1BVBA

Heme-packing motifs revealed by the crystal structure of cytochrome c554 from nitrosomonas europaea
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C-554
publication title Heme packing motifs revealed by the crystal structure of the tetra-heme cytochrome c554 from Nitrosomonas europaea.
pubmed doi rcsb
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 1998-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13435 Cytochrome_C554 Cytochrome c554 and c-prime
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1bvbA00
3D1IA 1M1RA 1Y0PA 1D4EA 1QJDA 1Q9IA 1D4DA 1FS9A 4L3XA 4L3YA 2OT4A 3BNFA 3BNHA 1KSUA 1M64A 2VR0A 3TORA 1P2EA 4Q1OA 2J7AA 3BNGA 4Q4UA 3LGQA 2ZO5A 1QDBA 1JRXA 3LG1A 4L3ZA 3BNJA 3L1TA 3SXQA 2RF7A 1E39A 1BVBA 1SP3A 1FS8A 1JNIA 3MMOA 3OWMA 4Q5CA 3GM6A 1P2HA 4Q17A 4L38A 1JRYA 1GU6A 1M1QA 1JRZA 1OAHA 2K3VA 3S7WA 1M1PA 3FO3A 1KSSA 2E80A 3TTBA 4Q0TA 2RDZA 1QO8A 4WJYA 1FT6A 1LJ1A 3F29A 3RKHA 3SCEA 1FT5A 2B7RA 2B7SA 1FS7A 4Q5BA 1D4CA 3UU9A 2E81A 3UBRA
chains in the Genus database with same CATH superfamily
3D1IA 1M1RA 1Y0PA 1D4EA 1QJDA 1Q9IA 1D4DA 1FS9A 4L3XA 4L3YA 2OT4A 3BNFA 3BNHA 1KSUA 1M64A 2VR0A 3TORA 1P2EA 2CZSA 4Q1OA 2J7AA 3BNGA 4Q4UA 3LGQA 2ZO5A 1QDBA 1JRXA 3LG1A 4L3ZA 3BNJA 3L1TA 3SXQA 2RF7A 1E39A 1BVBA 1SP3A 1FS8A 1JNIA 3MMOA 3OWMA 4Q5CA 3GM6A 1P2HA 4Q17A 4L38A 1JRYA 1GU6A 1M1QA 1JRZA 1OAHA 2K3VA 3S7WA 1M1PA 3FO3A 1KSSA 2E80A 3TTBA 4Q0TA 2RDZA 1QO8A 4WJYA 1FT6A 1LJ1A 3F29A 3RKHA 3SCEA 1FT5A 2B7RA 2B7SA 1FS7A 4Q5BA 1D4CA 3UU9A 2E81A 3UBRA
chains in the Genus database with same CATH topology
3D1IA 1M1RA 1Y0PA 1D4EA 1QJDA 1Q9IA 1D4DA 1FS9A 4L3XA 4L3YA 2OT4A 3BNFA 3BNHA 1KSUA 1M64A 2VR0A 3TORA 1P2EA 4Q1OA 2J7AA 3BNGA 4Q4UA 3LGQA 2ZO5A 1QDBA 1JRXA 3LG1A 4L3ZA 3BNJA 3L1TA 3SXQA 2RF7A 1E39A 1BVBA 1SP3A 1FS8A 1JNIA 3MMOA 3OWMA 4Q5CA 3GM6A 1P2HA 4Q17A 4L38A 1JRYA 1GU6A 1M1QA 1JRZA 1OAHA 2K3VA 3S7WA 1M1PA 3FO3A 1KSSA 2E80A 3TTBA 4Q0TA 2RDZA 1QO8A 4WJYA 1FT6A 1LJ1A 3F29A 3RKHA 3SCEA 1FT5A 2B7RA 2B7SA 1FS7A 4Q5BA 1D4CA 3UU9A 2E81A 3UBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1I A;  1M1R A;  1Y0P A;  1D4E A;  1QJD A;  1Q9I A;  1D4D A;  1FS9 A;  4L3X A;  4L3Y A;  2OT4 A;  3BNF A;  3BNH A;  1KSU A;  1M64 A;  2VR0 A;  3TOR A;  1P2E A;  4Q1O A;  2J7A A;  3BNG A;  4Q4U A;  3LGQ A;  2ZO5 A;  1QDB A;  1JRX A;  3LG1 A;  4L3Z A;  3BNJ A;  3L1T A;  3SXQ A;  2RF7 A;  1E39 A;  1BVB A;  1SP3 A;  1FS8 A;  1JNI A;  3MMO A;  3OWM A;  4Q5C A;  3GM6 A;  1P2H A;  4Q17 A;  4L38 A;  1JRY A;  1GU6 A;  1M1Q A;  1JRZ A;  1OAH A;  2K3V A;  3S7W A;  1M1P A;  3FO3 A;  1KSS A;  2E80 A;  3TTB A;  4Q0T A;  2RDZ A;  1QO8 A;  4WJY A;  1FT6 A;  1LJ1 A;  3F29 A;  3RKH A;  3SCE A;  1FT5 A;  2B7R A;  2B7S A;  1FS7 A;  4Q5B A;  1D4C A;  3UU9 A;  2E81 A;  3UBR A; 
#chains in the Genus database with same CATH topology
 3D1I A;  1M1R A;  1Y0P A;  1D4E A;  1QJD A;  1Q9I A;  1D4D A;  1FS9 A;  4L3X A;  4L3Y A;  2OT4 A;  3BNF A;  3BNH A;  1KSU A;  1M64 A;  2VR0 A;  3TOR A;  1P2E A;  2CZS A;  4Q1O A;  2J7A A;  3BNG A;  4Q4U A;  3LGQ A;  2ZO5 A;  1QDB A;  1JRX A;  3LG1 A;  4L3Z A;  3BNJ A;  3L1T A;  3SXQ A;  2RF7 A;  1E39 A;  1BVB A;  1SP3 A;  1FS8 A;  1JNI A;  3MMO A;  3OWM A;  4Q5C A;  3GM6 A;  1P2H A;  4Q17 A;  4L38 A;  1JRY A;  1GU6 A;  1M1Q A;  1JRZ A;  1OAH A;  2K3V A;  3S7W A;  1M1P A;  3FO3 A;  1KSS A;  2E80 A;  3TTB A;  4Q0T A;  2RDZ A;  1QO8 A;  4WJY A;  1FT6 A;  1LJ1 A;  3F29 A;  3RKH A;  3SCE A;  1FT5 A;  2B7R A;  2B7S A;  1FS7 A;  4Q5B A;  1D4C A;  3UU9 A;  2E81 A;  3UBR A; 
#chains in the Genus database with same CATH homology
 3D1I A;  1M1R A;  1Y0P A;  1D4E A;  1QJD A;  1Q9I A;  1D4D A;  1FS9 A;  4L3X A;  4L3Y A;  2OT4 A;  3BNF A;  3BNH A;  1KSU A;  1M64 A;  2VR0 A;  3TOR A;  1P2E A;  4Q1O A;  2J7A A;  3BNG A;  4Q4U A;  3LGQ A;  2ZO5 A;  1QDB A;  1JRX A;  3LG1 A;  4L3Z A;  3BNJ A;  3L1T A;  3SXQ A;  2RF7 A;  1E39 A;  1BVB A;  1SP3 A;  1FS8 A;  1JNI A;  3MMO A;  3OWM A;  4Q5C A;  3GM6 A;  1P2H A;  4Q17 A;  4L38 A;  1JRY A;  1GU6 A;  1M1Q A;  1JRZ A;  1OAH A;  2K3V A;  3S7W A;  1M1P A;  3FO3 A;  1KSS A;  2E80 A;  3TTB A;  4Q0T A;  2RDZ A;  1QO8 A;  4WJY A;  1FT6 A;  1LJ1 A;  3F29 A;  3RKH A;  3SCE A;  1FT5 A;  2B7R A;  2B7S A;  1FS7 A;  4Q5B A;  1D4C A;  3UU9 A;  2E81 A;  3UBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...