4YA 2W3RA 4H2PA 2NQLA 3QN3A 4MJWA 1JROA 5L46A 4K7ZA 4K1WA 3GD6A 2PGWA 3AE6A 3IWAA 3HPFA 5EBKA 2HNEA 1DODA 2ARDA 3Q4DA 2XVEA 4IHCA 1GNDA 2YLRA 2H88A 4IV9A 3THUA 1H7WA 2BACA 3AYLA 5JCMA 2GR2A 4IP5A 1EL8A 3SBFA 5KVHA 2GVCA 4GISA 3H4KA 4A6NA 3AEBA 2XGZA 2E1MA 4HA6A 2PU0A 4BK1A 4H2NA 3NYCA 1XDIA 2AR8A 3SFEA 1PXCA 2B9XA 2BC0A 4H4WA 3VC6A 2WP9A 1OJAA 1EBDA 2OX4A 1S7MA 4A3RA 1TDKA 5FJPA 1PBEA 4H4RA 3R25A 3UKHA 5IQ4A 3NNEA 2J3NA 3NLCA 3L8KA 3H70A 4Y4LA 2PGEA 1E1LA 3S5WA 1X2HA 3UJFA 3SSZA 2YG6A 5JCIA 3R1ZA 1IJHA 1M64A 2GB0A 1VQWA 4X9MA 3NG7X 1D4CA 3FG2P 3WE0A 3RITA 5CKUA 5KWFA 2PP3A 2ZC8A 1NAAA 2YG7A 3STPA 3EKGA 4A9WA 4C3XA 2YR4A 3NK2X 1EBGA 3NRZB 1BF3A 1F6MA 3GWDA 1YKJA 2FJAA 4UDQA 4IP4A 3RP8A 3NK0X 5HHFA 1LQUA 3SGLA 2AAQA 2BRYA 4JN8A 2VRLA 3LJPA 2QDEA 4YKGA 1DJQA 3BI2A 4B1BA 1PHHA 3FPZA 3BNUA 1TDFA 1L9EA 1TYTA 3CAWA 3PWGA 2VVLA 4X2PA 1JPMA 3OC4A 3SQPA 4K22A 5HYMA 3V4BA 2WOIA 1JNRA 1KF6A 4EMIA 4YTMA 3DMEA 2C66A 3NN6X 2BS4A 4G8TA 4ROPA 4AT2A 1MUCA 3DFHA 5JRBA 2GQWA 3ZLHA 3QSMA 1NPXA 3ES8A 3NXLA 1CBOA 4DWDA 3UCDA 3U9IA 3T2ZA 3GYIA 3NKSA 1Y0PA 2NPXA 2EQ8A 2APGA 2GAGB 2C3CA 1KNPA 4GF7A 4IL2A 1P2EA 3IJLA 2YR6A 3ZDNA 3UKAA 1IUXA 1BGNA 3ZVHA 1M6IA 3CGEA 4H4XA 2JB2A 1TDOA 3RRAA 4U8IA 3T9PA 2ZZ0A 4LA1A 4J1OA 2OO6A 2FYMA 4OPIA 3DG6A 1IUWA 2OG9A 4G7FA 3PWIA 2WPFA 2Q0KA 2BYBA 3DJGX 2GMJA 2YM2A 4DX3A 2WDVA 3AE7A 4RG3A 1H7XA 1F9CA 3EAOA 4DGKA 2XLPA 3V3NA 4CY6A 4ZA0A 1GREA 4EWJA 3R0KA 4NTCA 4U2SA 4GDEA 4EQXA 1GSNA 1GALA 2A8XA 4HCLA 1RP0A 2IIDA 2RGHA 3R07C 1SJCA 4OPDA 2PU1A 2OPJA 1T3QC 1SB3B 3GD4A 4C5OA 2R0PA 3I6DA 2PTWA 4EQWA 2XVIA 3QSEA 3PO7A 3NTDA 3FJ4A 3LXDA 1NENA 1CC4A 4TM0A 2GF3A 1Y56A 2P88A 5FS7A 4Z17A 3GDPA 3OW1A 2BRAA 4U8JA 5M0ZA 3GDNA 3FMWA 3EEZA 4Z2UA 4GGHA 4REKA 3RCYA 5GRTA 3EANA 1OEPA 4OPLA 2XLUA 4H7UA 3JVAA 1BKWA 4UDRA 2Z5YA 2B9YA 4AP3A 2R0CA 3CT2A 2E5VA 3AEAA 3VRDB 3UKLA 3SZWA 3UOVA 2OQHA 2AL2B 1GTEA 1DOCA 4X9NA 4FK1C 3I4KA 1CJCA 4GRTA 2FKPA 1S2YA 5BUKA 2Z5XA 3UJRA 3ZLFA 5C2TA 3GMBA 4YKFA 2W55A 1MDLA 4JQ9A 4B67A 1NG3A 4II2A 3VC5A 1B4VA 1JRXA 4K8GA 4E6MA 5GSNA 5M10A 3I6EA 1ZMCA 3CK5A 5CQFA 2XH7A 3C96A 5J04A 4DSHA 3NT6A 5JCLA 4E4FA 5KXJA 2POZA 4NNJA 2AL2A 3N6JA 2WHDA 4Z26A 2A89A 3UXKA 1DTNA 3NVYB 4B64A 1BGJA 1PXBA 2BS3A 3Q9TA 1SJAA 2VQ7A 3NVZB 3RP7A 1SJBA 3OP2A 4HNCA 4JY3A 4IVOB 3BI5A 4A7AA 3QVRA 2BCGG 2E4GA 3FYYA 3LZXA 1MRAA 4D03A 2P3ZA 3IC9A 4IT1A 1HYUA 4GDPA 1QLBA 3BHKA 1KCZA 2OZ8A 4EM4A 4HCHA 3I6TA 2O56A 2GL5A 4EIPA 3SZFA 3D1CA 1GEUA 3AEFA 4JN9A 1H6VA 3B6DA 3R0UA 2DW6A 2BK3A 3NTAA 2PYXA 4B66A 3AE9A 2E5AA 3GO2A 5IDZA 1KKRA 3ISHA 1CJ3A 4MMWA 3AEEA 4TM3A 1E9IA 2I0ZA 2RGJA
chains in the Genus database with same CATH topology
4FDCB 4H4PA 1PBEA 3HYWA 3SY4A 3SYIA 4E0VA 1V59A 2X50A 4H4RA 4BK3A 2NVKX 1VG9A 3DK4A 1TDEA 1NDAA 3HYVA 4H4TA 4P9SA 1YQZA 3T0KA 3UKHA 5IQ4A 3NNEA 4J56A 2QAEA 2J3NA 3C4NA 2WETA 4I59A 2VOUA 4JDRA 5FS9A 3NLCA 3L8KA 3ICRA 1JOAA 4Z44A 5J60A 1F8SA 1DXLA 3LADA 5IPYA 4Y4LA 2B7RA 1E1LA 2XVFA 4APNA 4G6GA 1RYIA 2DKHA 3S5WA 1QJDA 2OLNA 1PBCA 2V60A 2Q6UA 2YG6A 5JCIA 1O94A 2C73A 3KA7A 2GV8A 3NN0X 4K5SA 5KRQA 3BHFA 1IJHA 1GT8A 1L9CA 1M64A 2W0HA 2GB0A 3DJDA 1PBDA 3G5QA 4J34A 3ALLA 2YQUA 1VQWA 4B68A 4X9MA 3NG7X 4NWZA 4LU6A 3AE3A 4BJZA 4EQRA 1D4CA 1S2QA 3SXIA 2WP6A 3ICTA 4YTPA 3FG2P 3KU9A 3WE0A 3GYJA 5CKUA 5C3JA 2B76A 5KWFA 2WPEA 2FJEA 3CTYA 4CNJA 2XYOA 2GQFA 2V61A 1F8WA 2WDRA 4EQSA 1NAAA 2YG7A 3H8IA 4XXGA 2A87A 1VG0A 4A9WA 4C3XA 2YR4A 3AE1A 3NK2X 3UKKA 3AEDA 2JBVA 3T2KA 4YTNA 2WOVA 1VRQB 2OAMA 2WS3A 3IHMA 2QA1A 3K7TA 2CFYA 1BF3A 1O95A 3CPJG 1ZOYA 1W4XA 4H4ZA 1F6MA 3GWDA 1YKJA 2FJAA 3GYXA 4H50A 2XVHA 3T31A 1GXFA 4J36A 4IVMB 4UDQA 4J31A 4CBQA 5FS8A 1YQ4A 1LPFA 3RP8A 2WBAA 3NK0X 5HHFA 5U25A 2YG5A 2C76A 1LQUA 3SGLA 3R9UA 1N4UA 4WCTA 1CHUA 2C64A 4Z2TA 2ACZA 3FIMB 5U63A 2AAQA 2BRYA 3E1TA 2VRLA 3LJPA 4TM1A 4B65A 3UOZA 1AOGA 4B63A 1NHPA 1N4WA 3CPIG 3UP4A 3AYJA 3CGCA 1OJDA 4YKGA 2Y6RA 1DJQA 3BI2A 2R9ZA 1K0LA 2QA2A 3ATRA 4J2WA 4B1BA 4OPGA 1JRYA 1PHHA 2X8CA 2WDQA 1Q1WA 3PVCA 2EQ9A 2YM1A 3C4AA 1PJ5A 2WU2A 3T37A 3FPZA 3BNUA 3BNMA 2YVGA 3VRBA 1TDFA 1IUUA 2BCPA 2VZ2A 2R4JA 1CC6A 3DK8A 1D4EA 1L9EA 3HZLA 3UTHA 1TYTA 4A79A 2CDUA 3AD9B 2VVLA 2VVLG 3K30A 1B5QA 4OCGA 4I58A 2IVDA 4N9XA 1FECA 1GRHA 2B9WA 1CL0A 3SQPA 3OC4A 2OLOA 4PABA 4K22A 1FEAA 3UTGA 5HYMA 4H4SA 4RSLA 2XFUA 2WOIA 1E7PA 2WQYA 3CNPA 4G9KA 3UKQA 1JNRA 5U1OA 1KF6A 1E1KA 3K7MX 3UOXA 4DNAA 3V3OA 4EMIA 3PS9A 4ADWA 4YTMA 3SZCA 4NTEA 3DJEA 5EOWA 3K7QX 3DMEA 5HXIA 2CVJA 4B69A 2C66A 1CJ2A 2GH5A 1VDCA 1EL7A 3NN6X 2JK6A 2BS4A 3G5RA 1K4QA 4HB9A 3V76A 1FOHA 1XPQA 1LVLA 1COYA 2OA1A 2IVEA 2R46A 3CIRA 4U8NA 3LOVA 4AT2A 1GESA 1CC2A 5JRBA 2GQWA 1KDGA 4U2TA 3DK9A 2V3BA 3QSMA 4JY2A 1GRFA 1NPXA 1TDNA 3AE5A 4U8MA 1ZDLA 1TYPA 2BXRA 1CBOA 3UP5A 4YXDA 3HYXA 2YLWA 2XLRA 4H2QA 3ADAB 3DGHA 5HY5A 3T2ZA 3CNDA 2XFNA 3GYIA 3NKSA 2YLSA 5LV9A 1Y0PA 2NPXA 5BVAA 2EQ8A 1E6EA 2APGA 2GAGB 2C3CA 3ALJA 1UKVG 2X8HA 3PG6A 1KNPA 4GF7A 3DGZA 1DJNA 1GRTA 1ZX9A 1P2EA 4GUVA 2AQJA 3AD8B 2YR6A 4GAPA 3UKAA 3ZDNA 1IUXA 4YT0A 2BK5A 2EQ6A 2WPCA 4USQA 4ZN0A 2WEUA 1BGNA 1M6IA 3CGEA 4H4XA 2JB2A 1CJ4A 3QJ4A 1TDOA 3CNTA 5KMRA 4U8IA 4NEVA 1KFYA 2ZZ0A 1DNCA 3NGCX 4LA1A 4Z25A 3L5OA 4OPIA 1IUWA 5BRTA 4XWRA 4Y4NA 4LIIA 3P4PA 1MO9A 2WPFA 2Q0KA 1LQTA 4H4QA 2BYBA 2YLZA 3VR9A 1NG4A 4EMJA 2GR0A 1JU2A 1Q9IA 4A65A 4C74A 1KN0A 1Q1RA 3UKFA 3DJGX 2GMJA 2YR5A 3DJJA 1GRGA 2YM2A 4UP3A 1D7YA 2WDVA 4K2XA 1SEZA 1QO8A 1MOKA 2YLXA 3AE7A 3CGDA 4RG3A 3CNJA 1H7XA 2WP5A 3NIXA 3EAOA 2C4CA 1Y56B 3S61A 3QFBA 2BXSA 4DGKA 2UZZA 3JSKA 4Y4MA 1GOSA 2XLPA 2XCGA 3V3NA 2VRMA 4CY6A 2GR1A 3M13A 4KPRA 1DOBA 1ZP0A 1TRBA 1KSUA 1D4DA 1GREA 3UKPA 1OJTA 1D5TA 3G5SA 3IF9A 5KMPA 2FBWA 4NTCA 3EPTA 4A5LA 1S3BA 4U2SA 3D8XA 5FS6A 2C3DA 4GDEA 4EQXA 4CNKA 2GR3A 1GSNA 1NHQA 1GALA 2XLSA 2YG3A 2C67A 1PBFA 3CNSA 3GRSA 3RP6A 4H4VA 2A8XA 2X8GA 1RP0A 3M0OA 1H84A 2BABA 2FJBA 5KVIA 1PXAA 2IIDA 2WESA 4B64A 2RGHA 3ALMA 5KOXA 2V3AA 3KLJA 4OPDA 1NHRA 4G73A 3NHOX 3AWIA 2HQMA 2XFQA 3GD4A 1ZY8A 1JRZA 4C5OA 4CY8A 2R0PA 3I6DA 4GR1A 4EQWA 2XVIA 3QSEA 4U8PA 4K8DA 4BV6A 4CCRA 3PO7A 3NTDA 3SZ0A 3CPHG 3LXDA 1NENA 1CC4A 2YG4A 4O5UA 1O5WA 1H81A 3NK1X 2GF3A 3B3RA 4RG4A 1Y56A 4TM0A 1NEKA 5JCNA 5FS7A 3GDPA 4NEWA 3SM8A 1JNZA 2BRAA 4U8JA 5M0ZA 1FCDA 3GDNA 3T14A 1B37A 1PJ7A 2BA9A 3FMWA 4O5QA 4Z2UA 2JKCA 4REKA 5GRTA 2X3NA 4AP1A 4G6HA 3EANA 4D04A 3ABVA 4OPLA 1GTHA 2H89A 2C75A 4AT0A 3REDA 2XLUA 4H7UA 2RABA 3ICSA 3T2YA 1BKWA 1PS9A 2C72A 4YSYA 2XDOA 4UDRA 3CMMA 2Z5YA 1ZKQA 3F8DA 2RGOA 3IHGA 3F8PA 3AXBA 2BC1A 3KPFA 3ATQA 1S3EA 2B9YA 3ZYXA 4AP3A 2R0CA 1PBBA 1LTXR 3RHAA 3P4RA 4Z43A 2DKIA 3DA1A 5IQ1A 2E5VA 3AEAA 3VRDB 3GWFA 3QVPA 3UKLA 1IUVA 1H86A 4XWZA 3CGBA 5ER0A 3SFDA 3SZWA 3UOVA 5EB5A 4AOSA 1ONFA 5JCKA 4GCMA 4TLZA 3URHA 2X99A 1GTEA 1ZOVA 1LV0A 3NYEA 1DOCA 2XLTA 2V6OA 3NYFA 2JB3A 1H82A 4X9NA 4FK1C 5TR3A 1CJCA 2F5ZA 4CCQA 1F3PA 1PDHA 3D9XA 1BWCA 3GD3A 1YQ3A 2VQBA 2Q7VA 4GRTA 4USRA 2JAEA 4BURA 4ZCDA 2VVMA 1GERA 1RSGA 3LZWA 1IUSA 2FJDA 1E1NA 2YVJA 1NHSA 1S2YA 3KKJA 1IUTA 2Z5XA 5BUKA 3VRAA 1BZLA 3COXA 3ITJA 3FBSA 3GRTA 4U8LA 1LJ1A 1F8RA 1L9DA 4X4JA 5C2TA 3RNMA 3GMBA 4YKFA 3UOYA 2XFPA 1GV4A 4K5RA 4WX1A 3QSSA 2ZZBA 1Z6LA 2WOWA 4JQ9A 4B67A 1NG3A 4U8KA 4II2A 1ZMDA 1B4VA 3F8RA 4J33A 1JRXA 4ICYA 2C7GA 2O9ZA 4EM3A 3AB1A 2R45A 1FL2A 1GRAA 3AECA 5GSNA 4JNQA 5M10A 4Z24A 4YSZA 1ZMCA 2Y6QA 4TLXA 1X31B 4EMWA 1CF3A 2C70A 3GMCA 5CQFA 1E1MA 4BJYA 1JEHA 4YWOA 3C96A 3UCLA 2YVFA 5J7XA 2OALA 1N1PA 5KMQA 4DSHA 3DH9A 3M12A 2BS2A 3NT6A 4U2LA 1N4VA 5JCLA 3P4SA 4U8OA 2ZBWA 1ELIA 2R0GA 2YLTA 2WU5A 4OVIA 3QFAA 5KXJA 4C77A 1FEBA 4OPUA 4NNJA 2C65A 3L1RA 5KNLA 4J57A 3P1WA 2WHDA 1EL9A 1E39A 3LB8A 4Z26A 2A89A 1XANA 4A6NB 1OJCA 4FK1A 3P4QA 4KX6A 1BGJA 1PJ6A 2BK4A 3GSIA 3I3LA 1KNRA 1PXBA 2BS3A 3Q9TA 2VQ7A 4IA5A 4YSXA 2EQ7A 3KVEA 3O0HA 2XVJA 3VQRA 3RP7A 1PN0A 2QCUA 3AEGA 2PHHA 3SX6A 4FX9A 4GAVA 3II4A 2R4EA 3AD7B 4H2RA 4JY3A 4IVOB 1D7LA 3BI5A 4M52A 2JB1A 4A7AA 3H8LA 1XHCA 2GEWA 1REOA 4UDPA 2B7SA 2V5ZA 4A99A 3QVRA 4H4YA 3KPKA 1K0IA 2BCGG 2E4GA 3LZXA 4H2PA 1L0VA 3AE2A 4MJWA 4D03A 2GRTA 4TM4A 1B8SA 5L46A 4K7ZA 1H83A 3IC9A 3AE6A 1HYUA 4Z2RA 3IWAA 4GDPA 4OPCA 5EBKA 1GPEA 1QLBA 2TMDA 1H2IA 3BHKA 1DODA 4ECHA 4EM4A 1DOEA 3BI4A 4IA6A 1ZK7A 3EF6A 2ARDA 2CULA 2GAHB 2XVEA 2XFOA 1GNDA 2YLRA 3UTEA 2H88A 4C3YA 1K0JA 4ZCCA 4IV9A 1OJ9A 4EIPA 4H4UA 3SZFA 1H7WA 2BACA 3AYLA 5JCMA 2GR2A 3KD9A 5FMHA 2ZZCA 2GMHA 3NH3X 2YWLA 4PAAA 1EL5A 1EL8A 5KMSA 3D1CA 5BULA 1GEUA 3AEFA 4JN9A 3AE8A 5KVHA 1H6VA 3B6DA 4DSGA 2GVCA 3AYIA 1YY5A 3VR8A 3H4KA 4CRTA 4NTDA 4A6NA 3AEBA 1GETA 1P2HA 4II3A 4NZHA 1KSSA 2BK3A 2E1MA 4HA6A 4BK2A 2TPRA 4BK1A 2YAUA 4H2NA 3NTAA 3UTFA 2PYXA 4B66A 4JNAA 3AE9A 3NYCA 1XDIA 3NRNA 1MXTA 3P9UA 4G74A 5EB4A 4OPTA 4EIQA 3ISHA 2AR8A 3SFEA 1CJ3A 1PXCA 2B9XA 2BC0A 3AEEA 3OZ2A 2Q0LA 3AE4A 1GRBA 4TM3A 4H4WA 4YSHA 3CN8A 2WP9A 1OJAA 1EBDA 3Q6JA 5KOWA 4AOXA 1S7MA 2I0ZA 5DBJA 1TDKA 2RGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FDC B;  4H4P A;  1PBE A;  4E0V A;  1V59 A;  2X50 A;  4H4R A;  4BK3 A;  2NVK X;  1VG9 A;  3DK4 A;  1TDE A;  1NDA A;  3UKH A;  4H4T A;  4P9S A;  1YQZ A;  5IQ4 A;  3NNE A;  4J56 A;  2QAE A;  2J3N A;  3C4N A;  2WET A;  4I59 A;  2VOU A;  4JDR A;  5FS9 A;  3NLC A;  3L8K A;  3ICR A;  1JOA A;  4Z44 A;  5J60 A;  1F8S A;  1DXL A;  3LAD A;  5IPY A;  4Y4L A;  2B7R A;  1E1L A;  2XVF A;  4APN A;  3S5W A;  1RYI A;  2DKH A;  1QJD A;  2OLN A;  1PBC A;  2V60 A;  2Q6U A;  2YG6 A;  5JCI A;  1O94 A;  2C73 A;  3KA7 A;  2GV8 A;  3NN0 X;  4K5S A;  5KRQ A;  3BHF A;  1IJH A;  1GT8 A;  1L9C A;  1M64 A;  2W0H A;  2GB0 A;  3DJD A;  1PBD A;  3G5Q A;  4J34 A;  3ALL A;  2YQU A;  1VQW A;  4B68 A;  4X9M A;  3NG7 X;  4BJZ A;  4LU6 A;  3AE3 A;  4EQR A;  1D4C A;  1S2Q A;  2WP6 A;  3ICT A;  4YTP A;  3FG2 P;  3KU9 A;  3WE0 A;  3GYJ A;  5CKU A;  5C3J A;  2B76 A;  5KWF A;  2WPE A;  2FJE A;  3CTY A;  4CNJ A;  2XYO A;  2GQF A;  2V61 A;  1F8W A;  2WDR A;  4EQS A;  1NAA A;  2YG7 A;  3H8I A;  4XXG A;  2A87 A;  1VG0 A;  4A9W A;  4C3X A;  2YR4 A;  3AE1 A;  3NK2 X;  3UKK A;  3AED A;  2JBV A;  4YTN A;  2WOV A;  1VRQ B;  2OAM A;  2WS3 A;  3IHM A;  2QA1 A;  3K7T A;  2CFY A;  1BF3 A;  1O95 A;  3CPJ G;  1ZOY A;  1W4X A;  4H4Z A;  1F6M A;  3GWD A;  1YKJ A;  2FJA A;  4H50 A;  2XVH A;  1GXF A;  4J36 A;  4IVM B;  4UDQ A;  4J31 A;  4CBQ A;  5FS8 A;  1YQ4 A;  1LPF A;  3RP8 A;  2WBA A;  3NK0 X;  5HHF A;  5U25 A;  2YG5 A;  2C76 A;  1LQU A;  3SGL A;  3R9U A;  1N4U A;  4WCT A;  1CHU A;  2C64 A;  4Z2T A;  2ACZ A;  3FIM B;  5U63 A;  2AAQ A;  3E1T A;  2VRL A;  3LJP A;  4TM1 A;  4B65 A;  3UOZ A;  1AOG A;  4B63 A;  1NHP A;  1N4W A;  3CPI G;  3UP4 A;  3AYJ A;  3CGC A;  1OJD A;  4YKG A;  2Y6R A;  1DJQ A;  3BI2 A;  2R9Z A;  1K0L A;  2QA2 A;  3ATR A;  4J2W A;  4B1B A;  4OPG A;  1JRY A;  1PHH A;  2X8C A;  2WDQ A;  1Q1W A;  3PVC A;  2EQ9 A;  2YM1 A;  3C4A A;  1PJ5 A;  2WU2 A;  3T37 A;  3FPZ A;  3BNU A;  3BNM A;  2YVG A;  3VRB A;  1TDF A;  1IUU A;  2BCP A;  2VZ2 A;  2R4J A;  1CC6 A;  3DK8 A;  1D4E A;  1L9E A;  3HZL A;  3UTH A;  1TYT A;  4A79 A;  2CDU A;  3AD9 B;  2VVL A;  2VVL G;  3K30 A;  1B5Q A;  4OCG A;  4I58 A;  2IVD A;  4N9X A;  1FEC A;  1GRH A;  2B9W A;  1CL0 A;  3SQP A;  3OC4 A;  2OLO A;  4PAB A;  4K22 A;  1FEA A;  3UTG A;  5HYM A;  4H4S A;  4RSL A;  2XFU A;  2WOI A;  1E7P A;  2WQY A;  3CNP A;  3UKQ A;  1JNR A;  5U1O A;  1KF6 A;  1E1K A;  3K7M X;  3UOX A;  4DNA A;  3V3O A;  4EMI A;  3PS9 A;  4ADW A;  4YTM A;  4NTE A;  3DJE A;  5EOW A;  3K7Q X;  3DME A;  5HXI A;  2CVJ A;  4B69 A;  2C66 A;  1CJ2 A;  2GH5 A;  1VDC A;  1EL7 A;  3NN6 X;  2JK6 A;  2BS4 A;  3G5R A;  1K4Q A;  4HB9 A;  3V76 A;  1FOH A;  1XPQ A;  1LVL A;  1COY A;  2OA1 A;  2IVE A;  2R46 A;  3CIR A;  4U8N A;  3LOV A;  4AT2 A;  1GES A;  1CC2 A;  1KDG A;  2GQW A;  4U2T A;  3DK9 A;  2V3B A;  3QSM A;  4JY2 A;  1GRF A;  1NPX A;  1TDN A;  3AE5 A;  4U8M A;  1ZDL A;  1TYP A;  2BXR A;  1CBO A;  3UP5 A;  4YXD A;  2YLW A;  2XLR A;  4H2Q A;  3ADA B;  3DGH A;  5HY5 A;  3CND A;  2XFN A;  3GYI A;  3NKS A;  2YLS A;  5LV9 A;  1Y0P A;  2NPX A;  5BVA A;  2EQ8 A;  1E6E A;  2APG A;  2GAG B;  2C3C A;  3ALJ A;  1UKV G;  2X8H A;  1KNP A;  4GF7 A;  3DGZ A;  1DJN A;  1GRT A;  1ZX9 A;  1P2E A;  4GUV A;  2AQJ A;  3AD8 B;  2YR6 A;  3ZDN A;  3UKA A;  1IUX A;  4YT0 A;  2BK5 A;  2EQ6 A;  2WPC A;  4USQ A;  4ZN0 A;  2WEU A;  1BGN A;  1M6I A;  3CGE A;  4H4X A;  2JB2 A;  1CJ4 A;  3QJ4 A;  1TDO A;  3CNT A;  4U8I A;  4NEV A;  1KFY A;  2ZZ0 A;  1DNC A;  3NGC X;  4LA1 A;  4Z25 A;  4OPI A;  1IUW A;  5BRT A;  4XWR A;  4Y4N A;  4LII A;  3P4P A;  1MO9 A;  2WPF A;  2Q0K A;  1LQT A;  4H4Q A;  2BYB A;  2YLZ A;  3VR9 A;  1NG4 A;  4EMJ A;  2GR0 A;  1JU2 A;  1Q9I A;  4A65 A;  4C74 A;  1Q1R A;  3UKF A;  3DJG X;  2GMJ A;  2YR5 A;  3DJJ A;  1GRG A;  2YM2 A;  4UP3 A;  1D7Y A;  2WDV A;  4K2X A;  1SEZ A;  1QO8 A;  1MOK A;  2YLX A;  3AE7 A;  3CGD A;  4RG3 A;  3CNJ A;  1H7X A;  2WP5 A;  3NIX A;  3EAO A;  1Y56 B;  3S61 A;  3QFB A;  2BXS A;  4DGK A;  2UZZ A;  3JSK A;  4Y4M A;  1GOS A;  2XLP A;  2XCG A;  3V3N A;  2VRM A;  4CY6 A;  2GR1 A;  3M13 A;  4KPR A;  1DOB A;  1ZP0 A;  1TRB A;  1KSU A;  1D4D A;  1GRE A;  3UKP A;  1OJT A;  1D5T A;  3G5S A;  3IF9 A;  2FBW A;  4NTC A;  3EPT A;  4A5L A;  1S3B A;  4U2S A;  3D8X A;  5FS6 A;  2C3D A;  4GDE A;  4EQX A;  4CNK A;  2GR3 A;  1GSN A;  1NHQ A;  1GAL A;  2XLS A;  2YG3 A;  2C67 A;  1PBF A;  3CNS A;  3GRS A;  3RP6 A;  4H4V A;  2A8X A;  2X8G A;  1RP0 A;  3M0O A;  1H84 A;  2BAB A;  2FJB A;  5KVI A;  1PXA A;  2IID A;  2WES A;  4B64 A;  2RGH A;  3ALM A;  5KOX A;  3KLJ A;  2V3A A;  4OPD A;  1NHR A;  3NHO X;  3AWI A;  2HQM A;  2XFQ A;  3GD4 A;  1ZY8 A;  1JRZ A;  4C5O A;  4CY8 A;  2R0P A;  3I6D A;  4GR1 A;  4EQW A;  2XVI A;  3QSE A;  4U8P A;  4K8D A;  4BV6 A;  4CCR A;  3PO7 A;  3NTD A;  3CPH G;  3LXD A;  1NEN A;  1CC4 A;  2YG4 A;  4O5U A;  1O5W A;  1H81 A;  3NK1 X;  2GF3 A;  3B3R A;  4RG4 A;  1Y56 A;  4TM0 A;  1NEK A;  5JCN A;  5FS7 A;  3GDP A;  4NEW A;  3SM8 A;  1JNZ A;  5M0Z A;  4U8J A;  1FCD A;  3GDN A;  1B37 A;  1PJ7 A;  2BA9 A;  3FMW A;  4O5Q A;  4Z2U A;  2JKC A;  4REK A;  5GRT A;  2X3N A;  4AP1 A;  3EAN A;  4D04 A;  3ABV A;  4OPL A;  1GTH A;  2H89 A;  2C75 A;  4AT0 A;  3RED A;  2XLU A;  4H7U A;  2RAB A;  3ICS A;  1BKW A;  1PS9 A;  2C72 A;  4YSY A;  2XDO A;  4UDR A;  2Z5Y A;  1ZKQ A;  3F8D A;  2RGO A;  3IHG A;  3F8P A;  3AXB A;  2BC1 A;  3KPF A;  3ATQ A;  1S3E A;  2B9Y A;  3ZYX A;  4AP3 A;  2R0C A;  1PBB A;  1LTX R;  3RHA A;  3P4R A;  4Z43 A;  2DKI A;  3DA1 A;  5IQ1 A;  2E5V A;  3AEA A;  3VRD B;  3GWF A;  3QVP A;  3UKL A;  1IUV A;  1H86 A;  4XWZ A;  3CGB A;  5ER0 A;  3SFD A;  3UOV A;  5EB5 A;  4AOS A;  1ONF A;  5JCK A;  4GCM A;  4TLZ A;  3URH A;  2X99 A;  1GTE A;  1ZOV A;  1LV0 A;  3NYE A;  1DOC A;  2XLT A;  2V6O A;  3NYF A;  2JB3 A;  1H82 A;  4X9N A;  4FK1 C;  5TR3 A;  1CJC A;  2F5Z A;  4CCQ A;  1F3P A;  1PDH A;  1BWC A;  3GD3 A;  1YQ3 A;  2VQB A;  2Q7V A;  4GRT A;  4USR A;  2JAE A;  4BUR A;  4ZCD A;  2VVM A;  1GER A;  1RSG A;  3LZW A;  1IUS A;  2FJD A;  1E1N A;  2YVJ A;  1NHS A;  1S2Y A;  3KKJ A;  1IUT A;  2Z5X A;  5BUK A;  3VRA A;  1BZL A;  3COX A;  3ITJ A;  3FBS A;  3GRT A;  4U8L A;  1LJ1 A;  1F8R A;  1L9D A;  4X4J A;  5C2T A;  3RNM A;  3GMB A;  4YKF A;  3UOY A;  2XFP A;  1GV4 A;  4K5R A;  4WX1 A;  3QSS A;  2ZZB A;  1Z6L A;  2WOW A;  4JQ9 A;  4B67 A;  1NG3 A;  4U8K A;  1ZMD A;  1B4V A;  3F8R A;  4J33 A;  1JRX A;  4ICY A;  2C7G A;  2O9Z A;  4EM3 A;  3AB1 A;  2R45 A;  1FL2 A;  1GRA A;  3AEC A;  5GSN A;  4JNQ A;  5M10 A;  4Z24 A;  4YSZ A;  1ZMC A;  2Y6Q A;  4TLX A;  1X31 B;  4EMW A;  1CF3 A;  2C70 A;  3GMC A;  5CQF A;  1E1M A;  4BJY A;  1JEH A;  4YWO A;  3C96 A;  3UCL A;  2YVF A;  5J7X A;  2OAL A;  1N1P A;  4DSH A;  3DH9 A;  3M12 A;  2BS2 A;  3NT6 A;  4U2L A;  1N4V A;  5JCL A;  3P4S A;  4U8O A;  2ZBW A;  1ELI A;  2R0G A;  2YLT A;  2WU5 A;  4OVI A;  3QFA A;  5KXJ A;  4C77 A;  1FEB A;  4OPU A;  2C65 A;  3L1R A;  4J57 A;  3P1W A;  2WHD A;  1EL9 A;  1E39 A;  3LB8 A;  4Z26 A;  2A89 A;  1XAN A;  4A6N B;  1OJC A;  4FK1 A;  3P4Q A;  4KX6 A;  1BGJ A;  1PJ6 A;  2BK4 A;  3GSI A;  3I3L A;  1KNR A;  1PXB A;  2BS3 A;  3Q9T A;  2VQ7 A;  4IA5 A;  4YSX A;  2EQ7 A;  3KVE A;  3O0H A;  2XVJ A;  3VQR A;  3RP7 A;  1PN0 A;  2QCU A;  3AEG A;  2PHH A;  4FX9 A;  3II4 A;  2R4E A;  3AD7 B;  4H2R A;  4JY3 A;  4IVO B;  1D7L A;  3BI5 A;  4M52 A;  2JB1 A;  4A7A A;  3H8L A;  1XHC A;  2GEW A;  1REO A;  4UDP A;  2B7S A;  2V5Z A;  4A99 A;  3QVR A;  4H4Y A;  1K0I A;  2BCG G;  2E4G A;  3LZX A;  4H2P A;  1L0V A;  3AE2 A;  4MJW A;  4D03 A;  2GRT A;  4TM4 A;  1B8S A;  5L46 A;  4K7Z A;  1H83 A;  3IC9 A;  3AE6 A;  1HYU A;  4Z2R A;  3IWA A;  4GDP A;  4OPC A;  5EBK A;  1GPE A;  1QLB A;  2TMD A;  3BHK A;  1DOD A;  4ECH A;  4EM4 A;  1DOE A;  3BI4 A;  4IA6 A;  1ZK7 A;  3EF6 A;  2ARD A;  2CUL A;  2GAH B;  2XVE A;  2XFO A;  1GND A;  2YLR A;  3UTE A;  2H88 A;  4C3Y A;  1K0J A;  4ZCC A;  4IV9 A;  1OJ9 A;  4EIP A;  4H4U A;  1H7W A;  2BAC A;  3AYL A;  5JCM A;  2GR2 A;  3KD9 A;  5FMH A;  2ZZC A;  2GMH A;  3NH3 X;  2YWL A;  4PAA A;  1EL5 A;  1EL8 A;  3D1C A;  5BUL A;  1GEU A;  3AEF A;  4JN9 A;  3AE8 A;  5KVH A;  1H6V A;  3B6D A;  4DSG A;  2GVC A;  3AYI A;  1YY5 A;  3VR8 A;  3H4K A;  4CRT A;  4NTD A;  4A6N A;  3AEB A;  1GET A;  1P2H A;  4NZH A;  1KSS A;  2BK3 A;  2E1M A;  4HA6 A;  4BK2 A;  2TPR A;  4BK1 A;  2YAU A;  4H2N A;  3NTA A;  3UTF A;  2PYX A;  4B66 A;  4JNA A;  3AE9 A;  3NYC A;  1XDI A;  3NRN A;  1MXT A;  3P9U A;  5EB4 A;  4OPT A;  4EIQ A;  3ISH A;  2AR8 A;  3SFE A;  1CJ3 A;  1PXC A;  2B9X A;  2BC0 A;  3AEE A;  3OZ2 A;  2Q0L A;  3AE4 A;  1GRB A;  4TM3 A;  4H4W A;  4YSH A;  3CN8 A;  2WP9 A;  1OJA A;  1EBD A;  3Q6J A;  5KOW A;  4AOX A;  2I0Z A;  5DBJ A;  1TDK A;  2RGJ A; 
#chains in the Genus database with same CATH topology
 3HYW A;  3SY4 A;  2X50 A;  3MKC A;  4BK3 A;  2NVK X;  2RDX A;  1TDE A;  3HYV A;  2QAE A;  3MQT A;  1EC7 A;  2OQY A;  4I59 A;  1N5W C;  4JDR A;  3TTE A;  4Z44 A;  1F8S A;  1NU5 A;  2XVF A;  4G6G A;  1QJD A;  2OLN A;  3JZU A;  1O94 A;  4MGG A;  2OLA A;  2PP1 A;  1WYG A;  3BHF A;  3JW7 A;  3DJD A;  4Z1Y A;  3PK7 A;  4E8G A;  3ALL A;  2YQU A;  4B68 A;  4BJZ A;  1S2Q A;  4YTP A;  3MWC A;  1V97 A;  2FJE A;  2OVL A;  2XYO A;  2GQF A;  2V61 A;  4EQS A;  2A87 A;  2PMQ A;  3AE1 A;  3UKK A;  2JBV A;  3DG3 A;  2WOV A;  2QJN A;  3IHM A;  3SR6 B;  4H4Z A;  3MZN A;  4J31 A;  1YEY A;  3V5C A;  2WBA A;  3VDG A;  1ZXI C;  5U25 A;  4Z2T A;  1CHU A;  3FIM B;  5U63 A;  3E1T A;  3UXL A;  3MSY A;  4TM1 A;  4B65 A;  1AOG A;  4B63 A;  3CPI G;  3AYJ A;  2QA2 A;  1K0L A;  4J2W A;  4OPG A;  2X8C A;  2WDQ A;  3DDM A;  2WU2 A;  3T37 A;  3VCN A;  4A35 A;  3VRB A;  3HZL A;  2R4J A;  1D4E A;  4A79 A;  2CDU A;  1B5Q A;  3T8Q A;  2HXT A;  1GRH A;  4PAB A;  2HZG A;  3NVV B;  5G5G B;  3UKQ A;  4H4S A;  1N61 C;  1FFU C;  3QLD A;  3PS9 A;  3MY9 A;  4B69 A;  4HNL A;  3G5R A;  4E5T A;  1LVL A;  2IVE A;  3CIR A;  1CC2 A;  4JY2 A;  1GRF A;  3N6H A;  1TDN A;  2BXR A;  3TOY A;  2YLW A;  2QGY A;  3DGH A;  3OPS A;  5HY5 A;  3CND A;  4KPL A;  1KD0 A;  3TWB A;  3PG6 A;  1DJN A;  3AD8 B;  4ZN0 A;  2EQ6 A;  2WPC A;  4USQ A;  2AKM A;  2I5Q A;  4NEV A;  1KFY A;  1DNC A;  3HRD C;  3NGC X;  3L5O A;  4Y4N A;  4YWS A;  4LII A;  1MO9 A;  1LQT A;  1JU2 A;  1EC8 A;  1Q1R A;  3SN0 A;  3BJS A;  3DJJ A;  1D7Y A;  1SEZ A;  3CGD A;  3CNJ A;  2C4C A;  5EU9 A;  3BOX A;  2XCG A;  2VRM A;  3M13 A;  1D4D A;  1MDR A;  3A7A A;  3D8X A;  2C3D A;  5G5H B;  1NHQ A;  2DW7 A;  2OFJ A;  3B97 A;  3CNS A;  3RP6 A;  2P8C A;  2GGJ A;  1H84 A;  2BAB A;  1PXA A;  5FJO A;  3KLJ A;  4G73 A;  3NHO X;  1ZY8 A;  3DIP A;  4BV6 A;  4ENL A;  3DG7 A;  3H7V A;  3NK1 X;  4RG4 A;  1NEK A;  4K2S A;  4NEW A;  3FVD A;  4IZG A;  1FCD A;  3T14 A;  3TWA A;  2GSH A;  2JKC A;  3ABV A;  2AKZ A;  3ICS A;  3T2Y A;  1JCT A;  1PS9 A;  2XDO A;  3ATQ A;  3HW2 A;  1TKK A;  3ZYX A;  1STZ A;  1FHU A;  5IQ1 A;  3GWF A;  3QVP A;  3CGB A;  5ER0 A;  5JCK A;  4TLZ A;  2MNR A;  3NYE A;  2V6O A;  3NYF A;  4CCQ A;  2F5Z A;  3GD3 A;  1YQ3 A;  2Q7V A;  2JAE A;  3LZW A;  4HYR A;  2FJD A;  1E1N A;  3KKJ A;  1IUT A;  3VRA A;  3COX A;  1LJ1 A;  3SJN A;  1L9D A;  4H83 A;  3UOY A;  2XFP A;  1GV4 A;  4WX1 A;  2ZZB A;  1Z6L A;  1R0M A;  4J33 A;  4ICY A;  4GYP A;  3AB1 A;  2R45 A;  3AEC A;  1X31 B;  4EMW A;  3NS1 B;  3GMC A;  1JEH A;  4YWO A;  2OAL A;  4U2L A;  2ZBW A;  1N5X A;  2YLT A;  4C77 A;  3P1W A;  3LB8 A;  3KUM A;  3A7U A;  4HN8 A;  3I3L A;  2XVJ A;  2ONE A;  1PN0 A;  3AEG A;  3SX6 A;  1N63 C;  3AD7 B;  2R4E A;  4UDP A;  3KPK A;  1L0V A;  1FFV C;  3RO6 A;  4TM4 A;  1H83 A;  4Z2R A;  2PPG A;  3D47 A;  2TMD A;  1DOE A;  4IA6 A;  3EF6 A;  2GAH B;  3UTE A;  2CHR A;  1K0J A;  4ZCC A;  4H4U A;  3NO1 A;  1SJD A;  3V3W A;  3KD9 A;  4PAA A;  2E3T A;  5KMS A;  3K1G A;  5BUL A;  3AE8 A;  3VR8 A;  3AYI A;  2AL1 A;  1P2H A;  4II3 A;  4NZH A;  2PTZ A;  1WUE A;  5FJT A;  1MXT A;  4G74 A;  5BOF A;  1WUF A;  2Q0L A;  1GRB A;  2QJM A;  4YSH A;  3CN8 A;  3Q6J A;  5KOW A;  3P93 A;  2GGE A;  4KWS A;  3S47 A;  4FDC B;  4H4P A;  1V59 A;  1TE6 A;  4ZOH B;  1VG9 A;  3DK4 A;  4P9S A;  1YQZ A;  3T0K A;  3C4N A;  3ICR A;  5J60 A;  3LAD A;  3TJI A;  5IPY A;  2B7R A;  1RYI A;  2DKH A;  2QVH A;  1KKO A;  4DN1 A;  2V60 A;  2Q6U A;  3KA7 A;  3NN0 X;  2GV8 A;  4K5S A;  1L9C A;  4J34 A;  2PP0 A;  1P43 A;  2W0H A;  4M6U A;  3G5Q A;  3FXG A;  4LU6 A;  1FHV A;  4DYE A;  4EQR A;  3SXI A;  2WP6 A;  3ICT A;  1ECQ A;  3H8A A;  5C3J A;  2B76 A;  2OZ3 A;  3CTY A;  4CNJ A;  3H8I A;  2WDR A;  1P48 A;  1RM6 B;  2PCE A;  3ZLG A;  3DFY A;  3T2K A;  2OAM A;  2WS3 A;  2QA1 A;  2CFY A;  1O95 A;  3CPJ G;  1ZOY A;  1W4X A;  2PA6 A;  3QPE A;  4HPN A;  3GYX A;  4H50 A;  1VDV A;  2XVH A;  3IJQ A;  4J36 A;  4CBQ A;  5FS8 A;  1N60 C;  1LPF A;  3R9U A;  1N4U A;  4WCT A;  2C64 A;  1L8P A;  3UOZ A;  1NHP A;  1N4W A;  3CGC A;  2R9Z A;  3ATR A;  1JRY A;  1Q1W A;  2EQ9 A;  2YM1 A;  1PJ5 A;  2YVG A;  3CB3 A;  4DHG A;  1IUU A;  2VZ2 A;  1CC6 A;  2MUC A;  2VVL G;  4OCG A;  2IVD A;  1IYX A;  4N9X A;  1FEC A;  2OLO A;  2POD A;  4RSL A;  2XFU A;  3CNP A;  1E1K A;  4J3Z A;  3U4F A;  3K7M X;  3UOX A;  4DNA A;  4ADW A;  3SZC A;  3DJE A;  5EOW A;  3K7Q X;  1CJ2 A;  2GH5 A;  1EL7 A;  2JK6 A;  1K4Q A;  3A7R A;  4HB9 A;  1FOH A;  5BOE A;  1XPQ A;  2OA1 A;  1GES A;  1KDG A;  4U2T A;  4MKS A;  3AE5 A;  4U8M A;  2OZT A;  3UP5 A;  4YXD A;  4H2Q A;  2XLR A;  1TZZ A;  3ADA B;  3CXB A;  5LV9 A;  5BVA A;  1E6E A;  3DGZ A;  1GRT A;  1ZX9 A;  4GAP A;  1FIQ B;  2W3S A;  2WEU A;  3QJ4 A;  1CJ4 A;  3CNT A;  1JRP A;  5KMR A;  2QDD A;  4FI4 A;  3UJE A;  4XWR A;  4H4Q A;  2YLZ A;  3VR9 A;  1NG4 A;  4EMJ A;  2GR0 A;  1Q9I A;  1KN0 A;  2YR5 A;  2YLX A;  1MOK A;  3NIX A;  2XH4 A;  2BXS A;  2UZZ A;  3JSK A;  4TVW A;  2GR1 A;  1ZP0 A;  1KSU A;  3T6C A;  3IF9 A;  3VA8 A;  4A5L A;  2XLS A;  2C67 A;  1PBF A;  3M0O A;  3CYJ A;  2WES A;  5KOX A;  1NHR A;  3SN1 A;  2HQM A;  1JRZ A;  4H1Z A;  4CY8 A;  4U8P A;  4K8D A;  3SZ0 A;  3CPH G;  4O5U A;  1O5W A;  3B3R A;  5JCN A;  3OZM A;  3SM8 A;  1JNZ A;  3CXO A;  2BA9 A;  4O5Q A;  4D04 A;  1GTH A;  2H89 A;  3GC2 A;  4F4R A;  3UCC A;  3CMM A;  3IHG A;  3F8P A;  3DES A;  2BC1 A;  3D46 A;  1S3E A;  1PBB A;  3RHA A;  3P4R A;  2DKI A;  3DA1 A;  4XWZ A;  4AOS A;  1ONF A;  4GYP C;  3URH A;  2XLT A;  1F3P A;  3D9X A;  1BWC A;  1W6T A;  4ZCD A;  2VVM A;  3DER A;  1IUS A;  1NHS A;  3ITJ A;  3T4W A;  3FBS A;  1F8R A;  3RNM A;  3UJS A;  3QSS A;  2P0I A;  3B9J B;  1ZMD A;  2C7G A;  2O9Z A;  4EM3 A;  4IL0 A;  1GRA A;  4YSZ A;  2Y6Q A;  3H12 A;  4BJY A;  3AM9 A;  2C70 A;  4ZCW A;  3UCL A;  2GDQ A;  5J7X A;  5KMQ A;  1N1P A;  3DH9 A;  3M12 A;  2BS2 A;  4KEM A;  1ELI A;  2R0G A;  1BKH A;  2WU5 A;  4OPU A;  5KNL A;  1EL9 A;  1XS2 A;  4FK1 A;  3P4Q A;  3EUB 3;  1PJ6 A;  2BK4 A;  3GSI A;  4YSX A;  3KVE A;  3VQR A;  1BQG A;  4JN7 A;  2QCU A;  4FX9 A;  4GAV A;  3II4 A;  4H2R A;  2JB1 A;  1XHC A;  2B7S A;  2V5Z A;  4GGB A;  1K0I A;  3MUC A;  3AE2 A;  2GRT A;  1B8S A;  4OPC A;  1GPE A;  1H2I A;  4ECH A;  3BI4 A;  1ZK7 A;  2CUL A;  3AMZ A;  2XFO A;  4C3Y A;  1OJ9 A;  3TCS A;  3NH3 X;  5FMH A;  2ZZC A;  2GMH A;  2YWL A;  1EL5 A;  5FJR A;  3UGV A;  2XSX A;  4DSG A;  4H19 A;  1YY5 A;  1PDY A;  4CRT A;  4NTD A;  1GET A;  1KSS A;  4BK2 A;  2TPR A;  2YAU A;  3UTF A;  2OKT A;  4JNA A;  2ZAD A;  3NRN A;  3P9U A;  1EBH A;  5EB4 A;  4OPT A;  4EIQ A;  1RVK A;  3OZ2 A;  3AE4 A;  3ETR B;  4AOX A;  5DBJ A;  3SYI A;  4E0V A;  1NDA A;  4H4T A;  4J56 A;  3DEQ A;  2WET A;  2VOU A;  5FS9 A;  1JOA A;  1DXL A;  1R6W A;  4APN A;  1PBC A;  2C73 A;  5KRQ A;  1GT8 A;  2HXU A;  1PBD A;  3DGB A;  3SN4 A;  4NWZ A;  3AE3 A;  2QQ6 A;  3KU9 A;  3GYJ A;  1JDF A;  5FJU A;  3TW9 A;  2WPE A;  1F8W A;  3NZG A;  4XXG A;  2PTY A;  1VG0 A;  2XH2 A;  3N4E A;  3AED A;  4YTN A;  4GME A;  1VRQ B;  3K7T A;  3VCC A;  4TVY A;  2GGH A;  3T31 A;  1GXF A;  4IVM B;  1YQ4 A;  3PFR A;  2YG5 A;  2C76 A;  2ACZ A;  3P3B A;  3UP4 A;  2PS2 A;  1ONE A;  1OJD A;  2Y6R A;  3PVC A;  3C4A A;  3BNM A;  4HCD A;  3P0W A;  3NVW B;  2BCP A;  3FV9 A;  3DK8 A;  3UTH A;  1VQZ A;  3AD9 B;  3K30 A;  1X2G A;  4I58 A;  5ENL A;  2B9W A;  3ZVI A;  6ENL A;  1CL0 A;  3UTG A;  1FEA A;  3ENL A;  1E7P A;  2WQY A;  4G9K A;  5U1O A;  4GFI A;  3V3O A;  4NTE A;  5HXI A;  2CVJ A;  1VDC A;  3ZVH B;  3BSM A;  3V76 A;  4U8N A;  1COY A;  2R46 A;  3LOV A;  3DK9 A;  2V3B A;  1ZDL A;  1TYP A;  4GIR A;  3HYX A;  1FO4 A;  1EC9 A;  2PTX A;  2XFN A;  2YLS A;  3ALJ A;  1UKV G;  2X8H A;  4GUV A;  2AQJ A;  4YT0 A;  3Q45 A;  2BK5 A;  1PDZ A;  4Z25 A;  5BRT A;  3P4P A;  4C74 A;  4A65 A;  3UJ2 A;  3IJI A;  3UKF A;  1GRG A;  4UP3 A;  4K2X A;  1QO8 A;  3OZY A;  2WP5 A;  3R10 A;  1Y56 B;  3S61 A;  3QFB A;  4Y4M A;  1GOS A;  4KPR A;  1DOB A;  1TRB A;  2GGG A;  3UKP A;  1OJT A;  1D5T A;  3G5S A;  2W54 A;  5KMP A;  2FBW A;  3EPT A;  1S3B A;  4CNK A;  5FS6 A;  2GR3 A;  2YG3 A;  3GRS A;  4H4V A;  2X8G A;  2FJB A;  5KVI A;  3ALM A;  3RR1 A;  2V3A A;  3AWI A;  2XFQ A;  4M0X A;  4GR1 A;  4CCR A;  4A6G A;  3FCP A;  4DXK A;  2YG4 A;  2GGI A;  1H81 A;  4E4U A;  3TJ4 A;  3IK4 A;  2P8B A;  1B37 A;  3GY1 A;  1PJ7 A;  4FP1 A;  4KT2 A;  2X3N A;  4AP1 A;  4G6H A;  1NEL A;  4AT0 A;  2C75 A;  3RED A;  2RAB A;  2C72 A;  4YSY A;  1ZKQ A;  3F8D A;  2RGO A;  3AXB A;  3KPF A;  3ES7 A;  4Z43 A;  1LTX R;  3V5F A;  1MNS A;  1IUV A;  1H86 A;  3SFD A;  3R11 A;  5EB5 A;  4GCM A;  2XH0 A;  3VFC A;  2X99 A;  1ZOV A;  1LV0 A;  2JB3 A;  3S5S A;  2QJJ A;  1H82 A;  5TR3 A;  1PDH A;  2VQB A;  4USR A;  4BUR A;  3AN1 A;  1GER A;  1RSG A;  2YVJ A;  1BZL A;  3RGT A;  3GRT A;  4U8L A;  4X4J A;  3TQP A;  4K5R A;  1XPY A;  2WOW A;  4U8K A;  3F8R A;  2PSN A;  3NFU A;  1FL2 A;  1N62 C;  4JNQ A;  3SQS A;  4Z24 A;  1ELS A;  4TLX A;  1CF3 A;  1E1M A;  2YVF A;  3OTR A;  3QKE A;  1N4V A;  4U8O A;  3P4S A;  3N4F A;  3QTP A;  4OVI A;  3QFA A;  1FEB A;  2C65 A;  3L1R A;  4J57 A;  1E39 A;  4H2H A;  1XAN A;  4A6N B;  1OJC A;  4KX6 A;  4IA5 A;  1KNR A;  2EQ7 A;  3O0H A;  1JPD X;  2PHH A;  4JHM A;  1D7L A;  4M52 A;  7ENL A;  3H8L A;  2GEW A;  1REO A;  4A99 A;  4H4Y A;  2W3R A;  4H2P A;  2NQL A;  3QN3 A;  4MJW A;  1JRO A;  5L46 A;  4K7Z A;  4K1W A;  3GD6 A;  2PGW A;  3AE6 A;  3IWA A;  3HPF A;  5EBK A;  2HNE A;  1DOD A;  2ARD A;  3Q4D A;  2XVE A;  4IHC A;  1GND A;  2YLR A;  2H88 A;  4IV9 A;  3THU A;  1H7W A;  2BAC A;  3AYL A;  5JCM A;  2GR2 A;  4IP5 A;  1EL8 A;  3SBF A;  5KVH A;  2GVC A;  4GIS A;  3H4K A;  4A6N A;  3AEB A;  2XGZ A;  2E1M A;  4HA6 A;  2PU0 A;  4BK1 A;  4H2N A;  3NYC A;  1XDI A;  2AR8 A;  3SFE A;  1PXC A;  2B9X A;  2BC0 A;  4H4W A;  3VC6 A;  2WP9 A;  1OJA A;  1EBD A;  2OX4 A;  1S7M A;  4A3R A;  1TDK A;  5FJP A;  1PBE A;  4H4R A;  3R25 A;  3UKH A;  5IQ4 A;  3NNE A;  2J3N A;  3NLC A;  3L8K A;  3H70 A;  4Y4L A;  2PGE A;  1E1L A;  3S5W A;  1X2H A;  3UJF A;  3SSZ A;  2YG6 A;  5JCI A;  3R1Z A;  1IJH A;  1M64 A;  2GB0 A;  1VQW A;  4X9M A;  3NG7 X;  1D4C A;  3FG2 P;  3WE0 A;  3RIT A;  5CKU A;  5KWF A;  2PP3 A;  2ZC8 A;  1NAA A;  2YG7 A;  3STP A;  3EKG A;  4A9W A;  4C3X A;  2YR4 A;  3NK2 X;  1EBG A;  3NRZ B;  1BF3 A;  1F6M A;  3GWD A;  1YKJ A;  2FJA A;  4UDQ A;  4IP4 A;  3RP8 A;  3NK0 X;  5HHF A;  1LQU A;  3SGL A;  2AAQ A;  2BRY A;  4JN8 A;  2VRL A;  3LJP A;  2QDE A;  4YKG A;  1DJQ A;  3BI2 A;  4B1B A;  1PHH A;  3FPZ A;  3BNU A;  1TDF A;  1L9E A;  1TYT A;  3CAW A;  3PWG A;  2VVL A;  4X2P A;  1JPM A;  3OC4 A;  3SQP A;  4K22 A;  5HYM A;  3V4B A;  2WOI A;  1JNR A;  1KF6 A;  4EMI A;  4YTM A;  3DME A;  2C66 A;  3NN6 X;  2BS4 A;  4G8T A;  4ROP A;  4AT2 A;  1MUC A;  3DFH A;  5JRB A;  2GQW A;  3ZLH A;  3QSM A;  1NPX A;  3ES8 A;  3NXL A;  1CBO A;  4DWD A;  3UCD A;  3U9I A;  3T2Z A;  3GYI A;  3NKS A;  1Y0P A;  2NPX A;  2EQ8 A;  2APG A;  2GAG B;  2C3C A;  1KNP A;  4GF7 A;  4IL2 A;  1P2E A;  3IJL A;  2YR6 A;  3ZDN A;  3UKA A;  1IUX A;  1BGN A;  3ZVH A;  1M6I A;  3CGE A;  4H4X A;  2JB2 A;  1TDO A;  3RRA A;  4U8I A;  3T9P A;  2ZZ0 A;  4LA1 A;  4J1O A;  2OO6 A;  2FYM A;  4OPI A;  3DG6 A;  1IUW A;  2OG9 A;  4G7F A;  3PWI A;  2WPF A;  2Q0K A;  2BYB A;  3DJG X;  2GMJ A;  2YM2 A;  4DX3 A;  2WDV A;  3AE7 A;  4RG3 A;  1H7X A;  1F9C A;  3EAO A;  4DGK A;  2XLP A;  3V3N A;  4CY6 A;  4ZA0 A;  1GRE A;  4EWJ A;  3R0K A;  4NTC A;  4U2S A;  4GDE A;  4EQX A;  1GSN A;  1GAL A;  2A8X A;  4HCL A;  1RP0 A;  2IID A;  2RGH A;  3R07 C;  1SJC A;  4OPD A;  2PU1 A;  2OPJ A;  1T3Q C;  1SB3 B;  3GD4 A;  4C5O A;  2R0P A;  3I6D A;  2PTW A;  4EQW A;  2XVI A;  3QSE A;  3PO7 A;  3NTD A;  3FJ4 A;  3LXD A;  1NEN A;  1CC4 A;  4TM0 A;  2GF3 A;  1Y56 A;  2P88 A;  5FS7 A;  4Z17 A;  3GDP A;  3OW1 A;  2BRA A;  4U8J A;  5M0Z A;  3GDN A;  3FMW A;  3EEZ A;  4Z2U A;  4GGH A;  4REK A;  3RCY A;  5GRT A;  3EAN A;  1OEP A;  4OPL A;  2XLU A;  4H7U A;  3JVA A;  1BKW A;  4UDR A;  2Z5Y A;  2B9Y A;  4AP3 A;  2R0C A;  3CT2 A;  2E5V A;  3AEA A;  3VRD B;  3UKL A;  3SZW A;  3UOV A;  2OQH A;  2AL2 B;  1GTE A;  1DOC A;  4X9N A;  4FK1 C;  3I4K A;  1CJC A;  4GRT A;  2FKP A;  1S2Y A;  5BUK A;  2Z5X A;  3UJR A;  3ZLF A;  5C2T A;  3GMB A;  4YKF A;  2W55 A;  1MDL A;  4JQ9 A;  4B67 A;  1NG3 A;  4II2 A;  3VC5 A;  1B4V A;  1JRX A;  4K8G A;  4E6M A;  5GSN A;  5M10 A;  3I6E A;  1ZMC A;  3CK5 A;  5CQF A;  2XH7 A;  3C96 A;  5J04 A;  4DSH A;  3NT6 A;  5JCL A;  4E4F A;  5KXJ A;  2POZ A;  4NNJ A;  2AL2 A;  3N6J A;  2WHD A;  4Z26 A;  2A89 A;  3UXK A;  1DTN A;  3NVY B;  4B64 A;  1BGJ A;  1PXB A;  2BS3 A;  3Q9T A;  1SJA A;  2VQ7 A;  3NVZ B;  3RP7 A;  1SJB A;  3OP2 A;  4HNC A;  4JY3 A;  4IVO B;  3BI5 A;  4A7A A;  3QVR A;  2BCG G;  2E4G A;  3FYY A;  3LZX A;  1MRA A;  4D03 A;  2P3Z A;  3IC9 A;  4IT1 A;  1HYU A;  4GDP A;  1QLB A;  3BHK A;  1KCZ A;  2OZ8 A;  4EM4 A;  4HCH A;  3I6T A;  2O56 A;  2GL5 A;  4EIP A;  3SZF A;  3D1C A;  1GEU A;  3AEF A;  4JN9 A;  1H6V A;  3B6D A;  3R0U A;  2DW6 A;  2BK3 A;  3NTA A;  2PYX A;  4B66 A;  3AE9 A;  2E5A A;  3GO2 A;  5IDZ A;  1KKR A;  3ISH A;  1CJ3 A;  4MMW A;  3AEE A;  4TM3 A;  1E9I A;  2I0Z A;  2RGJ A; 
#chains in the Genus database with same CATH homology
 4FDC B;  4H4P A;  1PBE A;  3HYW A;  3SY4 A;  3SYI A;  4E0V A;  1V59 A;  2X50 A;  4H4R A;  4BK3 A;  2NVK X;  1VG9 A;  3DK4 A;  1TDE A;  1NDA A;  3HYV A;  4H4T A;  4P9S A;  1YQZ A;  3T0K A;  3UKH A;  5IQ4 A;  3NNE A;  4J56 A;  2QAE A;  2J3N A;  3C4N A;  2WET A;  4I59 A;  2VOU A;  4JDR A;  5FS9 A;  3NLC A;  3L8K A;  3ICR A;  1JOA A;  4Z44 A;  5J60 A;  1F8S A;  1DXL A;  3LAD A;  5IPY A;  4Y4L A;  2B7R A;  1E1L A;  2XVF A;  4APN A;  4G6G A;  1RYI A;  2DKH A;  3S5W A;  1QJD A;  2OLN A;  1PBC A;  2V60 A;  2Q6U A;  2YG6 A;  5JCI A;  1O94 A;  2C73 A;  3KA7 A;  2GV8 A;  3NN0 X;  4K5S A;  5KRQ A;  3BHF A;  1IJH A;  1GT8 A;  1L9C A;  1M64 A;  2W0H A;  2GB0 A;  3DJD A;  1PBD A;  3G5Q A;  4J34 A;  3ALL A;  2YQU A;  1VQW A;  4B68 A;  4X9M A;  3NG7 X;  4NWZ A;  4LU6 A;  3AE3 A;  4BJZ A;  4EQR A;  1D4C A;  1S2Q A;  3SXI A;  2WP6 A;  3ICT A;  4YTP A;  3FG2 P;  3KU9 A;  3WE0 A;  3GYJ A;  5CKU A;  5C3J A;  2B76 A;  5KWF A;  2WPE A;  2FJE A;  3CTY A;  4CNJ A;  2XYO A;  2GQF A;  2V61 A;  1F8W A;  2WDR A;  4EQS A;  1NAA A;  2YG7 A;  3H8I A;  4XXG A;  2A87 A;  1VG0 A;  4A9W A;  4C3X A;  2YR4 A;  3AE1 A;  3NK2 X;  3UKK A;  3AED A;  2JBV A;  3T2K A;  4YTN A;  2WOV A;  1VRQ B;  2OAM A;  2WS3 A;  3IHM A;  2QA1 A;  3K7T A;  2CFY A;  1BF3 A;  1O95 A;  3CPJ G;  1ZOY A;  1W4X A;  4H4Z A;  1F6M A;  3GWD A;  1YKJ A;  2FJA A;  3GYX A;  4H50 A;  2XVH A;  3T31 A;  1GXF A;  4J36 A;  4IVM B;  4UDQ A;  4J31 A;  4CBQ A;  5FS8 A;  1YQ4 A;  1LPF A;  3RP8 A;  2WBA A;  3NK0 X;  5HHF A;  5U25 A;  2YG5 A;  2C76 A;  1LQU A;  3SGL A;  3R9U A;  1N4U A;  4WCT A;  1CHU A;  2C64 A;  4Z2T A;  2ACZ A;  3FIM B;  5U63 A;  2AAQ A;  2BRY A;  3E1T A;  2VRL A;  3LJP A;  4TM1 A;  4B65 A;  3UOZ A;  1AOG A;  4B63 A;  1NHP A;  1N4W A;  3CPI G;  3UP4 A;  3AYJ A;  3CGC A;  1OJD A;  4YKG A;  2Y6R A;  1DJQ A;  3BI2 A;  2R9Z A;  1K0L A;  2QA2 A;  3ATR A;  4J2W A;  4B1B A;  4OPG A;  1JRY A;  1PHH A;  2X8C A;  2WDQ A;  1Q1W A;  3PVC A;  2EQ9 A;  2YM1 A;  3C4A A;  1PJ5 A;  2WU2 A;  3T37 A;  3FPZ A;  3BNU A;  3BNM A;  2YVG A;  3VRB A;  1TDF A;  1IUU A;  2BCP A;  2VZ2 A;  2R4J A;  1CC6 A;  3DK8 A;  1D4E A;  1L9E A;  3HZL A;  3UTH A;  1TYT A;  4A79 A;  2CDU A;  3AD9 B;  2VVL A;  2VVL G;  3K30 A;  1B5Q A;  4OCG A;  4I58 A;  2IVD A;  4N9X A;  1FEC A;  1GRH A;  2B9W A;  1CL0 A;  3SQP A;  3OC4 A;  2OLO A;  4PAB A;  4K22 A;  1FEA A;  3UTG A;  5HYM A;  4H4S A;  4RSL A;  2XFU A;  2WOI A;  1E7P A;  2WQY A;  3CNP A;  4G9K A;  3UKQ A;  1JNR A;  5U1O A;  1KF6 A;  1E1K A;  3K7M X;  3UOX A;  4DNA A;  3V3O A;  4EMI A;  3PS9 A;  4ADW A;  4YTM A;  3SZC A;  4NTE A;  3DJE A;  5EOW A;  3K7Q X;  3DME A;  5HXI A;  2CVJ A;  4B69 A;  2C66 A;  1CJ2 A;  2GH5 A;  1VDC A;  1EL7 A;  3NN6 X;  2JK6 A;  2BS4 A;  3G5R A;  1K4Q A;  4HB9 A;  3V76 A;  1FOH A;  1XPQ A;  1LVL A;  1COY A;  2OA1 A;  2IVE A;  2R46 A;  3CIR A;  4U8N A;  3LOV A;  4AT2 A;  1GES A;  1CC2 A;  5JRB A;  2GQW A;  1KDG A;  4U2T A;  3DK9 A;  2V3B A;  3QSM A;  4JY2 A;  1GRF A;  1NPX A;  1TDN A;  3AE5 A;  4U8M A;  1ZDL A;  1TYP A;  2BXR A;  1CBO A;  3UP5 A;  4YXD A;  3HYX A;  2YLW A;  2XLR A;  4H2Q A;  3ADA B;  3DGH A;  5HY5 A;  3T2Z A;  3CND A;  2XFN A;  3GYI A;  3NKS A;  2YLS A;  5LV9 A;  1Y0P A;  2NPX A;  5BVA A;  2EQ8 A;  1E6E A;  2APG A;  2GAG B;  2C3C A;  3ALJ A;  1UKV G;  2X8H A;  3PG6 A;  1KNP A;  4GF7 A;  3DGZ A;  1DJN A;  1GRT A;  1ZX9 A;  1P2E A;  4GUV A;  2AQJ A;  3AD8 B;  2YR6 A;  4GAP A;  3UKA A;  3ZDN A;  1IUX A;  4YT0 A;  2BK5 A;  2EQ6 A;  2WPC A;  4USQ A;  4ZN0 A;  2WEU A;  1BGN A;  1M6I A;  3CGE A;  4H4X A;  2JB2 A;  1CJ4 A;  3QJ4 A;  1TDO A;  3CNT A;  5KMR A;  4U8I A;  4NEV A;  1KFY A;  2ZZ0 A;  1DNC A;  3NGC X;  4LA1 A;  4Z25 A;  3L5O A;  4OPI A;  1IUW A;  5BRT A;  4XWR A;  4Y4N A;  4LII A;  3P4P A;  1MO9 A;  2WPF A;  2Q0K A;  1LQT A;  4H4Q A;  2BYB A;  2YLZ A;  3VR9 A;  1NG4 A;  4EMJ A;  2GR0 A;  1JU2 A;  1Q9I A;  4A65 A;  4C74 A;  1KN0 A;  1Q1R A;  3UKF A;  3DJG X;  2GMJ A;  2YR5 A;  3DJJ A;  1GRG A;  2YM2 A;  4UP3 A;  1D7Y A;  2WDV A;  4K2X A;  1SEZ A;  1QO8 A;  1MOK A;  2YLX A;  3AE7 A;  3CGD A;  4RG3 A;  3CNJ A;  1H7X A;  2WP5 A;  3NIX A;  3EAO A;  2C4C A;  1Y56 B;  3S61 A;  3QFB A;  2BXS A;  4DGK A;  2UZZ A;  3JSK A;  4Y4M A;  1GOS A;  2XLP A;  2XCG A;  3V3N A;  2VRM A;  4CY6 A;  2GR1 A;  3M13 A;  4KPR A;  1DOB A;  1ZP0 A;  1TRB A;  1KSU A;  1D4D A;  1GRE A;  3UKP A;  1OJT A;  1D5T A;  3G5S A;  3IF9 A;  5KMP A;  2FBW A;  4NTC A;  3EPT A;  4A5L A;  1S3B A;  4U2S A;  3D8X A;  5FS6 A;  2C3D A;  4GDE A;  4EQX A;  4CNK A;  2GR3 A;  1GSN A;  1NHQ A;  1GAL A;  2XLS A;  2YG3 A;  2C67 A;  1PBF A;  3CNS A;  3GRS A;  3RP6 A;  4H4V A;  2A8X A;  2X8G A;  1RP0 A;  3M0O A;  1H84 A;  2BAB A;  2FJB A;  5KVI A;  1PXA A;  2IID A;  2WES A;  4B64 A;  2RGH A;  3ALM A;  5KOX A;  2V3A A;  3KLJ A;  4OPD A;  1NHR A;  4G73 A;  3NHO X;  3AWI A;  2HQM A;  2XFQ A;  3GD4 A;  1ZY8 A;  1JRZ A;  4C5O A;  4CY8 A;  2R0P A;  3I6D A;  4GR1 A;  4EQW A;  2XVI A;  3QSE A;  4U8P A;  4K8D A;  4BV6 A;  4CCR A;  3PO7 A;  3NTD A;  3SZ0 A;  3CPH G;  3LXD A;  1NEN A;  1CC4 A;  2YG4 A;  4O5U A;  1O5W A;  1H81 A;  3NK1 X;  2GF3 A;  3B3R A;  4RG4 A;  1Y56 A;  4TM0 A;  1NEK A;  5JCN A;  5FS7 A;  3GDP A;  4NEW A;  3SM8 A;  1JNZ A;  2BRA A;  4U8J A;  5M0Z A;  1FCD A;  3GDN A;  3T14 A;  1B37 A;  1PJ7 A;  2BA9 A;  3FMW A;  4O5Q A;  4Z2U A;  2JKC A;  4REK A;  5GRT A;  2X3N A;  4AP1 A;  4G6H A;  3EAN A;  4D04 A;  3ABV A;  4OPL A;  1GTH A;  2H89 A;  2C75 A;  4AT0 A;  3RED A;  2XLU A;  4H7U A;  2RAB A;  3ICS A;  3T2Y A;  1BKW A;  1PS9 A;  2C72 A;  4YSY A;  2XDO A;  4UDR A;  3CMM A;  2Z5Y A;  1ZKQ A;  3F8D A;  2RGO A;  3IHG A;  3F8P A;  3AXB A;  2BC1 A;  3KPF A;  3ATQ A;  1S3E A;  2B9Y A;  3ZYX A;  4AP3 A;  2R0C A;  1PBB A;  1LTX R;  3RHA A;  3P4R A;  4Z43 A;  2DKI A;  3DA1 A;  5IQ1 A;  2E5V A;  3AEA A;  3VRD B;  3GWF A;  3QVP A;  3UKL A;  1IUV A;  1H86 A;  4XWZ A;  3CGB A;  5ER0 A;  3SFD A;  3SZW A;  3UOV A;  5EB5 A;  4AOS A;  1ONF A;  5JCK A;  4GCM A;  4TLZ A;  3URH A;  2X99 A;  1GTE A;  1ZOV A;  1LV0 A;  3NYE A;  1DOC A;  2XLT A;  2V6O A;  3NYF A;  2JB3 A;  1H82 A;  4X9N A;  4FK1 C;  5TR3 A;  1CJC A;  2F5Z A;  4CCQ A;  1F3P A;  1PDH A;  3D9X A;  1BWC A;  3GD3 A;  1YQ3 A;  2VQB A;  2Q7V A;  4GRT A;  4USR A;  2JAE A;  4BUR A;  4ZCD A;  2VVM A;  1GER A;  1RSG A;  3LZW A;  1IUS A;  2FJD A;  1E1N A;  2YVJ A;  1NHS A;  1S2Y A;  3KKJ A;  1IUT A;  2Z5X A;  5BUK A;  3VRA A;  1BZL A;  3COX A;  3ITJ A;  3FBS A;  3GRT A;  4U8L A;  1LJ1 A;  1F8R A;  1L9D A;  4X4J A;  5C2T A;  3RNM A;  3GMB A;  4YKF A;  3UOY A;  2XFP A;  1GV4 A;  4K5R A;  4WX1 A;  3QSS A;  2ZZB A;  1Z6L A;  2WOW A;  4JQ9 A;  4B67 A;  1NG3 A;  4U8K A;  4II2 A;  1ZMD A;  1B4V A;  3F8R A;  4J33 A;  1JRX A;  4ICY A;  2C7G A;  2O9Z A;  4EM3 A;  3AB1 A;  2R45 A;  1FL2 A;  1GRA A;  3AEC A;  5GSN A;  4JNQ A;  5M10 A;  4Z24 A;  4YSZ A;  1ZMC A;  2Y6Q A;  4TLX A;  1X31 B;  4EMW A;  1CF3 A;  2C70 A;  3GMC A;  5CQF A;  1E1M A;  4BJY A;  1JEH A;  4YWO A;  3C96 A;  3UCL A;  2YVF A;  5J7X A;  2OAL A;  1N1P A;  5KMQ A;  4DSH A;  3DH9 A;  3M12 A;  2BS2 A;  3NT6 A;  4U2L A;  1N4V A;  5JCL A;  3P4S A;  4U8O A;  2ZBW A;  1ELI A;  2R0G A;  2YLT A;  2WU5 A;  4OVI A;  3QFA A;  5KXJ A;  4C77 A;  1FEB A;  4OPU A;  4NNJ A;  2C65 A;  3L1R A;  5KNL A;  4J57 A;  3P1W A;  2WHD A;  1EL9 A;  1E39 A;  3LB8 A;  4Z26 A;  2A89 A;  1XAN A;  4A6N B;  1OJC A;  4FK1 A;  3P4Q A;  4KX6 A;  1BGJ A;  1PJ6 A;  2BK4 A;  3GSI A;  3I3L A;  1KNR A;  1PXB A;  2BS3 A;  3Q9T A;  2VQ7 A;  4IA5 A;  4YSX A;  2EQ7 A;  3KVE A;  3O0H A;  2XVJ A;  3VQR A;  3RP7 A;  1PN0 A;  2QCU A;  3AEG A;  2PHH A;  3SX6 A;  4FX9 A;  4GAV A;  3II4 A;  2R4E A;  3AD7 B;  4H2R A;  4JY3 A;  4IVO B;  1D7L A;  3BI5 A;  4M52 A;  2JB1 A;  4A7A A;  3H8L A;  1XHC A;  2GEW A;  1REO A;  4UDP A;  2B7S A;  2V5Z A;  4A99 A;  3QVR A;  4H4Y A;  3KPK A;  1K0I A;  2BCG G;  2E4G A;  3LZX A;  4H2P A;  1L0V A;  3AE2 A;  4MJW A;  4D03 A;  2GRT A;  4TM4 A;  1B8S A;  5L46 A;  4K7Z A;  1H83 A;  3IC9 A;  3AE6 A;  1HYU A;  4Z2R A;  3IWA A;  4GDP A;  4OPC A;  5EBK A;  1GPE A;  1QLB A;  2TMD A;  1H2I A;  3BHK A;  1DOD A;  4ECH A;  4EM4 A;  1DOE A;  3BI4 A;  4IA6 A;  1ZK7 A;  3EF6 A;  2ARD A;  2CUL A;  2GAH B;  2XVE A;  2XFO A;  1GND A;  2YLR A;  3UTE A;  2H88 A;  4C3Y A;  1K0J A;  4ZCC A;  4IV9 A;  1OJ9 A;  4EIP A;  4H4U A;  3SZF A;  1H7W A;  2BAC A;  3AYL A;  5JCM A;  2GR2 A;  3KD9 A;  5FMH A;  2ZZC A;  2GMH A;  3NH3 X;  2YWL A;  4PAA A;  1EL5 A;  1EL8 A;  5KMS A;  3D1C A;  5BUL A;  1GEU A;  3AEF A;  4JN9 A;  3AE8 A;  5KVH A;  1H6V A;  3B6D A;  4DSG A;  2GVC A;  3AYI A;  1YY5 A;  3VR8 A;  3H4K A;  4CRT A;  4NTD A;  4A6N A;  3AEB A;  1GET A;  1P2H A;  4II3 A;  4NZH A;  1KSS A;  2BK3 A;  2E1M A;  4HA6 A;  4BK2 A;  2TPR A;  4BK1 A;  2YAU A;  4H2N A;  3NTA A;  3UTF A;  2PYX A;  4B66 A;  4JNA A;  3AE9 A;  3NYC A;  1XDI A;  3NRN A;  1MXT A;  3P9U A;  4G74 A;  5EB4 A;  4OPT A;  4EIQ A;  3ISH A;  2AR8 A;  3SFE A;  1CJ3 A;  1PXC A;  2B9X A;  2BC0 A;  3AEE A;  3OZ2 A;  2Q0L A;  3AE4 A;  1GRB A;  4TM3 A;  4H4W A;  4YSH A;  3CN8 A;  2WP9 A;  1OJA A;  1EBD A;  3Q6J A;  5KOW A;  4AOX A;  1S7M A;  2I0Z A;  5DBJ A;  1TDK A;  2RGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...