1BVBA

Heme-packing motifs revealed by the crystal structure of cytochrome c554 from nitrosomonas europaea
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C-554
publication title Heme packing motifs revealed by the crystal structure of the tetra-heme cytochrome c554 from Nitrosomonas europaea.
pubmed doi rcsb
molecule tags Electron transport
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 1998-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13435 Cytochrome_C554 Cytochrome c554 and c-prime
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1bvbA00
1LJ1A 3L1TA 1OAHA 1M1RA 3MMOA 1FT6A 3UBRA 1P2HA 1M64A 1D4DA 1FS7A 1D4CA 1JRXA 1BVBA 1QO8A 1KSSA 1M1QA 2E81A 1E39A 3SCEA 3BNGA 2ZO5A 4WJYA 1P2EA 3OWMA 1JRZA 1Q9IA 2OT4A 4L3ZA 3BNFA 1FT5A 3TORA 3LGQA 2E80A 3BNHA 2B7RA 4L38A 2K3VA 1M1PA 3BNJA 2RF7A 3SXQA 2RDZA 1D4EA 1JNIA 1FS9A 3F29A 4Q4UA 1KSUA 4Q1OA 3UU9A 2J7AA 2B7SA 1SP3A 1Y0PA 4L3XA 1QDBA 3D1IA 1JRYA 3RKHA 4L3YA 4Q5CA 3LG1A 2VR0A 4Q5BA 1FS8A 4Q0TA 3GM6A 4Q17A 3S7WA 3TTBA 3FO3A 1GU6A 1QJDA
chains in the Genus database with same CATH superfamily
1LJ1A 3L1TA 1OAHA 1M1RA 3MMOA 1FT6A 3UBRA 1P2HA 1M64A 1D4DA 1FS7A 1D4CA 1JRXA 1BVBA 1QO8A 1KSSA 1M1QA 2E81A 1E39A 3SCEA 3BNGA 2ZO5A 4WJYA 1P2EA 3OWMA 1JRZA 1Q9IA 2OT4A 4L3ZA 3BNFA 1FT5A 3TORA 3LGQA 2E80A 3BNHA 2B7RA 4L38A 2K3VA 1M1PA 3BNJA 2RF7A 3SXQA 2RDZA 1D4EA 1JNIA 1FS9A 3F29A 4Q4UA 1KSUA 4Q1OA 3UU9A 2J7AA 2B7SA 1SP3A 1Y0PA 4L3XA 1QDBA 3D1IA 1JRYA 3RKHA 4L3YA 4Q5CA 2CZSA 2VR0A 3LG1A 1FS8A 4Q5BA 3GM6A 4Q0TA 4Q17A 3S7WA 3TTBA 3FO3A 1GU6A 1QJDA
chains in the Genus database with same CATH topology
1LJ1A 3L1TA 1OAHA 1M1RA 3MMOA 1FT6A 3UBRA 1P2HA 1M64A 1D4DA 1FS7A 1D4CA 1JRXA 1BVBA 1QO8A 1KSSA 1M1QA 2E81A 1E39A 3SCEA 3BNGA 2ZO5A 4WJYA 1P2EA 3OWMA 1JRZA 1Q9IA 2OT4A 4L3ZA 3BNFA 1FT5A 3TORA 3LGQA 2E80A 3BNHA 2B7RA 4L38A 2K3VA 1M1PA 3BNJA 2RF7A 3SXQA 2RDZA 1D4EA 1JNIA 1FS9A 3F29A 4Q4UA 1KSUA 4Q1OA 3UU9A 2J7AA 2B7SA 1SP3A 1Y0PA 4L3XA 1QDBA 3D1IA 1JRYA 3RKHA 4L3YA 4Q5CA 3LG1A 2VR0A 4Q5BA 1FS8A 4Q0TA 3GM6A 4Q17A 3S7WA 3TTBA 3FO3A 1GU6A 1QJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJ1 A;  3L1T A;  1OAH A;  1M1R A;  3MMO A;  1FT6 A;  3UBR A;  1P2H A;  1M64 A;  1D4D A;  1FS7 A;  1D4C A;  1JRX A;  1BVB A;  1QO8 A;  1KSS A;  1M1Q A;  2E81 A;  1E39 A;  3SCE A;  3BNG A;  2ZO5 A;  4WJY A;  1P2E A;  3OWM A;  1JRZ A;  1Q9I A;  2OT4 A;  4L3Z A;  3BNF A;  1FT5 A;  3TOR A;  3LGQ A;  2E80 A;  3BNH A;  2B7R A;  4L38 A;  2K3V A;  1M1P A;  3BNJ A;  2RF7 A;  3SXQ A;  2RDZ A;  1D4E A;  1JNI A;  1FS9 A;  3F29 A;  4Q4U A;  1KSU A;  4Q1O A;  3UU9 A;  2J7A A;  2B7S A;  1SP3 A;  1Y0P A;  4L3X A;  1QDB A;  3D1I A;  1JRY A;  3RKH A;  4L3Y A;  4Q5C A;  3LG1 A;  2VR0 A;  4Q5B A;  1FS8 A;  4Q0T A;  3GM6 A;  4Q17 A;  3S7W A;  3TTB A;  3FO3 A;  1GU6 A;  1QJD A; 
#chains in the Genus database with same CATH topology
 1LJ1 A;  3L1T A;  1OAH A;  1M1R A;  3MMO A;  1FT6 A;  3UBR A;  1P2H A;  1M64 A;  1D4D A;  1FS7 A;  1D4C A;  1JRX A;  1BVB A;  1QO8 A;  1KSS A;  1M1Q A;  2E81 A;  1E39 A;  3SCE A;  3BNG A;  2ZO5 A;  4WJY A;  1P2E A;  3OWM A;  1JRZ A;  1Q9I A;  2OT4 A;  4L3Z A;  3BNF A;  1FT5 A;  3TOR A;  3LGQ A;  2E80 A;  3BNH A;  2B7R A;  4L38 A;  2K3V A;  1M1P A;  3BNJ A;  2RF7 A;  3SXQ A;  2RDZ A;  1D4E A;  1JNI A;  1FS9 A;  3F29 A;  4Q4U A;  1KSU A;  4Q1O A;  3UU9 A;  2J7A A;  2B7S A;  1SP3 A;  1Y0P A;  4L3X A;  1QDB A;  3D1I A;  1JRY A;  3RKH A;  4L3Y A;  4Q5C A;  2CZS A;  2VR0 A;  3LG1 A;  1FS8 A;  4Q5B A;  3GM6 A;  4Q0T A;  4Q17 A;  3S7W A;  3TTB A;  3FO3 A;  1GU6 A;  1QJD A; 
#chains in the Genus database with same CATH homology
 1LJ1 A;  3L1T A;  1OAH A;  1M1R A;  3MMO A;  1FT6 A;  3UBR A;  1P2H A;  1M64 A;  1D4D A;  1FS7 A;  1D4C A;  1JRX A;  1BVB A;  1QO8 A;  1KSS A;  1M1Q A;  2E81 A;  1E39 A;  3SCE A;  3BNG A;  2ZO5 A;  4WJY A;  1P2E A;  3OWM A;  1JRZ A;  1Q9I A;  2OT4 A;  4L3Z A;  3BNF A;  1FT5 A;  3TOR A;  3LGQ A;  2E80 A;  3BNH A;  2B7R A;  4L38 A;  2K3V A;  1M1P A;  3BNJ A;  2RF7 A;  3SXQ A;  2RDZ A;  1D4E A;  1JNI A;  1FS9 A;  3F29 A;  4Q4U A;  1KSU A;  4Q1O A;  3UU9 A;  2J7A A;  2B7S A;  1SP3 A;  1Y0P A;  4L3X A;  1QDB A;  3D1I A;  1JRY A;  3RKH A;  4L3Y A;  4Q5C A;  3LG1 A;  2VR0 A;  4Q5B A;  1FS8 A;  4Q0T A;  3GM6 A;  4Q17 A;  3S7W A;  3TTB A;  3FO3 A;  1GU6 A;  1QJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...