2B7RA

Structure of e378d mutant flavocytochrome c3
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTDAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 191
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7rA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7rA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7rA03
4Q5BA 1FL2A 3BI5A 1NG4A 4K2XA 2B7RA 3NHOX 3DK4A 4H4UA 2C65A 4K5RA 2PHHA 1S3BA 4U8PA 1D4DA 4KX6A 5FMHA 1CJ4A 4ECHA 2RABA 3NYCA 1BGNA 4YSHA 3CPIG 1D5TA 3AWIA 2OLOA 2O9ZA 2YR6A 4FX9A 4OPTA 4OVIA 1PBEA 2XVHA 2IVEA 1Q1RA 3NN6X 4GRTA 1IJHA 5KVIA 3UTFA 2YLTA 3RHAA 3SCEA 4ZN0A 2CFYA 2OAMA 3BI4A 1NDAA 3UP4A 3FPZA 3VR9A 1DOCA 1S3EA 4OPUA 4Z26A 3BNHA 3VRDB 3BNGA 1GXFA 3UP5A 1GNDA 4B68A 4UDRA 2EQ8A 2JAEA 3KKJA 3LZXA 4H50A 3AE5A 4I58A 4C3YA 1OJCA 3GRSA 2YG6A 3AEAA 3QFBA 4J31A 3FMWA 2XLRA 4A99A 2LFCA 3S5WA 3C4AA 1JRYA 2ZZ0A 3QSMA 3QVPA 5EB4A 2GRTA 2R0PA 1KDGA 1SEZA 4JQ9A 4OPLA 4TM3A 5BULA 3GDPA 3RKHA 2B9WA 2BC1A 2Q0LA 1H84A 4JN9A 3K7TA 1NAAA 4EQXA 3UCLA 2BABA 3G5SA 1CF3A 1Y56A 3I6DA 3NIXA 3GMBA 4TLXA 2GF3A 4UDPA 2GR0A 3V3NA 1JOAA 2VQBA 2DKIA 3CN8A 2XYOA 2YG3A 3AE6A 1L9EA 3NK0X 1GREA 3EPTA 4WX1A 2F5ZA 5U25A 1GRTA 1N4UA 2QAEA 3AE3A 1DJNA 4YTMA 3G5QA 3DGHA 1B4VA 1GV4A 2WP5A 2WS3A 5IQ4A 1LQUA 1CJ3A 4B66A 1IUXA 1KNPA 2GR3A 2R45A 1K0JA 4BURA 2K3VA 2XFUA 4KPRA 2JK6A 2TMDA 3ATRA 3DH9A 4PAAA 3I3LA 1N1PA 1MOKA 4U8OA 3GMCA 3D1IA 1DJQA 3V76A 1BGJA 1GT8A 1ONFA 1PJ5A 2A87A 1Q9IA 4GUVA 2WDVA 2XFPA 3P4PA 4RG4A 2EQ7A 3KU9A 1BVBA 2YQUA 4H4XA 4Y4LA 1GSNA 1RSGA 4NTDA 5GSNA 5HY5A 5IPYA 1CL0A 3DMEA 3CGBA 4Z2RA 1NHSA 4E0VA 3GYXA 3O0HA 4NZHA 1MXTA 4USRA 3QSEA 3ICRA 4JNQA 4D04A 3ZDNA 1O95A 2RGHA 3B3RA 1OJ9A 3ALJA 1E1NA 3COXA 1COYA 3D1CA 4CY8A 1FOHA 2WETA 5TR3A 2YG7A 2NPXA 3AEBA 4H4YA 1Z6LA 4U8KA 2V3BA 3CPJG 2GH5A 4XWZA 2WU5A 3L1RA 3DK9A 4GDEA 1ZDLA 4H2RA 4Z44A 1DXLA 3M0OA 1JNIA 2EQ9A 3FG2P 3K30A 5JCKA 2WEUA 4EM4A 2ZBWA 3LZWA 5FS7A 1TYPA 4YSZA 4Z2UA 1M1QA 4IV9A 1FEBA 3ABVA 2GMHA 2FBWA 4RG3A 2YLWA 5BVAA 1YY5A 2XLUA 2A8XA 4FK1A 4GF7A 1VQWA 3P4SA 3F8DA 4BJYA 3SFEA 1REOA 4CNKA 1FEAA 4Q17A 4EQRA 1CC2A 3VQRA 5L46A 2BACA 3PS9A 4CY6A 2YG5A 2BK4A 4OPCA 1QO8A 2R0GA 3GSIA 1EL8A 1PS9A 4N9XA 4PABA 1E7PA 4AOSA 1Y0PA 3LG1A 2GQWA 3LOVA 2YM1A 2VQ7A 1ZMDA 4K8DA 1FS7A 4O5UA 3BNMA 4XXGA 4J36A 1LTXR 2X50A 2A89A 2YVFA 3V3OA 3VR8A 1NHRA 1FT6A 2XLSA 1OJTA 4WJYA 1QDBA 2RF7A 4RSLA 1B5QA 4YTPA 3GD4A 2CVJA 3IHGA 5EB5A 2C3DA 1F3PA 1B8SA 2RGOA 4YT0A 4AT0A 5JCMA 2YVJA 4GR1A 1DODA 1ZY8A 5C3JA 3K7QX 1JU2A 3QSSA 2WU2A 4LIIA 4A9WA 2ZO5A 4JNAA 4A79A 1D7LA 5M0ZA 1M6IA 2NVKX 2WOIA 2WOWA 2WHDA 4H2NA 1H83A 4U8JA 4B67A 3MMOA 3E1TA 2QA1A 4B65A 3C96A 4FK1C 3DA1A 4J56A 2C75A 4U2TA 2VRLA 1AOGA 1TDEA 5HXIA 4NTEA 2OT4A 2DKHA 1D7YA 2TPRA 1OJDA 5GRTA 2FJEA 4CRTA 4OPGA 5EOWA 4B64A 3P4RA 3AXBA 4Q4UA 4J34A 1F8SA 4H7UA 3SXQA 1Y56B 3AE2A 4NEWA 2BS3A 2CDUA 3LXDA 4L3ZA 5CKUA 3CNSA 5JCLA 1GALA 3DJEA 4I59A 1DOEA 2GQFA 4NEVA 1XPQA 4LU6A 4YKGA 4JY3A 1GESA 4CCQA 1W4XA 2VVMA 1H82A 3KPFA 2R4EA 4B69A 3RP8A 1CJ2A 1E1KA 2B9XA 3VRAA 2BCGG 5JCIA 3AD8B 3GYIA 4H2PA 1M1RA 1B37A 2BXSA 3BNFA 3EAOA 4P9SA 2BCPA 4USQA 1IUSA 3UKHA 1CJCA 3TORA 5KOWA 4BK2A 2ACZA 1BZLA 1GRGA 3AD7B 1KF6A 1BWCA 3RP7A 2WBAA 5J7XA 4LA1A 3ZYXA 4C5OA 3NGCX 1FS8A 4ICYA 4H4SA 3QFAA 3CNPA 3KA7A 4OCGA 3UOZA 1O94A 3BNUA 2C73A 4DSHA 1GEUA 1OAHA 1L9CA 1BKWA 1RYIA 2YWLA 4J2WA 2QA2A 1PBDA 4X9NA 2WESA 1UKVG 1ZOYA 2BS4A 2I0ZA 2VOUA 2OA1A 4L38A 4YWOA 2R0CA 4H4ZA 4Z2TA 4U2SA 3S7WA 2W0HA 3AE7A 4B1BA 1LV0A 1N4WA 3AECA 5BUKA 1CBOA 1PDHA 3F8RA 4BK1A 4A6NB 3FBSA 2JKCA 3KLJA 4K7ZA 1X31B 2AAQA 2WOVA 1H81A 1PJ7A 1PHHA 1PXCA 2YLRA 3IWAA 1D4CA 3PO7A 4K22A 4HB9A 4HA6A 4L3YA 4L3XA 3AB1A 3OC4A 3FO3A 4IA6A 1LJ1A 1TYTA 3UKKA 2WP6A 2XFQA 4AT2A 4IVMB 5FS8A 4EMWA 2YG4A 1PBCA 4XWRA 2H89A 1O5WA 2C64A 2YLSA 3NK2X 3SQPA 1M1PA 3TTBA 1TDNA 1ZX9A 3NTAA 3GYJA 3P4QA 1NEKA 4X4JA 2V5ZA 1VRQB 4ZCDA 3OWMA 1IUWA 1E39A 3BI2A 1GOSA 2XDOA 1FT5A 1PJ6A 2ZZCA 1K0IA 3F8PA 2ZZBA 3UTGA 1TDFA 2FJAA 3H8LA 4Y4NA 3AEEA 2JB1A 1XHCA 1JEHA 1LQTA 1TRBA 2GVCA 2XVJA 3UKFA 3UKLA 4YTNA 2QCUA 4EQSA 5KVHA 3OZ2A 3AYJA 4EMJA 4EIQA 4BV6A 1S2YA 3AEFA 5C2TA 4H4QA 2EQ6A 3P1WA 1D4EA 5M10A 1XDIA 1EL9A 2GMJA 1JRZA 3NYEA 3AEDA 1GTEA 3NK1X 1NHQA 1CHUA 3M12A 5HYMA 3RNMA 4BK3A 2XVIA 1JRXA 2V3AA 4H4VA 4C77A 4DGKA 1VDCA 2XLPA 2GR2A 1DOBA 1E6EA 4JDRA 4EMIA 4GDPA 2Q7VA 5U1OA 3BHKA 3UTEA 4Q5CA 4U8IA 3GWDA 1EL5A 1YKJA 1HYUA 2BA9A 2GR1A 1JNRA 1GETA 2Y6QA 2WDQA 2R9ZA 1EBDA 2C7GA 3UKAA 1FS9A 3H4KA 2E81A 4EIPA 1BF3A 3UOVA 4EQWA 5KXJA 3LGQA 4A7AA 1EL7A 1F6MA 3AE4A 3HZLA 3LJPA 1P2HA 3BNJA 2C72A 2WPFA 4UP3A 5FS9A 2WP9A 3GDNA 3IHMA 2C67A 2WDRA 3ALMA 3ALLA 2BK5A 1Q1WA 1JNZA 3WE0A 2YLZA 2Z5XA 4U8MA 4DSGA 2VVLG 2J7AA 2OLNA 5IQ1A 3ISHA 4C74A 4TLZA 3NRNA 2YAUA 3QJ4A 2JB3A 4U2LA 4GCMA 5KRQA 2XLTA 1E1MA 4CBQA 4BJZA 2FJDA 2B7SA 3DJJA 3NH3X 4U8NA 1GU6A 2AR8A 2APGA 2X8HA 1ELIA 3LADA 4APNA 4K5SA 3ITJA 3T37A 4A5LA 2X3NA 2C76A 3L8KA 4O5QA 3ICTA 2Q6UA 1ZMCA 3Q6JA 3UKPA 1NG3A 3AYIA 3UTHA 3DJDA 4M52A 3S61A 1PN0A 4CNJA 4JY2A 3REDA 2WPCA 1F8RA 2X8CA 3F29A 4IVOB 4Q0TA 1P2EA 2YM2A 3P9UA 4D03A 1QLBA 2BYBA 3CNTA 4REKA 2PYXA 3UOYA 3PVCA 4J33A 3L1TA 1GRHA 4ADWA 1KNRA 2VVLA 1FCDA 3KVEA 2XFOA 5KWFA 3NG7X 3AD9B 1KSSA 3CGDA 4TM0A 2OALA 2Y6RA 2JBVA 3CNDA 4H2QA 5HHFA 2V60A 3JSKA 2RGJA 1FECA 3SM8A 1F8WA 2E1MA 4YSYA 1TDOA 2UZZA 1GRBA 3CNJA 3SGLA 4TM1A 4A65A 1H86A 3DK8A 3SFDA 2BS2A 1SP3A 1YQ4A 3G5RA 4YSXA 4J57A 1OJAA 2E4GA 3Q9TA 1KSUA 4CCRA 1IUUA 2ARDA 3B6DA 3K7MX 5ER0A 4AP3A 5EBKA 3UU9A 1L0VA 2GV8A 2VZ2A 1IUVA 3KD9A 4Z24A 3UBRA 2AQJA 1YQZA 3GRTA 3QVRA 3NT6A 1ZOVA 4AP1A 1K0LA 3LB8A 1ZK7A 3NLCA 3NNEA 3NYFA 4X9MA 1GTHA 3AYLA 1GRAA 2YVGA 4H4PA 3RP6A 2H88A 1PBFA 2RDZA 1PXBA 1MO9A 2XCGA 2GB0A 2YR4A 1NPXA 2GAGB 4ZCCA 2R46A 3NN0X 2VR0A 3M13A 3AE9A 5KOXA 3GM6A 3ADAB 1PXAA 1H7WA 1H7XA 1NENA 3D8XA 3NTDA 1CC4A 4H4TA 4U8LA 1YQ3A 3GD3A 2BXRA 4Y4MA 2E80A 2HQMA 1S2QA 4UDQA 4DNAA 3R9UA 1H6VA 4C3XA 1XANA 2C70A 2WPEA 2XVEA 4A6NA 1VG9A 3CIRA 3ICSA 2V61A 3URHA 1M64A 1N4VA 2GAHB 1RP0A 3DGZA 2XFNA 2E5VA 1NHPA 2BK3A 2BC0A 3C4NA 4OPDA 2IVDA 1ZKQA 3DJGX 3CGCA 1GPEA 2V6OA 4AOXA 2JB2A 3GWFA 3CTYA 4H4WA 4EM3A 2C66A 2FJBA 1L9DA 2YR5A 4FDCB 4H4RA 4OPIA 4YKFA 5BRTA 2VRMA 4Q1OA 4Z43A 1TDKA 2CULA 3UKQA 2YLXA 2B76A 3VRBA 2C3CA 4WCTA 3AE8A 4NTCA 2B9YA 1KFYA 3CPHG 4TM4A 1IUTA 3ATQA 1GRFA 2WQYA 1LVLA 5U63A 3H8IA 5J60A 1DNCA 3EANA 1QJDA 3NKSA 3II4A 3CGEA 5DBJA 2J3NA 2Q0KA 3FIMB 5LV9A 1K4QA 5FS6A 1LPFA 3IF9A 1VG0A 5CQFA 1ZP0A 3UOXA 4Z25A 1E1LA 1PBBA 2X8GA 4MJWA 5JCNA 4IA5A 4B63A 1GERA 3AEGA 2Z5YA 1V59A 3EF6A 2IIDA 2XVFA 2X99A 1CC6A 3AE1A 4YXDA 3IC9A 3BHFA 2R4JA 2GEWA
chains in the Genus database with same CATH superfamily
4Q5BA 1FL2A 3BI5A 1NG4A 4K2XA 2B7RA 3NHOX 3DK4A 4H4UA 2C65A 4K5RA 2PHHA 1S3BA 4U8PA 1D4DA 4KX6A 5FMHA 1CJ4A 4ECHA 2RABA 3NYCA 1BGNA 4YSHA 3CPIG 1D5TA 3AWIA 2OLOA 3SZWA 2O9ZA 2YR6A 4FX9A 4OPTA 4OVIA 1PBEA 2XVHA 2IVEA 1Q1RA 3NN6X 4GRTA 1IJHA 5KVIA 3UTFA 2YLTA 3RHAA 3SCEA 4ZN0A 2CFYA 2OAMA 3BI4A 1NDAA 3UP4A 3FPZA 3VR9A 1DOCA 1S3EA 4OPUA 4Z26A 3BNHA 3VRDB 3BNGA 1GXFA 3UP5A 1GNDA 4B68A 4UDRA 2EQ8A 2JAEA 3KKJA 3LZXA 4H50A 3AE5A 4I58A 4C3YA 1OJCA 3GRSA 2YG6A 3AEAA 3QFBA 4J31A 3FMWA 2XLRA 4A99A 2LFCA 3S5WA 3C4AA 1JRYA 2ZZ0A 3QSMA 3QVPA 4G73A 3SXIA 5EB4A 2GRTA 2R0PA 1KDGA 1SEZA 4JQ9A 4OPLA 4TM3A 5BULA 3GDPA 3RKHA 2B9WA 2BC1A 2Q0LA 1H84A 4JN9A 3K7TA 1NAAA 4EQXA 3UCLA 3T14A 2BABA 3G5SA 1CF3A 1Y56A 3I6DA 3NIXA 3GMBA 4TLXA 2GF3A 4UDPA 2GR0A 3V3NA 1JOAA 2VQBA 2DKIA 3CN8A 2XYOA 2YG3A 3AE6A 1L9EA 3NK0X 1GREA 3EPTA 4WX1A 2F5ZA 5U25A 1GRTA 1N4UA 2QAEA 3AE3A 1DJNA 4YTMA 3G5QA 3DGHA 1B4VA 1GV4A 2WP5A 2WS3A 5IQ4A 1LQUA 1CJ3A 4B66A 1IUXA 1KNPA 2GR3A 2R45A 1K0JA 4BURA 2K3VA 2XFUA 4KPRA 2JK6A 2TMDA 3ATRA 3DH9A 4PAAA 3I3LA 1N1PA 1MOKA 4U8OA 3GMCA 3D1IA 1DJQA 3V76A 1BGJA 1GT8A 1ONFA 1PJ5A 2A87A 1Q9IA 4GAPA 2WDVA 2XFPA 3P4PA 4GUVA 2EQ7A 3KU9A 4RG4A 1BVBA 2YQUA 4H4XA 4Y4LA 1GSNA 1RSGA 4NTDA 5GSNA 5HY5A 5IPYA 1CL0A 3DMEA 3CGBA 4Z2RA 1NHSA 2BRAA 4E0VA 3GYXA 3O0HA 4NZHA 1MXTA 4USRA 3QSEA 3ICRA 4JNQA 4D04A 3ZDNA 1O95A 2RGHA 3SZFA 3CMMA 3B3RA 1OJ9A 3ALJA 1E1NA 3COXA 1COYA 3D1CA 4CY8A 1FOHA 2CZSA 2WETA 3SY4A 5TR3A 2YG7A 2NPXA 3AEBA 4H4YA 1Z6LA 4U8KA 2V3BA 3CPJG 2GH5A 4XWZA 2WU5A 3L1RA 3DK9A 4GDEA 1ZDLA 4H2RA 4Z44A 1DXLA 3M0OA 1JNIA 2EQ9A 3FG2P 5KNLA 3K30A 5JCKA 2WEUA 4EM4A 2ZBWA 3LZWA 5FS7A 1TYPA 4YSZA 4Z2UA 1M1QA 4IV9A 1FEBA 3ABVA 2GMHA 2FBWA 4RG3A 2YLWA 5BVAA 1YY5A 2XLUA 2A8XA 4FK1A 4GF7A 1VQWA 3P4SA 3F8DA 4BJYA 3SFEA 1REOA 4CNKA 1FEAA 4Q17A 4EQRA 1CC2A 3VQRA 5L46A 2BACA 3PS9A 4CY6A 2YG5A 2BK4A 4G9KA 4OPCA 5KMSA 1QO8A 2R0GA 3GSIA 1EL8A 3T31A 1PS9A 4N9XA 4PABA 1E7PA 4AOSA 1Y0PA 3LG1A 2GQWA 3LOVA 2YM1A 2VQ7A 1ZMDA 4K8DA 1FS7A 4O5UA 3BNMA 4XXGA 4J36A 1LTXR 2X50A 2A89A 2YVFA 3V3OA 3VR8A 1NHRA 1FT6A 2XLSA 1OJTA 4WJYA 1QDBA 2RF7A 4RSLA 1B5QA 4YTPA 3GD4A 2CVJA 3IHGA 5EB5A 2C3DA 1F3PA 1B8SA 2RGOA 4YT0A 4AT0A 5JCMA 2YVJA 4GR1A 1DODA 1ZY8A 5C3JA 3K7QX 1JU2A 3QSSA 2WU2A 4LIIA 4A9WA 2ZO5A 4JNAA 4A79A 1D7LA 5M0ZA 1M6IA 2NVKX 2WOIA 2WOWA 2WHDA 4H2NA 1H83A 4U8JA 4B67A 3MMOA 3E1TA 2QA1A 4B65A 3C96A 4FK1C 3DA1A 4J56A 2C75A 4U2TA 2VRLA 1AOGA 1TDEA 5HXIA 2C4CA 4NTEA 2OT4A 2DKHA 1D7YA 2TPRA 1OJDA 5GRTA 2FJEA 4CRTA 4OPGA 5EOWA 4B64A 3P4RA 3AXBA 4Q4UA 4J34A 1F8SA 4H7UA 3SXQA 1Y56B 3AE2A 4NEWA 2BS3A 2CDUA 3LXDA 4L3ZA 5CKUA 3CNSA 5JCLA 3SZCA 1GALA 3DJEA 4I59A 1DOEA 2GQFA 4NEVA 1XPQA 4LU6A 4YKGA 4JY3A 1GESA 4CCQA 1W4XA 2VVMA 1H82A 3KPFA 2R4EA 4B69A 3RP8A 1CJ2A 1E1KA 2B9XA 3VRAA 2BCGG 5JCIA 3AD8B 3GYIA 4H2PA 1M1RA 1B37A 2BXSA 3BNFA 3EAOA 4P9SA 2BCPA 4USQA 1IUSA 3T2ZA 3UKHA 1CJCA 3TORA 5KOWA 4BK2A 2ACZA 1BZLA 1GRGA 3AD7B 1KF6A 1BWCA 3RP7A 2WBAA 5J7XA 4LA1A 3ZYXA 4C5OA 3NGCX 1FS8A 4ICYA 4H4SA 3QFAA 3CNPA 3KA7A 4OCGA 3UOZA 1O94A 3BNUA 2C73A 4DSHA 1GEUA 1OAHA 1L9CA 1BKWA 1RYIA 2YWLA 4J2WA 2QA2A 1PBDA 4X9NA 2WESA 4II3A 1UKVG 1ZOYA 2BS4A 2I0ZA 2VOUA 2OA1A 4L38A 4YWOA 2R0CA 4H4ZA 4Z2TA 4U2SA 3S7WA 2W0HA 3AE7A 4B1BA 1LV0A 1N4WA 3AECA 5BUKA 1CBOA 1PDHA 3F8RA 4BK1A 4A6NB 3FBSA 2JKCA 3KLJA 4K7ZA 1X31B 2AAQA 2WOVA 1H81A 1PJ7A 1PHHA 1PXCA 2YLRA 3IWAA 1D4CA 3PO7A 4K22A 3SYIA 4HB9A 4HA6A 4L3YA 4L3XA 3AB1A 3OC4A 3FO3A 4IA6A 1LJ1A 1TYTA 3UKKA 2WP6A 2XFQA 4AT2A 4IVMB 5FS8A 4EMWA 2YG4A 1PBCA 4XWRA 5KMQA 4II2A 2H89A 1O5WA 2C64A 2YLSA 3NK2X 3SQPA 1M1PA 3TTBA 1TDNA 1ZX9A 3NTAA 3GYJA 3P4QA 1NEKA 3HYXA 4X4JA 2V5ZA 1VRQB 4ZCDA 3OWMA 1IUWA 1E39A 3SX6A 3BI2A 1GOSA 2XDOA 1FT5A 1PJ6A 2ZZCA 1K0IA 3F8PA 4GAVA 2ZZBA 3UTGA 1TDFA 2FJAA 3H8LA 4Y4NA 3AEEA 2JB1A 1XHCA 1JEHA 1LQTA 1TRBA 2GVCA 2XVJA 3UKFA 3UKLA 4YTNA 2QCUA 4EQSA 5KVHA 3OZ2A 3AYJA 4EMJA 4EIQA 4BV6A 1S2YA 3AEFA 5C2TA 4H4QA 4G6HA 2EQ6A 3P1WA 1D4EA 5M10A 1XDIA 1EL9A 2GMJA 1JRZA 3NYEA 3AEDA 1GTEA 3NK1X 1NHQA 1CHUA 3M12A 5HYMA 3RNMA 4BK3A 2XVIA 1JRXA 2V3AA 4H4VA 4C77A 4DGKA 1VDCA 2XLPA 2GR2A 1DOBA 1E6EA 4JDRA 4EMIA 4GDPA 2Q7VA 5U1OA 3BHKA 4G6GA 3UTEA 4Q5CA 4U8IA 3GWDA 1EL5A 1YKJA 1HYUA 2BA9A 2GR1A 1JNRA 1GETA 2Y6QA 2WDQA 2R9ZA 3T2KA 1EBDA 2C7GA 3UKAA 1FS9A 3H4KA 2E81A 4EIPA 1BF3A 3UOVA 4EQWA 5KXJA 3LGQA 4A7AA 1EL7A 1F6MA 3AE4A 3HZLA 3LJPA 1P2HA 3BNJA 2C72A 2WPFA 4UP3A 5FS9A 2WP9A 3GDNA 3IHMA 2C67A 2WDRA 3ALMA 3ALLA 2BK5A 1Q1WA 1JNZA 3WE0A 2YLZA 2Z5XA 4U8MA 4DSGA 2VVLG 2J7AA 2OLNA 5IQ1A 3ISHA 4C74A 4TLZA 3NRNA 2YAUA 3QJ4A 2JB3A 4U2LA 4GCMA 5KRQA 2XLTA 1E1MA 4CBQA 4BJZA 2FJDA 2B7SA 3DJJA 3NH3X 4U8NA 1GU6A 2AR8A 2APGA 2X8HA 1ELIA 3LADA 4APNA 4K5SA 3ITJA 3T37A 4A5LA 2X3NA 2C76A 3L8KA 4O5QA 3ICTA 2Q6UA 1ZMCA 2BRYA 3Q6JA 1NG3A 3AYIA 3UKPA 3UTHA 3DJDA 4M52A 3S61A 3T2YA 1PN0A 4CNJA 4JY2A 3REDA 2WPCA 1F8RA 2X8CA 3F29A 4IVOB 4Q0TA 1P2EA 2YM2A 3P9UA 4D03A 1QLBA 2BYBA 3CNTA 4NNJA 4REKA 2PYXA 3UOYA 3PVCA 4J33A 3L1TA 1GRHA 4ADWA 1KNRA 2VVLA 1FCDA 3KVEA 2XFOA 5KWFA 3NG7X 3AD9B 1KSSA 3CGDA 4TM0A 2OALA 2Y6RA 2JBVA 3CNDA 4H2QA 5HHFA 2V60A 3JSKA 2RGJA 1FECA 3SM8A 1F8WA 2E1MA 4YSYA 1TDOA 2UZZA 1GRBA 3CNJA 3SGLA 4TM1A 4A65A 1H86A 3DK8A 3SFDA 2BS2A 1SP3A 1YQ4A 3G5RA 4YSXA 4J57A 1OJAA 2E4GA 3Q9TA 1KSUA 4CCRA 1IUUA 2ARDA 3B6DA 3K7MX 5ER0A 4AP3A 5EBKA 3UU9A 1L0VA 2GV8A 2VZ2A 1IUVA 3KD9A 4Z24A 3UBRA 2AQJA 1YQZA 3GRTA 3KPKA 3QVRA 3NT6A 1ZOVA 4AP1A 4NWZA 1K0LA 3LB8A 1ZK7A 3NLCA 5KMRA 3NNEA 3NYFA 5KMPA 4X9MA 1GTHA 3AYLA 1GRAA 2YVGA 4H4PA 3RP6A 2H88A 1PBFA 2RDZA 1PXBA 1MO9A 2XCGA 2GB0A 2YR4A 1NPXA 2GAGB 4ZCCA 2R46A 3NN0X 2VR0A 3M13A 3AE9A 5KOXA 3GM6A 3ADAB 3HYWA 1PXAA 1H7WA 1H7XA 1NENA 3D8XA 3NTDA 1CC4A 4H4TA 4U8LA 1YQ3A 3GD3A 2BXRA 4Y4MA 2E80A 2HQMA 1S2QA 4UDQA 4DNAA 3R9UA 1H6VA 4C3XA 1XANA 3T0KA 2C70A 2WPEA 2XVEA 4A6NA 1VG9A 3CIRA 3ICSA 2V61A 3URHA 1M64A 1N4VA 2GAHB 1RP0A 3DGZA 2XFNA 2E5VA 1NHPA 2BK3A 2BC0A 3C4NA 4OPDA 2IVDA 1ZKQA 3DJGX 3CGCA 1GPEA 2V6OA 4G74A 4AOXA 2JB2A 3GWFA 3CTYA 4H4WA 4EM3A 2C66A 2FJBA 1L9DA 2YR5A 4FDCB 4H4RA 4OPIA 4YKFA 5BRTA 2VRMA 4Q1OA 4Z43A 1TDKA 2CULA 3UKQA 2YLXA 2B76A 3VRBA 2C3CA 4WCTA 3AE8A 4NTCA 2B9YA 1KFYA 3CPHG 4TM4A 1IUTA 3ATQA 1GRFA 2WQYA 1LVLA 5U63A 3H8IA 5J60A 1DNCA 3EANA 1QJDA 3NKSA 3II4A 3CGEA 5DBJA 2J3NA 2Q0KA 3FIMB 5LV9A 1K4QA 5FS6A 1LPFA 3IF9A 1VG0A 5CQFA 1ZP0A 3UOXA 4Z25A 1E1LA 1PBBA 2X8GA 4MJWA 5JCNA 4IA5A 4B63A 3HYVA 1GERA 3AEGA 2Z5YA 1V59A 3EF6A 3SZ0A 2IIDA 2XVFA 2X99A 1CC6A 3AE1A 4YXDA 3IC9A 3BHFA 2R4JA 2GEWA
chains in the Genus database with same CATH topology
4Q5BA 1FL2A 3BI5A 1NG4A 4K2XA 2B7RA 3NHOX 3DK4A 4H4UA 2C65A 4K5RA 2PHHA 1S3BA 4U8PA 1D4DA 4KX6A 5FMHA 1CJ4A 4ECHA 2RABA 3NYCA 1BGNA 4YSHA 3CPIG 1D5TA 3AWIA 2OLOA 3SZWA 2O9ZA 2YR6A 4FX9A 4OPTA 4OVIA 1PBEA 2XVHA 2IVEA 1Q1RA 3NN6X 4GRTA 1IJHA 5KVIA 3UTFA 2YLTA 3RHAA 3SCEA 4ZN0A 2CFYA 2OAMA 3BI4A 1NDAA 3UP4A 3FPZA 3VR9A 1DOCA 1S3EA 4OPUA 4Z26A 3BNHA 3VRDB 3BNGA 1GXFA 3UP5A 1GNDA 4B68A 4UDRA 2EQ8A 2JAEA 3KKJA 3LZXA 4H50A 3AE5A 4I58A 4C3YA 1OJCA 3GRSA 2YG6A 3AEAA 3QFBA 4J31A 3FMWA 2XLRA 4A99A 2LFCA 3S5WA 3C4AA 1JRYA 2ZZ0A 3QSMA 3QVPA 4G73A 3SXIA 5EB4A 2GRTA 2R0PA 1KDGA 1SEZA 4JQ9A 4OPLA 4TM3A 5BULA 3GDPA 3RKHA 2B9WA 2BC1A 2Q0LA 1H84A 4JN9A 3K7TA 1NAAA 4EQXA 3UCLA 3T14A 2BABA 3G5SA 1CF3A 1Y56A 3I6DA 3NIXA 3GMBA 4TLXA 2GF3A 4UDPA 2GR0A 3V3NA 1JOAA 2VQBA 2DKIA 3CN8A 2XYOA 2YG3A 3AE6A 1L9EA 3NK0X 1GREA 3EPTA 4WX1A 2F5ZA 5U25A 1GRTA 1N4UA 2QAEA 3AE3A 1DJNA 4YTMA 3G5QA 3DGHA 1B4VA 1GV4A 2WP5A 2WS3A 5IQ4A 1LQUA 1CJ3A 4B66A 1IUXA 1KNPA 2GR3A 2R45A 1K0JA 4BURA 2K3VA 2XFUA 4KPRA 2JK6A 2TMDA 3ATRA 3DH9A 4PAAA 3I3LA 1N1PA 1MOKA 4U8OA 3GMCA 3D1IA 1DJQA 3V76A 1BGJA 1GT8A 1ONFA 1PJ5A 2A87A 1Q9IA 4GAPA 2WDVA 2XFPA 3P4PA 4GUVA 2EQ7A 3KU9A 4RG4A 1BVBA 2YQUA 4H4XA 4Y4LA 1GSNA 1RSGA 4NTDA 5GSNA 5HY5A 5IPYA 1CL0A 3DMEA 3CGBA 4Z2RA 1NHSA 2BRAA 4E0VA 3GYXA 3O0HA 4NZHA 1MXTA 4USRA 3QSEA 3ICRA 4JNQA 4D04A 3ZDNA 1O95A 2RGHA 3SZFA 3CMMA 3B3RA 1OJ9A 3ALJA 1E1NA 3COXA 1COYA 3D1CA 4CY8A 1FOHA 2WETA 3SY4A 5TR3A 2YG7A 2NPXA 3AEBA 4H4YA 1Z6LA 4U8KA 2V3BA 3CPJG 2GH5A 4XWZA 2WU5A 3L1RA 3DK9A 4GDEA 1ZDLA 4H2RA 4Z44A 1DXLA 3M0OA 1JNIA 2EQ9A 3FG2P 5KNLA 3K30A 5JCKA 2WEUA 4EM4A 2ZBWA 3LZWA 5FS7A 1TYPA 4YSZA 4Z2UA 1M1QA 4IV9A 1FEBA 3ABVA 2GMHA 2FBWA 4RG3A 2YLWA 5BVAA 1YY5A 2XLUA 2A8XA 4FK1A 4GF7A 1VQWA 3P4SA 3F8DA 4BJYA 3SFEA 1REOA 4CNKA 1FEAA 4Q17A 4EQRA 1CC2A 3VQRA 5L46A 2BACA 3PS9A 4CY6A 2YG5A 2BK4A 4G9KA 4OPCA 5KMSA 1QO8A 2R0GA 3GSIA 1EL8A 3T31A 1PS9A 4N9XA 4PABA 1E7PA 4AOSA 1Y0PA 3LG1A 2GQWA 3LOVA 2YM1A 2VQ7A 1ZMDA 4K8DA 1FS7A 4O5UA 3BNMA 4XXGA 4J36A 1LTXR 2X50A 2A89A 2YVFA 3V3OA 3VR8A 1NHRA 1FT6A 2XLSA 1OJTA 4WJYA 1QDBA 2RF7A 4RSLA 1B5QA 4YTPA 3GD4A 2CVJA 3IHGA 5EB5A 2C3DA 1F3PA 1B8SA 2RGOA 4YT0A 4AT0A 5JCMA 2YVJA 4GR1A 1DODA 1ZY8A 5C3JA 3K7QX 1JU2A 3QSSA 2WU2A 4LIIA 4A9WA 2ZO5A 4JNAA 4A79A 1D7LA 5M0ZA 1M6IA 2NVKX 2WOIA 2WOWA 2WHDA 4H2NA 1H83A 4U8JA 4B67A 3MMOA 3E1TA 2QA1A 4B65A 3C96A 4FK1C 3DA1A 4J56A 2C75A 4U2TA 2VRLA 1AOGA 1TDEA 5HXIA 2C4CA 4NTEA 2OT4A 2DKHA 1D7YA 2TPRA 1OJDA 5GRTA 2FJEA 4CRTA 4OPGA 5EOWA 4B64A 3P4RA 3AXBA 4Q4UA 4J34A 1F8SA 4H7UA 3SXQA 1Y56B 3AE2A 4NEWA 2BS3A 2CDUA 3LXDA 4L3ZA 5CKUA 3CNSA 5JCLA 3SZCA 1GALA 3DJEA 4I59A 1DOEA 2GQFA 4NEVA 1XPQA 4LU6A 4YKGA 4JY3A 1GESA 4CCQA 1W4XA 2VVMA 1H82A 3KPFA 2R4EA 4B69A 3RP8A 1CJ2A 1E1KA 2B9XA 3VRAA 2BCGG 5JCIA 3AD8B 3GYIA 4H2PA 1M1RA 1B37A 2BXSA 3BNFA 3EAOA 4P9SA 2BCPA 4USQA 1IUSA 3T2ZA 3UKHA 1CJCA 3TORA 5KOWA 4BK2A 2ACZA 1BZLA 1GRGA 3AD7B 1KF6A 1BWCA 3RP7A 2WBAA 5J7XA 4LA1A 3ZYXA 4C5OA 3NGCX 1FS8A 4ICYA 4H4SA 3QFAA 3CNPA 3KA7A 4OCGA 3UOZA 1O94A 3BNUA 2C73A 4DSHA 1GEUA 1OAHA 1L9CA 1BKWA 1RYIA 2YWLA 4J2WA 2QA2A 1PBDA 4X9NA 2WESA 4II3A 1UKVG 1ZOYA 2BS4A 2I0ZA 2VOUA 2OA1A 4L38A 4YWOA 2R0CA 4H4ZA 4Z2TA 4U2SA 3S7WA 2W0HA 3AE7A 4B1BA 1LV0A 1N4WA 3AECA 5BUKA 1CBOA 1PDHA 3F8RA 4BK1A 4A6NB 3FBSA 2JKCA 3KLJA 4K7ZA 1X31B 2AAQA 2WOVA 1H81A 1PJ7A 1PHHA 1PXCA 2YLRA 3IWAA 1D4CA 3PO7A 4K22A 3SYIA 4HB9A 4HA6A 4L3YA 4L3XA 3AB1A 3OC4A 3FO3A 4IA6A 1LJ1A 1TYTA 3UKKA 2WP6A 2XFQA 4AT2A 4IVMB 5FS8A 4EMWA 2YG4A 1PBCA 4XWRA 5KMQA 4II2A 2H89A 1O5WA 2C64A 2YLSA 3NK2X 3SQPA 1M1PA 3TTBA 1TDNA 1ZX9A 3NTAA 3GYJA 3P4QA 1NEKA 3HYXA 4X4JA 2V5ZA 1VRQB 4ZCDA 3OWMA 1IUWA 1E39A 3SX6A 3BI2A 1GOSA 2XDOA 1FT5A 1PJ6A 2ZZCA 1K0IA 3F8PA 4GAVA 2ZZBA 3UTGA 1TDFA 2FJAA 3H8LA 4Y4NA 3AEEA 2JB1A 1XHCA 1JEHA 1LQTA 1TRBA 2GVCA 2XVJA 3UKFA 3UKLA 4YTNA 2QCUA 4EQSA 5KVHA 3OZ2A 3AYJA 4EMJA 4EIQA 4BV6A 1S2YA 3AEFA 5C2TA 4H4QA 4G6HA 2EQ6A 3P1WA 1D4EA 5M10A 1XDIA 1EL9A 2GMJA 1JRZA 3NYEA 3AEDA 1GTEA 3NK1X 1NHQA 1CHUA 3M12A 5HYMA 3RNMA 4BK3A 2XVIA 1JRXA 2V3AA 4H4VA 4C77A 4DGKA 1VDCA 2XLPA 2GR2A 1DOBA 1E6EA 4JDRA 4EMIA 4GDPA 2Q7VA 5U1OA 3BHKA 4G6GA 3UTEA 4Q5CA 4U8IA 3GWDA 1EL5A 1YKJA 1HYUA 2BA9A 2GR1A 1JNRA 1GETA 2Y6QA 2WDQA 2R9ZA 3T2KA 1EBDA 2C7GA 3UKAA 1FS9A 3H4KA 2E81A 4EIPA 1BF3A 3UOVA 4EQWA 5KXJA 3LGQA 4A7AA 1EL7A 1F6MA 3AE4A 3HZLA 3LJPA 1P2HA 3BNJA 2C72A 2WPFA 4UP3A 5FS9A 2WP9A 3GDNA 3IHMA 2C67A 2WDRA 3ALMA 3ALLA 2BK5A 1Q1WA 1JNZA 3WE0A 2YLZA 2Z5XA 4U8MA 4DSGA 2VVLG 2J7AA 2OLNA 5IQ1A 3ISHA 4C74A 4TLZA 3NRNA 2YAUA 3QJ4A 2JB3A 4U2LA 4GCMA 5KRQA 2XLTA 1E1MA 4CBQA 4BJZA 2FJDA 2B7SA 3DJJA 3NH3X 4U8NA 1GU6A 2AR8A 2APGA 2X8HA 1ELIA 3LADA 4APNA 4K5SA 3ITJA 3T37A 4A5LA 2X3NA 2C76A 3L8KA 4O5QA 3ICTA 2Q6UA 1ZMCA 2BRYA 3Q6JA 1NG3A 3AYIA 3UKPA 3UTHA 3DJDA 4M52A 3S61A 3T2YA 1PN0A 4CNJA 4JY2A 3REDA 2WPCA 1F8RA 2X8CA 3F29A 4IVOB 4Q0TA 1P2EA 2YM2A 3P9UA 4D03A 1QLBA 2BYBA 3CNTA 4NNJA 4REKA 2PYXA 3UOYA 3PVCA 4J33A 3L1TA 1GRHA 4ADWA 1KNRA 2VVLA 1FCDA 3KVEA 2XFOA 5KWFA 3NG7X 3AD9B 1KSSA 3CGDA 4TM0A 2OALA 2Y6RA 2JBVA 3CNDA 4H2QA 5HHFA 2V60A 3JSKA 2RGJA 1FECA 3SM8A 1F8WA 2E1MA 4YSYA 1TDOA 2UZZA 1GRBA 3CNJA 3SGLA 4TM1A 4A65A 1H86A 3DK8A 3SFDA 2BS2A 1SP3A 1YQ4A 3G5RA 4YSXA 4J57A 1OJAA 2E4GA 3Q9TA 1KSUA 4CCRA 1IUUA 2ARDA 3B6DA 3K7MX 5ER0A 4AP3A 5EBKA 3UU9A 1L0VA 2GV8A 2VZ2A 1IUVA 3KD9A 4Z24A 3UBRA 2AQJA 1YQZA 3GRTA 3KPKA 3QVRA 3NT6A 1ZOVA 4AP1A 4NWZA 1K0LA 3LB8A 1ZK7A 3NLCA 5KMRA 3NNEA 3NYFA 5KMPA 4X9MA 1GTHA 3AYLA 1GRAA 2YVGA 4H4PA 3RP6A 2H88A 1PBFA 2RDZA 1PXBA 1MO9A 2XCGA 2GB0A 2YR4A 1NPXA 2GAGB 4ZCCA 2R46A 3NN0X 2VR0A 3M13A 3AE9A 5KOXA 3GM6A 3ADAB 3HYWA 1PXAA 1H7WA 1H7XA 1NENA 3D8XA 3NTDA 1CC4A 4H4TA 4U8LA 1YQ3A 3GD3A 2BXRA 4Y4MA 2E80A 2HQMA 1S2QA 4UDQA 4DNAA 3R9UA 1H6VA 4C3XA 1XANA 3T0KA 2C70A 2WPEA 2XVEA 4A6NA 1VG9A 3CIRA 3ICSA 2V61A 3URHA 1M64A 1N4VA 2GAHB 1RP0A 3DGZA 2XFNA 2E5VA 1NHPA 2BK3A 2BC0A 3C4NA 4OPDA 2IVDA 1ZKQA 3DJGX 3CGCA 1GPEA 2V6OA 4G74A 4AOXA 2JB2A 3GWFA 3CTYA 4H4WA 4EM3A 2C66A 2FJBA 1L9DA 2YR5A 4FDCB 4H4RA 4OPIA 4YKFA 5BRTA 2VRMA 4Q1OA 4Z43A 1TDKA 2CULA 3UKQA 2YLXA 2B76A 3VRBA 2C3CA 4WCTA 3AE8A 4NTCA 2B9YA 1KFYA 3CPHG 4TM4A 1IUTA 3ATQA 1GRFA 2WQYA 1LVLA 5U63A 3H8IA 5J60A 1DNCA 3EANA 1QJDA 3NKSA 3II4A 3CGEA 5DBJA 2J3NA 2Q0KA 3FIMB 5LV9A 1K4QA 5FS6A 1LPFA 3IF9A 1VG0A 5CQFA 1ZP0A 3UOXA 4Z25A 1E1LA 1PBBA 2X8GA 4MJWA 5JCNA 4IA5A 4B63A 3HYVA 1GERA 3AEGA 2Z5YA 1V59A 3EF6A 3SZ0A 2IIDA 2XVFA 2X99A 1CC6A 3AE1A 4YXDA 3IC9A 3BHFA 2R4JA 2GEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5B A;  1FL2 A;  3BI5 A;  1NG4 A;  4K2X A;  2B7R A;  3NHO X;  3DK4 A;  4H4U A;  2C65 A;  4K5R A;  2PHH A;  1S3B A;  4U8P A;  1D4D A;  4KX6 A;  5FMH A;  1CJ4 A;  4ECH A;  2RAB A;  3NYC A;  1BGN A;  4YSH A;  3CPI G;  1D5T A;  3AWI A;  2OLO A;  2O9Z A;  2YR6 A;  4FX9 A;  4OPT A;  4OVI A;  1PBE A;  2XVH A;  2IVE A;  1Q1R A;  3NN6 X;  4GRT A;  1IJH A;  5KVI A;  3UTF A;  2YLT A;  3RHA A;  3SCE A;  4ZN0 A;  2CFY A;  2OAM A;  3BI4 A;  1NDA A;  3UP4 A;  3FPZ A;  3VR9 A;  1DOC A;  1S3E A;  4OPU A;  4Z26 A;  3BNH A;  3VRD B;  3BNG A;  1GXF A;  3UP5 A;  1GND A;  4B68 A;  4UDR A;  2EQ8 A;  2JAE A;  3KKJ A;  3LZX A;  4H50 A;  3AE5 A;  4I58 A;  4C3Y A;  1OJC A;  3GRS A;  2YG6 A;  3AEA A;  3QFB A;  4J31 A;  3FMW A;  2XLR A;  4A99 A;  2LFC A;  3S5W A;  3C4A A;  1JRY A;  2ZZ0 A;  3QSM A;  3QVP A;  5EB4 A;  2GRT A;  2R0P A;  1KDG A;  1SEZ A;  4JQ9 A;  4OPL A;  4TM3 A;  5BUL A;  3GDP A;  3RKH A;  2B9W A;  2BC1 A;  2Q0L A;  1H84 A;  4JN9 A;  3K7T A;  1NAA A;  4EQX A;  3UCL A;  2BAB A;  3G5S A;  1CF3 A;  1Y56 A;  3I6D A;  3NIX A;  3GMB A;  4TLX A;  2GF3 A;  4UDP A;  2GR0 A;  3V3N A;  1JOA A;  2VQB A;  2DKI A;  3CN8 A;  2XYO A;  2YG3 A;  3AE6 A;  1L9E A;  3NK0 X;  1GRE A;  3EPT A;  4WX1 A;  2F5Z A;  5U25 A;  1GRT A;  1N4U A;  2QAE A;  3AE3 A;  1DJN A;  4YTM A;  3G5Q A;  3DGH A;  1B4V A;  1GV4 A;  2WP5 A;  2WS3 A;  5IQ4 A;  1LQU A;  1CJ3 A;  4B66 A;  1IUX A;  1KNP A;  2GR3 A;  2R45 A;  1K0J A;  4BUR A;  2K3V A;  2XFU A;  4KPR A;  2JK6 A;  2TMD A;  3ATR A;  3DH9 A;  4PAA A;  3I3L A;  1N1P A;  1MOK A;  4U8O A;  3GMC A;  3D1I A;  1DJQ A;  3V76 A;  1BGJ A;  1GT8 A;  1ONF A;  1PJ5 A;  2A87 A;  1Q9I A;  4GUV A;  2WDV A;  2XFP A;  3P4P A;  4RG4 A;  2EQ7 A;  3KU9 A;  1BVB A;  2YQU A;  4H4X A;  4Y4L A;  1GSN A;  1RSG A;  4NTD A;  5GSN A;  5HY5 A;  5IPY A;  1CL0 A;  3DME A;  3CGB A;  4Z2R A;  1NHS A;  4E0V A;  3GYX A;  3O0H A;  4NZH A;  1MXT A;  4USR A;  3QSE A;  3ICR A;  4JNQ A;  4D04 A;  3ZDN A;  1O95 A;  2RGH A;  3B3R A;  1OJ9 A;  3ALJ A;  1E1N A;  3COX A;  1COY A;  3D1C A;  4CY8 A;  1FOH A;  2WET A;  5TR3 A;  2YG7 A;  2NPX A;  3AEB A;  4H4Y A;  1Z6L A;  4U8K A;  2V3B A;  3CPJ G;  2GH5 A;  4XWZ A;  2WU5 A;  3L1R A;  3DK9 A;  4GDE A;  1ZDL A;  4H2R A;  4Z44 A;  1DXL A;  3M0O A;  1JNI A;  2EQ9 A;  3FG2 P;  3K30 A;  5JCK A;  2WEU A;  4EM4 A;  2ZBW A;  3LZW A;  5FS7 A;  1TYP A;  4YSZ A;  4Z2U A;  1M1Q A;  4IV9 A;  1FEB A;  3ABV A;  2GMH A;  2FBW A;  4RG3 A;  2YLW A;  5BVA A;  1YY5 A;  2XLU A;  2A8X A;  4FK1 A;  4GF7 A;  1VQW A;  3P4S A;  3F8D A;  4BJY A;  3SFE A;  1REO A;  4CNK A;  1FEA A;  4Q17 A;  4EQR A;  1CC2 A;  3VQR A;  5L46 A;  2BAC A;  3PS9 A;  4CY6 A;  2YG5 A;  2BK4 A;  4OPC A;  1QO8 A;  2R0G A;  3GSI A;  1EL8 A;  1PS9 A;  4N9X A;  4PAB A;  1E7P A;  4AOS A;  1Y0P A;  3LG1 A;  2GQW A;  3LOV A;  2YM1 A;  2VQ7 A;  1ZMD A;  4K8D A;  1FS7 A;  4O5U A;  3BNM A;  4XXG A;  4J36 A;  1LTX R;  2X50 A;  2A89 A;  2YVF A;  3V3O A;  3VR8 A;  1NHR A;  1FT6 A;  2XLS A;  1OJT A;  4WJY A;  1QDB A;  2RF7 A;  4RSL A;  1B5Q A;  4YTP A;  3GD4 A;  2CVJ A;  3IHG A;  5EB5 A;  2C3D A;  1F3P A;  1B8S A;  2RGO A;  4YT0 A;  4AT0 A;  5JCM A;  2YVJ A;  4GR1 A;  1DOD A;  1ZY8 A;  5C3J A;  3K7Q X;  1JU2 A;  3QSS A;  2WU2 A;  4LII A;  4A9W A;  2ZO5 A;  4JNA A;  4A79 A;  1D7L A;  5M0Z A;  1M6I A;  2NVK X;  2WOI A;  2WOW A;  2WHD A;  4H2N A;  1H83 A;  4U8J A;  4B67 A;  3MMO A;  3E1T A;  2QA1 A;  4B65 A;  3C96 A;  4FK1 C;  3DA1 A;  4J56 A;  2C75 A;  4U2T A;  2VRL A;  1AOG A;  1TDE A;  5HXI A;  4NTE A;  2OT4 A;  2DKH A;  1D7Y A;  2TPR A;  1OJD A;  5GRT A;  2FJE A;  4CRT A;  4OPG A;  5EOW A;  4B64 A;  3P4R A;  3AXB A;  4Q4U A;  4J34 A;  1F8S A;  4H7U A;  3SXQ A;  1Y56 B;  3AE2 A;  4NEW A;  2BS3 A;  2CDU A;  3LXD A;  4L3Z A;  5CKU A;  3CNS A;  5JCL A;  1GAL A;  3DJE A;  4I59 A;  1DOE A;  2GQF A;  4NEV A;  1XPQ A;  4LU6 A;  4YKG A;  4JY3 A;  1GES A;  4CCQ A;  1W4X A;  2VVM A;  1H82 A;  3KPF A;  2R4E A;  4B69 A;  3RP8 A;  1CJ2 A;  1E1K A;  2B9X A;  3VRA A;  2BCG G;  5JCI A;  3AD8 B;  3GYI A;  4H2P A;  1M1R A;  1B37 A;  2BXS A;  3BNF A;  3EAO A;  4P9S A;  2BCP A;  4USQ A;  1IUS A;  3UKH A;  1CJC A;  3TOR A;  5KOW A;  4BK2 A;  2ACZ A;  1BZL A;  1GRG A;  3AD7 B;  1KF6 A;  1BWC A;  3RP7 A;  2WBA A;  5J7X A;  4LA1 A;  3ZYX A;  4C5O A;  3NGC X;  1FS8 A;  4ICY A;  4H4S A;  3QFA A;  3CNP A;  3KA7 A;  4OCG A;  3UOZ A;  1O94 A;  3BNU A;  2C73 A;  4DSH A;  1GEU A;  1OAH A;  1L9C A;  1BKW A;  1RYI A;  2YWL A;  4J2W A;  2QA2 A;  1PBD A;  4X9N A;  2WES A;  1UKV G;  1ZOY A;  2BS4 A;  2I0Z A;  2VOU A;  2OA1 A;  4L38 A;  4YWO A;  2R0C A;  4H4Z A;  4Z2T A;  4U2S A;  3S7W A;  2W0H A;  3AE7 A;  4B1B A;  1LV0 A;  1N4W A;  3AEC A;  5BUK A;  1CBO A;  1PDH A;  3F8R A;  4BK1 A;  4A6N B;  3FBS A;  2JKC A;  3KLJ A;  4K7Z A;  1X31 B;  2AAQ A;  2WOV A;  1H81 A;  1PJ7 A;  1PHH A;  1PXC A;  2YLR A;  3IWA A;  1D4C A;  3PO7 A;  4K22 A;  4HB9 A;  4HA6 A;  4L3Y A;  4L3X A;  3AB1 A;  3OC4 A;  3FO3 A;  4IA6 A;  1LJ1 A;  1TYT A;  3UKK A;  2WP6 A;  2XFQ A;  4AT2 A;  4IVM B;  5FS8 A;  4EMW A;  2YG4 A;  1PBC A;  4XWR A;  2H89 A;  1O5W A;  2C64 A;  2YLS A;  3NK2 X;  3SQP A;  1M1P A;  3TTB A;  1TDN A;  1ZX9 A;  3NTA A;  3GYJ A;  3P4Q A;  1NEK A;  4X4J A;  2V5Z A;  1VRQ B;  4ZCD A;  3OWM A;  1IUW A;  1E39 A;  3BI2 A;  1GOS A;  2XDO A;  1FT5 A;  1PJ6 A;  2ZZC A;  1K0I A;  3F8P A;  2ZZB A;  3UTG A;  1TDF A;  2FJA A;  3H8L A;  4Y4N A;  3AEE A;  2JB1 A;  1XHC A;  1JEH A;  1LQT A;  1TRB A;  2GVC A;  2XVJ A;  3UKF A;  3UKL A;  4YTN A;  2QCU A;  4EQS A;  5KVH A;  3OZ2 A;  3AYJ A;  4EMJ A;  4EIQ A;  4BV6 A;  1S2Y A;  3AEF A;  5C2T A;  4H4Q A;  2EQ6 A;  3P1W A;  1D4E A;  5M10 A;  1XDI A;  1EL9 A;  2GMJ A;  1JRZ A;  3NYE A;  3AED A;  1GTE A;  3NK1 X;  1NHQ A;  1CHU A;  3M12 A;  5HYM A;  3RNM A;  4BK3 A;  2XVI A;  1JRX A;  2V3A A;  4H4V A;  4C77 A;  4DGK A;  1VDC A;  2XLP A;  2GR2 A;  1DOB A;  1E6E A;  4JDR A;  4EMI A;  4GDP A;  2Q7V A;  5U1O A;  3BHK A;  3UTE A;  4Q5C A;  4U8I A;  3GWD A;  1EL5 A;  1YKJ A;  1HYU A;  2BA9 A;  2GR1 A;  1JNR A;  1GET A;  2Y6Q A;  2WDQ A;  2R9Z A;  1EBD A;  2C7G A;  3UKA A;  1FS9 A;  3H4K A;  2E81 A;  4EIP A;  1BF3 A;  3UOV A;  4EQW A;  5KXJ A;  3LGQ A;  4A7A A;  1EL7 A;  1F6M A;  3AE4 A;  3HZL A;  3LJP A;  1P2H A;  3BNJ A;  2C72 A;  2WPF A;  4UP3 A;  5FS9 A;  2WP9 A;  3GDN A;  3IHM A;  2C67 A;  2WDR A;  3ALM A;  3ALL A;  2BK5 A;  1Q1W A;  1JNZ A;  3WE0 A;  2YLZ A;  2Z5X A;  4U8M A;  4DSG A;  2VVL G;  2J7A A;  2OLN A;  5IQ1 A;  3ISH A;  4C74 A;  4TLZ A;  3NRN A;  2YAU A;  3QJ4 A;  2JB3 A;  4U2L A;  4GCM A;  5KRQ A;  2XLT A;  1E1M A;  4CBQ A;  4BJZ A;  2FJD A;  2B7S A;  3DJJ A;  3NH3 X;  4U8N A;  1GU6 A;  2AR8 A;  2APG A;  2X8H A;  1ELI A;  3LAD A;  4APN A;  4K5S A;  3ITJ A;  3T37 A;  4A5L A;  2X3N A;  2C76 A;  3L8K A;  4O5Q A;  3ICT A;  2Q6U A;  1ZMC A;  3Q6J A;  3UKP A;  1NG3 A;  3AYI A;  3UTH A;  3DJD A;  4M52 A;  3S61 A;  1PN0 A;  4CNJ A;  4JY2 A;  3RED A;  2WPC A;  1F8R A;  2X8C A;  3F29 A;  4IVO B;  4Q0T A;  1P2E A;  2YM2 A;  3P9U A;  4D03 A;  1QLB A;  2BYB A;  3CNT A;  4REK A;  2PYX A;  3UOY A;  3PVC A;  4J33 A;  3L1T A;  1GRH A;  4ADW A;  1KNR A;  2VVL A;  1FCD A;  3KVE A;  2XFO A;  5KWF A;  3NG7 X;  3AD9 B;  1KSS A;  3CGD A;  4TM0 A;  2OAL A;  2Y6R A;  2JBV A;  3CND A;  4H2Q A;  5HHF A;  2V60 A;  3JSK A;  2RGJ A;  1FEC A;  3SM8 A;  1F8W A;  2E1M A;  4YSY A;  1TDO A;  2UZZ A;  1GRB A;  3CNJ A;  3SGL A;  4TM1 A;  4A65 A;  1H86 A;  3DK8 A;  3SFD A;  2BS2 A;  1SP3 A;  1YQ4 A;  3G5R A;  4YSX A;  4J57 A;  1OJA A;  2E4G A;  3Q9T A;  1KSU A;  4CCR A;  1IUU A;  2ARD A;  3B6D A;  3K7M X;  5ER0 A;  4AP3 A;  5EBK A;  3UU9 A;  1L0V A;  2GV8 A;  2VZ2 A;  1IUV A;  3KD9 A;  4Z24 A;  3UBR A;  2AQJ A;  1YQZ A;  3GRT A;  3QVR A;  3NT6 A;  1ZOV A;  4AP1 A;  1K0L A;  3LB8 A;  1ZK7 A;  3NLC A;  3NNE A;  3NYF A;  4X9M A;  1GTH A;  3AYL A;  1GRA A;  2YVG A;  4H4P A;  3RP6 A;  2H88 A;  1PBF A;  2RDZ A;  1PXB A;  1MO9 A;  2XCG A;  2GB0 A;  2YR4 A;  1NPX A;  2GAG B;  4ZCC A;  2R46 A;  3NN0 X;  2VR0 A;  3M13 A;  3AE9 A;  5KOX A;  3GM6 A;  3ADA B;  1PXA A;  1H7W A;  1H7X A;  1NEN A;  3D8X A;  3NTD A;  1CC4 A;  4H4T A;  4U8L A;  1YQ3 A;  3GD3 A;  2BXR A;  4Y4M A;  2E80 A;  2HQM A;  1S2Q A;  4UDQ A;  4DNA A;  3R9U A;  1H6V A;  4C3X A;  1XAN A;  2C70 A;  2WPE A;  2XVE A;  4A6N A;  1VG9 A;  3CIR A;  3ICS A;  2V61 A;  3URH A;  1M64 A;  1N4V A;  2GAH B;  1RP0 A;  3DGZ A;  2XFN A;  2E5V A;  1NHP A;  2BK3 A;  2BC0 A;  3C4N A;  4OPD A;  2IVD A;  1ZKQ A;  3DJG X;  3CGC A;  1GPE A;  2V6O A;  4AOX A;  2JB2 A;  3GWF A;  3CTY A;  4H4W A;  4EM3 A;  2C66 A;  2FJB A;  1L9D A;  2YR5 A;  4FDC B;  4H4R A;  4OPI A;  4YKF A;  5BRT A;  2VRM A;  4Q1O A;  4Z43 A;  1TDK A;  2CUL A;  3UKQ A;  2YLX A;  2B76 A;  3VRB A;  2C3C A;  4WCT A;  3AE8 A;  4NTC A;  2B9Y A;  1KFY A;  3CPH G;  4TM4 A;  1IUT A;  3ATQ A;  1GRF A;  2WQY A;  1LVL A;  5U63 A;  3H8I A;  5J60 A;  1DNC A;  3EAN A;  1QJD A;  3NKS A;  3II4 A;  3CGE A;  5DBJ A;  2J3N A;  2Q0K A;  3FIM B;  5LV9 A;  1K4Q A;  5FS6 A;  1LPF A;  3IF9 A;  1VG0 A;  5CQF A;  1ZP0 A;  3UOX A;  4Z25 A;  1E1L A;  1PBB A;  2X8G A;  4MJW A;  5JCN A;  4IA5 A;  4B63 A;  1GER A;  3AEG A;  2Z5Y A;  1V59 A;  3EF6 A;  2IID A;  2XVF A;  2X99 A;  1CC6 A;  3AE1 A;  4YXD A;  3IC9 A;  3BHF A;  2R4J A;  2GEW A; 
#chains in the Genus database with same CATH topology
 4Q5B A;  1FL2 A;  3BI5 A;  1NG4 A;  4K2X A;  2B7R A;  3NHO X;  3DK4 A;  4H4U A;  2C65 A;  4K5R A;  2PHH A;  1S3B A;  4U8P A;  1D4D A;  4KX6 A;  5FMH A;  1CJ4 A;  4ECH A;  2RAB A;  3NYC A;  1BGN A;  4YSH A;  3CPI G;  1D5T A;  3AWI A;  2OLO A;  3SZW A;  2O9Z A;  2YR6 A;  4FX9 A;  4OPT A;  4OVI A;  1PBE A;  2XVH A;  2IVE A;  1Q1R A;  3NN6 X;  4GRT A;  1IJH A;  5KVI A;  3UTF A;  2YLT A;  3RHA A;  3SCE A;  4ZN0 A;  2CFY A;  2OAM A;  3BI4 A;  1NDA A;  3UP4 A;  3FPZ A;  3VR9 A;  1DOC A;  1S3E A;  4OPU A;  4Z26 A;  3BNH A;  3VRD B;  3BNG A;  1GXF A;  3UP5 A;  1GND A;  4B68 A;  4UDR A;  2EQ8 A;  2JAE A;  3KKJ A;  3LZX A;  4H50 A;  3AE5 A;  4I58 A;  4C3Y A;  1OJC A;  3GRS A;  2YG6 A;  3AEA A;  3QFB A;  4J31 A;  3FMW A;  2XLR A;  4A99 A;  2LFC A;  3S5W A;  3C4A A;  1JRY A;  2ZZ0 A;  3QSM A;  3QVP A;  4G73 A;  3SXI A;  5EB4 A;  2GRT A;  2R0P A;  1KDG A;  1SEZ A;  4JQ9 A;  4OPL A;  4TM3 A;  5BUL A;  3GDP A;  3RKH A;  2B9W A;  2BC1 A;  2Q0L A;  1H84 A;  4JN9 A;  3K7T A;  1NAA A;  4EQX A;  3UCL A;  3T14 A;  2BAB A;  3G5S A;  1CF3 A;  1Y56 A;  3I6D A;  3NIX A;  3GMB A;  4TLX A;  2GF3 A;  4UDP A;  2GR0 A;  3V3N A;  1JOA A;  2VQB A;  2DKI A;  3CN8 A;  2XYO A;  2YG3 A;  3AE6 A;  1L9E A;  3NK0 X;  1GRE A;  3EPT A;  4WX1 A;  2F5Z A;  5U25 A;  1GRT A;  1N4U A;  2QAE A;  3AE3 A;  1DJN A;  4YTM A;  3G5Q A;  3DGH A;  1B4V A;  1GV4 A;  2WP5 A;  2WS3 A;  5IQ4 A;  1LQU A;  1CJ3 A;  4B66 A;  1IUX A;  1KNP A;  2GR3 A;  2R45 A;  1K0J A;  4BUR A;  2K3V A;  2XFU A;  4KPR A;  2JK6 A;  2TMD A;  3ATR A;  3DH9 A;  4PAA A;  3I3L A;  1N1P A;  1MOK A;  4U8O A;  3GMC A;  3D1I A;  1DJQ A;  3V76 A;  1BGJ A;  1GT8 A;  1ONF A;  1PJ5 A;  2A87 A;  1Q9I A;  4GAP A;  2WDV A;  2XFP A;  3P4P A;  4GUV A;  2EQ7 A;  3KU9 A;  4RG4 A;  1BVB A;  2YQU A;  4H4X A;  4Y4L A;  1GSN A;  1RSG A;  4NTD A;  5GSN A;  5HY5 A;  5IPY A;  1CL0 A;  3DME A;  3CGB A;  4Z2R A;  1NHS A;  2BRA A;  4E0V A;  3GYX A;  3O0H A;  4NZH A;  1MXT A;  4USR A;  3QSE A;  3ICR A;  4JNQ A;  4D04 A;  3ZDN A;  1O95 A;  2RGH A;  3SZF A;  3CMM A;  3B3R A;  1OJ9 A;  3ALJ A;  1E1N A;  3COX A;  1COY A;  3D1C A;  4CY8 A;  1FOH A;  2CZS A;  2WET A;  3SY4 A;  5TR3 A;  2YG7 A;  2NPX A;  3AEB A;  4H4Y A;  1Z6L A;  4U8K A;  2V3B A;  3CPJ G;  2GH5 A;  4XWZ A;  2WU5 A;  3L1R A;  3DK9 A;  4GDE A;  1ZDL A;  4H2R A;  4Z44 A;  1DXL A;  3M0O A;  1JNI A;  2EQ9 A;  3FG2 P;  5KNL A;  3K30 A;  5JCK A;  2WEU A;  4EM4 A;  2ZBW A;  3LZW A;  5FS7 A;  1TYP A;  4YSZ A;  4Z2U A;  1M1Q A;  4IV9 A;  1FEB A;  3ABV A;  2GMH A;  2FBW A;  4RG3 A;  2YLW A;  5BVA A;  1YY5 A;  2XLU A;  2A8X A;  4FK1 A;  4GF7 A;  1VQW A;  3P4S A;  3F8D A;  4BJY A;  3SFE A;  1REO A;  4CNK A;  1FEA A;  4Q17 A;  4EQR A;  1CC2 A;  3VQR A;  5L46 A;  2BAC A;  3PS9 A;  4CY6 A;  2YG5 A;  2BK4 A;  4G9K A;  4OPC A;  5KMS A;  1QO8 A;  2R0G A;  3GSI A;  1EL8 A;  3T31 A;  1PS9 A;  4N9X A;  4PAB A;  1E7P A;  4AOS A;  1Y0P A;  3LG1 A;  2GQW A;  3LOV A;  2YM1 A;  2VQ7 A;  1ZMD A;  4K8D A;  1FS7 A;  4O5U A;  3BNM A;  4XXG A;  4J36 A;  1LTX R;  2X50 A;  2A89 A;  2YVF A;  3V3O A;  3VR8 A;  1NHR A;  1FT6 A;  2XLS A;  1OJT A;  4WJY A;  1QDB A;  2RF7 A;  4RSL A;  1B5Q A;  4YTP A;  3GD4 A;  2CVJ A;  3IHG A;  5EB5 A;  2C3D A;  1F3P A;  1B8S A;  2RGO A;  4YT0 A;  4AT0 A;  5JCM A;  2YVJ A;  4GR1 A;  1DOD A;  1ZY8 A;  5C3J A;  3K7Q X;  1JU2 A;  3QSS A;  2WU2 A;  4LII A;  4A9W A;  2ZO5 A;  4JNA A;  4A79 A;  1D7L A;  5M0Z A;  1M6I A;  2NVK X;  2WOI A;  2WOW A;  2WHD A;  4H2N A;  1H83 A;  4U8J A;  4B67 A;  3MMO A;  3E1T A;  2QA1 A;  4B65 A;  3C96 A;  4FK1 C;  3DA1 A;  4J56 A;  2C75 A;  4U2T A;  2VRL A;  1AOG A;  1TDE A;  5HXI A;  2C4C A;  4NTE A;  2OT4 A;  2DKH A;  1D7Y A;  2TPR A;  1OJD A;  5GRT A;  2FJE A;  4CRT A;  4OPG A;  5EOW A;  4B64 A;  3P4R A;  3AXB A;  4Q4U A;  4J34 A;  1F8S A;  4H7U A;  3SXQ A;  1Y56 B;  3AE2 A;  4NEW A;  2BS3 A;  2CDU A;  3LXD A;  4L3Z A;  5CKU A;  3CNS A;  5JCL A;  3SZC A;  1GAL A;  3DJE A;  4I59 A;  1DOE A;  2GQF A;  4NEV A;  1XPQ A;  4LU6 A;  4YKG A;  4JY3 A;  1GES A;  4CCQ A;  1W4X A;  2VVM A;  1H82 A;  3KPF A;  2R4E A;  4B69 A;  3RP8 A;  1CJ2 A;  1E1K A;  2B9X A;  3VRA A;  2BCG G;  5JCI A;  3AD8 B;  3GYI A;  4H2P A;  1M1R A;  1B37 A;  2BXS A;  3BNF A;  3EAO A;  4P9S A;  2BCP A;  4USQ A;  1IUS A;  3T2Z A;  3UKH A;  1CJC A;  3TOR A;  5KOW A;  4BK2 A;  2ACZ A;  1BZL A;  1GRG A;  3AD7 B;  1KF6 A;  1BWC A;  3RP7 A;  2WBA A;  5J7X A;  4LA1 A;  3ZYX A;  4C5O A;  3NGC X;  1FS8 A;  4ICY A;  4H4S A;  3QFA A;  3CNP A;  3KA7 A;  4OCG A;  3UOZ A;  1O94 A;  3BNU A;  2C73 A;  4DSH A;  1GEU A;  1OAH A;  1L9C A;  1BKW A;  1RYI A;  2YWL A;  4J2W A;  2QA2 A;  1PBD A;  4X9N A;  2WES A;  4II3 A;  1UKV G;  1ZOY A;  2BS4 A;  2I0Z A;  2VOU A;  2OA1 A;  4L38 A;  4YWO A;  2R0C A;  4H4Z A;  4Z2T A;  4U2S A;  3S7W A;  2W0H A;  3AE7 A;  4B1B A;  1LV0 A;  1N4W A;  3AEC A;  5BUK A;  1CBO A;  1PDH A;  3F8R A;  4BK1 A;  4A6N B;  3FBS A;  2JKC A;  3KLJ A;  4K7Z A;  1X31 B;  2AAQ A;  2WOV A;  1H81 A;  1PJ7 A;  1PHH A;  1PXC A;  2YLR A;  3IWA A;  1D4C A;  3PO7 A;  4K22 A;  3SYI A;  4HB9 A;  4HA6 A;  4L3Y A;  4L3X A;  3AB1 A;  3OC4 A;  3FO3 A;  4IA6 A;  1LJ1 A;  1TYT A;  3UKK A;  2WP6 A;  2XFQ A;  4AT2 A;  4IVM B;  5FS8 A;  4EMW A;  2YG4 A;  1PBC A;  4XWR A;  5KMQ A;  4II2 A;  2H89 A;  1O5W A;  2C64 A;  2YLS A;  3NK2 X;  3SQP A;  1M1P A;  3TTB A;  1TDN A;  1ZX9 A;  3NTA A;  3GYJ A;  3P4Q A;  1NEK A;  3HYX A;  4X4J A;  2V5Z A;  1VRQ B;  4ZCD A;  3OWM A;  1IUW A;  1E39 A;  3SX6 A;  3BI2 A;  1GOS A;  2XDO A;  1FT5 A;  1PJ6 A;  2ZZC A;  1K0I A;  3F8P A;  4GAV A;  2ZZB A;  3UTG A;  1TDF A;  2FJA A;  3H8L A;  4Y4N A;  3AEE A;  2JB1 A;  1XHC A;  1JEH A;  1LQT A;  1TRB A;  2GVC A;  2XVJ A;  3UKF A;  3UKL A;  4YTN A;  2QCU A;  4EQS A;  5KVH A;  3OZ2 A;  3AYJ A;  4EMJ A;  4EIQ A;  4BV6 A;  1S2Y A;  3AEF A;  5C2T A;  4H4Q A;  4G6H A;  2EQ6 A;  3P1W A;  1D4E A;  5M10 A;  1XDI A;  1EL9 A;  2GMJ A;  1JRZ A;  3NYE A;  3AED A;  1GTE A;  3NK1 X;  1NHQ A;  1CHU A;  3M12 A;  5HYM A;  3RNM A;  4BK3 A;  2XVI A;  1JRX A;  2V3A A;  4H4V A;  4C77 A;  4DGK A;  1VDC A;  2XLP A;  2GR2 A;  1DOB A;  1E6E A;  4JDR A;  4EMI A;  4GDP A;  2Q7V A;  5U1O A;  3BHK A;  4G6G A;  3UTE A;  4Q5C A;  4U8I A;  3GWD A;  1EL5 A;  1YKJ A;  1HYU A;  2BA9 A;  2GR1 A;  1JNR A;  1GET A;  2Y6Q A;  2WDQ A;  2R9Z A;  3T2K A;  1EBD A;  2C7G A;  3UKA A;  1FS9 A;  3H4K A;  2E81 A;  4EIP A;  1BF3 A;  3UOV A;  4EQW A;  5KXJ A;  3LGQ A;  4A7A A;  1EL7 A;  1F6M A;  3AE4 A;  3HZL A;  3LJP A;  1P2H A;  3BNJ A;  2C72 A;  2WPF A;  4UP3 A;  5FS9 A;  2WP9 A;  3GDN A;  3IHM A;  2C67 A;  2WDR A;  3ALM A;  3ALL A;  2BK5 A;  1Q1W A;  1JNZ A;  3WE0 A;  2YLZ A;  2Z5X A;  4U8M A;  4DSG A;  2VVL G;  2J7A A;  2OLN A;  5IQ1 A;  3ISH A;  4C74 A;  4TLZ A;  3NRN A;  2YAU A;  3QJ4 A;  2JB3 A;  4U2L A;  4GCM A;  5KRQ A;  2XLT A;  1E1M A;  4CBQ A;  4BJZ A;  2FJD A;  2B7S A;  3DJJ A;  3NH3 X;  4U8N A;  1GU6 A;  2AR8 A;  2APG A;  2X8H A;  1ELI A;  3LAD A;  4APN A;  4K5S A;  3ITJ A;  3T37 A;  4A5L A;  2X3N A;  2C76 A;  3L8K A;  4O5Q A;  3ICT A;  2Q6U A;  1ZMC A;  2BRY A;  3Q6J A;  1NG3 A;  3AYI A;  3UKP A;  3UTH A;  3DJD A;  4M52 A;  3S61 A;  3T2Y A;  1PN0 A;  4CNJ A;  4JY2 A;  3RED A;  2WPC A;  1F8R A;  2X8C A;  3F29 A;  4IVO B;  4Q0T A;  1P2E A;  2YM2 A;  3P9U A;  4D03 A;  1QLB A;  2BYB A;  3CNT A;  4NNJ A;  4REK A;  2PYX A;  3UOY A;  3PVC A;  4J33 A;  3L1T A;  1GRH A;  4ADW A;  1KNR A;  2VVL A;  1FCD A;  3KVE A;  2XFO A;  5KWF A;  3NG7 X;  3AD9 B;  1KSS A;  3CGD A;  4TM0 A;  2OAL A;  2Y6R A;  2JBV A;  3CND A;  4H2Q A;  5HHF A;  2V60 A;  3JSK A;  2RGJ A;  1FEC A;  3SM8 A;  1F8W A;  2E1M A;  4YSY A;  1TDO A;  2UZZ A;  1GRB A;  3CNJ A;  3SGL A;  4TM1 A;  4A65 A;  1H86 A;  3DK8 A;  3SFD A;  2BS2 A;  1SP3 A;  1YQ4 A;  3G5R A;  4YSX A;  4J57 A;  1OJA A;  2E4G A;  3Q9T A;  1KSU A;  4CCR A;  1IUU A;  2ARD A;  3B6D A;  3K7M X;  5ER0 A;  4AP3 A;  5EBK A;  3UU9 A;  1L0V A;  2GV8 A;  2VZ2 A;  1IUV A;  3KD9 A;  4Z24 A;  3UBR A;  2AQJ A;  1YQZ A;  3GRT A;  3KPK A;  3QVR A;  3NT6 A;  1ZOV A;  4AP1 A;  4NWZ A;  1K0L A;  3LB8 A;  1ZK7 A;  3NLC A;  5KMR A;  3NNE A;  3NYF A;  5KMP A;  4X9M A;  1GTH A;  3AYL A;  1GRA A;  2YVG A;  4H4P A;  3RP6 A;  2H88 A;  1PBF A;  2RDZ A;  1PXB A;  1MO9 A;  2XCG A;  2GB0 A;  2YR4 A;  1NPX A;  2GAG B;  4ZCC A;  2R46 A;  3NN0 X;  2VR0 A;  3M13 A;  3AE9 A;  5KOX A;  3GM6 A;  3ADA B;  3HYW A;  1PXA A;  1H7W A;  1H7X A;  1NEN A;  3D8X A;  3NTD A;  1CC4 A;  4H4T A;  4U8L A;  1YQ3 A;  3GD3 A;  2BXR A;  4Y4M A;  2E80 A;  2HQM A;  1S2Q A;  4UDQ A;  4DNA A;  3R9U A;  1H6V A;  4C3X A;  1XAN A;  3T0K A;  2C70 A;  2WPE A;  2XVE A;  4A6N A;  1VG9 A;  3CIR A;  3ICS A;  2V61 A;  3URH A;  1M64 A;  1N4V A;  2GAH B;  1RP0 A;  3DGZ A;  2XFN A;  2E5V A;  1NHP A;  2BK3 A;  2BC0 A;  3C4N A;  4OPD A;  2IVD A;  1ZKQ A;  3DJG X;  3CGC A;  1GPE A;  2V6O A;  4G74 A;  4AOX A;  2JB2 A;  3GWF A;  3CTY A;  4H4W A;  4EM3 A;  2C66 A;  2FJB A;  1L9D A;  2YR5 A;  4FDC B;  4H4R A;  4OPI A;  4YKF A;  5BRT A;  2VRM A;  4Q1O A;  4Z43 A;  1TDK A;  2CUL A;  3UKQ A;  2YLX A;  2B76 A;  3VRB A;  2C3C A;  4WCT A;  3AE8 A;  4NTC A;  2B9Y A;  1KFY A;  3CPH G;  4TM4 A;  1IUT A;  3ATQ A;  1GRF A;  2WQY A;  1LVL A;  5U63 A;  3H8I A;  5J60 A;  1DNC A;  3EAN A;  1QJD A;  3NKS A;  3II4 A;  3CGE A;  5DBJ A;  2J3N A;  2Q0K A;  3FIM B;  5LV9 A;  1K4Q A;  5FS6 A;  1LPF A;  3IF9 A;  1VG0 A;  5CQF A;  1ZP0 A;  3UOX A;  4Z25 A;  1E1L A;  1PBB A;  2X8G A;  4MJW A;  5JCN A;  4IA5 A;  4B63 A;  3HYV A;  1GER A;  3AEG A;  2Z5Y A;  1V59 A;  3EF6 A;  3SZ0 A;  2IID A;  2XVF A;  2X99 A;  1CC6 A;  3AE1 A;  4YXD A;  3IC9 A;  3BHF A;  2R4J A;  2GEW A; 
#chains in the Genus database with same CATH homology
 4Q5B A;  1FL2 A;  3BI5 A;  1NG4 A;  4K2X A;  2B7R A;  3NHO X;  3DK4 A;  4H4U A;  2C65 A;  4K5R A;  2PHH A;  1S3B A;  4U8P A;  1D4D A;  4KX6 A;  5FMH A;  1CJ4 A;  4ECH A;  2RAB A;  3NYC A;  1BGN A;  4YSH A;  3CPI G;  1D5T A;  3AWI A;  2OLO A;  3SZW A;  2O9Z A;  2YR6 A;  4FX9 A;  4OPT A;  4OVI A;  1PBE A;  2XVH A;  2IVE A;  1Q1R A;  3NN6 X;  4GRT A;  1IJH A;  5KVI A;  3UTF A;  2YLT A;  3RHA A;  3SCE A;  4ZN0 A;  2CFY A;  2OAM A;  3BI4 A;  1NDA A;  3UP4 A;  3FPZ A;  3VR9 A;  1DOC A;  1S3E A;  4OPU A;  4Z26 A;  3BNH A;  3VRD B;  3BNG A;  1GXF A;  3UP5 A;  1GND A;  4B68 A;  4UDR A;  2EQ8 A;  2JAE A;  3KKJ A;  3LZX A;  4H50 A;  3AE5 A;  4I58 A;  4C3Y A;  1OJC A;  3GRS A;  2YG6 A;  3AEA A;  3QFB A;  4J31 A;  3FMW A;  2XLR A;  4A99 A;  2LFC A;  3S5W A;  3C4A A;  1JRY A;  2ZZ0 A;  3QSM A;  3QVP A;  4G73 A;  3SXI A;  5EB4 A;  2GRT A;  2R0P A;  1KDG A;  1SEZ A;  4JQ9 A;  4OPL A;  4TM3 A;  5BUL A;  3GDP A;  3RKH A;  2B9W A;  2BC1 A;  2Q0L A;  1H84 A;  4JN9 A;  3K7T A;  1NAA A;  4EQX A;  3UCL A;  3T14 A;  2BAB A;  3G5S A;  1CF3 A;  1Y56 A;  3I6D A;  3NIX A;  3GMB A;  4TLX A;  2GF3 A;  4UDP A;  2GR0 A;  3V3N A;  1JOA A;  2VQB A;  2DKI A;  3CN8 A;  2XYO A;  2YG3 A;  3AE6 A;  1L9E A;  3NK0 X;  1GRE A;  3EPT A;  4WX1 A;  2F5Z A;  5U25 A;  1GRT A;  1N4U A;  2QAE A;  3AE3 A;  1DJN A;  4YTM A;  3G5Q A;  3DGH A;  1B4V A;  1GV4 A;  2WP5 A;  2WS3 A;  5IQ4 A;  1LQU A;  1CJ3 A;  4B66 A;  1IUX A;  1KNP A;  2GR3 A;  2R45 A;  1K0J A;  4BUR A;  2K3V A;  2XFU A;  4KPR A;  2JK6 A;  2TMD A;  3ATR A;  3DH9 A;  4PAA A;  3I3L A;  1N1P A;  1MOK A;  4U8O A;  3GMC A;  3D1I A;  1DJQ A;  3V76 A;  1BGJ A;  1GT8 A;  1ONF A;  1PJ5 A;  2A87 A;  1Q9I A;  4GAP A;  2WDV A;  2XFP A;  3P4P A;  4GUV A;  2EQ7 A;  3KU9 A;  4RG4 A;  1BVB A;  2YQU A;  4H4X A;  4Y4L A;  1GSN A;  1RSG A;  4NTD A;  5GSN A;  5HY5 A;  5IPY A;  1CL0 A;  3DME A;  3CGB A;  4Z2R A;  1NHS A;  2BRA A;  4E0V A;  3GYX A;  3O0H A;  4NZH A;  1MXT A;  4USR A;  3QSE A;  3ICR A;  4JNQ A;  4D04 A;  3ZDN A;  1O95 A;  2RGH A;  3SZF A;  3CMM A;  3B3R A;  1OJ9 A;  3ALJ A;  1E1N A;  3COX A;  1COY A;  3D1C A;  4CY8 A;  1FOH A;  2WET A;  3SY4 A;  5TR3 A;  2YG7 A;  2NPX A;  3AEB A;  4H4Y A;  1Z6L A;  4U8K A;  2V3B A;  3CPJ G;  2GH5 A;  4XWZ A;  2WU5 A;  3L1R A;  3DK9 A;  4GDE A;  1ZDL A;  4H2R A;  4Z44 A;  1DXL A;  3M0O A;  1JNI A;  2EQ9 A;  3FG2 P;  5KNL A;  3K30 A;  5JCK A;  2WEU A;  4EM4 A;  2ZBW A;  3LZW A;  5FS7 A;  1TYP A;  4YSZ A;  4Z2U A;  1M1Q A;  4IV9 A;  1FEB A;  3ABV A;  2GMH A;  2FBW A;  4RG3 A;  2YLW A;  5BVA A;  1YY5 A;  2XLU A;  2A8X A;  4FK1 A;  4GF7 A;  1VQW A;  3P4S A;  3F8D A;  4BJY A;  3SFE A;  1REO A;  4CNK A;  1FEA A;  4Q17 A;  4EQR A;  1CC2 A;  3VQR A;  5L46 A;  2BAC A;  3PS9 A;  4CY6 A;  2YG5 A;  2BK4 A;  4G9K A;  4OPC A;  5KMS A;  1QO8 A;  2R0G A;  3GSI A;  1EL8 A;  3T31 A;  1PS9 A;  4N9X A;  4PAB A;  1E7P A;  4AOS A;  1Y0P A;  3LG1 A;  2GQW A;  3LOV A;  2YM1 A;  2VQ7 A;  1ZMD A;  4K8D A;  1FS7 A;  4O5U A;  3BNM A;  4XXG A;  4J36 A;  1LTX R;  2X50 A;  2A89 A;  2YVF A;  3V3O A;  3VR8 A;  1NHR A;  1FT6 A;  2XLS A;  1OJT A;  4WJY A;  1QDB A;  2RF7 A;  4RSL A;  1B5Q A;  4YTP A;  3GD4 A;  2CVJ A;  3IHG A;  5EB5 A;  2C3D A;  1F3P A;  1B8S A;  2RGO A;  4YT0 A;  4AT0 A;  5JCM A;  2YVJ A;  4GR1 A;  1DOD A;  1ZY8 A;  5C3J A;  3K7Q X;  1JU2 A;  3QSS A;  2WU2 A;  4LII A;  4A9W A;  2ZO5 A;  4JNA A;  4A79 A;  1D7L A;  5M0Z A;  1M6I A;  2NVK X;  2WOI A;  2WOW A;  2WHD A;  4H2N A;  1H83 A;  4U8J A;  4B67 A;  3MMO A;  3E1T A;  2QA1 A;  4B65 A;  3C96 A;  4FK1 C;  3DA1 A;  4J56 A;  2C75 A;  4U2T A;  2VRL A;  1AOG A;  1TDE A;  5HXI A;  2C4C A;  4NTE A;  2OT4 A;  2DKH A;  1D7Y A;  2TPR A;  1OJD A;  5GRT A;  2FJE A;  4CRT A;  4OPG A;  5EOW A;  4B64 A;  3P4R A;  3AXB A;  4Q4U A;  4J34 A;  1F8S A;  4H7U A;  3SXQ A;  1Y56 B;  3AE2 A;  4NEW A;  2BS3 A;  2CDU A;  3LXD A;  4L3Z A;  5CKU A;  3CNS A;  5JCL A;  3SZC A;  1GAL A;  3DJE A;  4I59 A;  1DOE A;  2GQF A;  4NEV A;  1XPQ A;  4LU6 A;  4YKG A;  4JY3 A;  1GES A;  4CCQ A;  1W4X A;  2VVM A;  1H82 A;  3KPF A;  2R4E A;  4B69 A;  3RP8 A;  1CJ2 A;  1E1K A;  2B9X A;  3VRA A;  2BCG G;  5JCI A;  3AD8 B;  3GYI A;  4H2P A;  1M1R A;  1B37 A;  2BXS A;  3BNF A;  3EAO A;  4P9S A;  2BCP A;  4USQ A;  1IUS A;  3T2Z A;  3UKH A;  1CJC A;  3TOR A;  5KOW A;  4BK2 A;  2ACZ A;  1BZL A;  1GRG A;  3AD7 B;  1KF6 A;  1BWC A;  3RP7 A;  2WBA A;  5J7X A;  4LA1 A;  3ZYX A;  4C5O A;  3NGC X;  1FS8 A;  4ICY A;  4H4S A;  3QFA A;  3CNP A;  3KA7 A;  4OCG A;  3UOZ A;  1O94 A;  3BNU A;  2C73 A;  4DSH A;  1GEU A;  1OAH A;  1L9C A;  1BKW A;  1RYI A;  2YWL A;  4J2W A;  2QA2 A;  1PBD A;  4X9N A;  2WES A;  4II3 A;  1UKV G;  1ZOY A;  2BS4 A;  2I0Z A;  2VOU A;  2OA1 A;  4L38 A;  4YWO A;  2R0C A;  4H4Z A;  4Z2T A;  4U2S A;  3S7W A;  2W0H A;  3AE7 A;  4B1B A;  1LV0 A;  1N4W A;  3AEC A;  5BUK A;  1CBO A;  1PDH A;  3F8R A;  4BK1 A;  4A6N B;  3FBS A;  2JKC A;  3KLJ A;  4K7Z A;  1X31 B;  2AAQ A;  2WOV A;  1H81 A;  1PJ7 A;  1PHH A;  1PXC A;  2YLR A;  3IWA A;  1D4C A;  3PO7 A;  4K22 A;  3SYI A;  4HB9 A;  4HA6 A;  4L3Y A;  4L3X A;  3AB1 A;  3OC4 A;  3FO3 A;  4IA6 A;  1LJ1 A;  1TYT A;  3UKK A;  2WP6 A;  2XFQ A;  4AT2 A;  4IVM B;  5FS8 A;  4EMW A;  2YG4 A;  1PBC A;  4XWR A;  5KMQ A;  4II2 A;  2H89 A;  1O5W A;  2C64 A;  2YLS A;  3NK2 X;  3SQP A;  1M1P A;  3TTB A;  1TDN A;  1ZX9 A;  3NTA A;  3GYJ A;  3P4Q A;  1NEK A;  3HYX A;  4X4J A;  2V5Z A;  1VRQ B;  4ZCD A;  3OWM A;  1IUW A;  1E39 A;  3SX6 A;  3BI2 A;  1GOS A;  2XDO A;  1FT5 A;  1PJ6 A;  2ZZC A;  1K0I A;  3F8P A;  4GAV A;  2ZZB A;  3UTG A;  1TDF A;  2FJA A;  3H8L A;  4Y4N A;  3AEE A;  2JB1 A;  1XHC A;  1JEH A;  1LQT A;  1TRB A;  2GVC A;  2XVJ A;  3UKF A;  3UKL A;  4YTN A;  2QCU A;  4EQS A;  5KVH A;  3OZ2 A;  3AYJ A;  4EMJ A;  4EIQ A;  4BV6 A;  1S2Y A;  3AEF A;  5C2T A;  4H4Q A;  4G6H A;  2EQ6 A;  3P1W A;  1D4E A;  5M10 A;  1XDI A;  1EL9 A;  2GMJ A;  1JRZ A;  3NYE A;  3AED A;  1GTE A;  3NK1 X;  1NHQ A;  1CHU A;  3M12 A;  5HYM A;  3RNM A;  4BK3 A;  2XVI A;  1JRX A;  2V3A A;  4H4V A;  4C77 A;  4DGK A;  1VDC A;  2XLP A;  2GR2 A;  1DOB A;  1E6E A;  4JDR A;  4EMI A;  4GDP A;  2Q7V A;  5U1O A;  3BHK A;  4G6G A;  3UTE A;  4Q5C A;  4U8I A;  3GWD A;  1EL5 A;  1YKJ A;  1HYU A;  2BA9 A;  2GR1 A;  1JNR A;  1GET A;  2Y6Q A;  2WDQ A;  2R9Z A;  3T2K A;  1EBD A;  2C7G A;  3UKA A;  1FS9 A;  3H4K A;  2E81 A;  4EIP A;  1BF3 A;  3UOV A;  4EQW A;  5KXJ A;  3LGQ A;  4A7A A;  1EL7 A;  1F6M A;  3AE4 A;  3HZL A;  3LJP A;  1P2H A;  3BNJ A;  2C72 A;  2WPF A;  4UP3 A;  5FS9 A;  2WP9 A;  3GDN A;  3IHM A;  2C67 A;  2WDR A;  3ALM A;  3ALL A;  2BK5 A;  1Q1W A;  1JNZ A;  3WE0 A;  2YLZ A;  2Z5X A;  4U8M A;  4DSG A;  2VVL G;  2J7A A;  2OLN A;  5IQ1 A;  3ISH A;  4C74 A;  4TLZ A;  3NRN A;  2YAU A;  3QJ4 A;  2JB3 A;  4U2L A;  4GCM A;  5KRQ A;  2XLT A;  1E1M A;  4CBQ A;  4BJZ A;  2FJD A;  2B7S A;  3DJJ A;  3NH3 X;  4U8N A;  1GU6 A;  2AR8 A;  2APG A;  2X8H A;  1ELI A;  3LAD A;  4APN A;  4K5S A;  3ITJ A;  3T37 A;  4A5L A;  2X3N A;  2C76 A;  3L8K A;  4O5Q A;  3ICT A;  2Q6U A;  1ZMC A;  2BRY A;  3Q6J A;  1NG3 A;  3AYI A;  3UKP A;  3UTH A;  3DJD A;  4M52 A;  3S61 A;  3T2Y A;  1PN0 A;  4CNJ A;  4JY2 A;  3RED A;  2WPC A;  1F8R A;  2X8C A;  3F29 A;  4IVO B;  4Q0T A;  1P2E A;  2YM2 A;  3P9U A;  4D03 A;  1QLB A;  2BYB A;  3CNT A;  4NNJ A;  4REK A;  2PYX A;  3UOY A;  3PVC A;  4J33 A;  3L1T A;  1GRH A;  4ADW A;  1KNR A;  2VVL A;  1FCD A;  3KVE A;  2XFO A;  5KWF A;  3NG7 X;  3AD9 B;  1KSS A;  3CGD A;  4TM0 A;  2OAL A;  2Y6R A;  2JBV A;  3CND A;  4H2Q A;  5HHF A;  2V60 A;  3JSK A;  2RGJ A;  1FEC A;  3SM8 A;  1F8W A;  2E1M A;  4YSY A;  1TDO A;  2UZZ A;  1GRB A;  3CNJ A;  3SGL A;  4TM1 A;  4A65 A;  1H86 A;  3DK8 A;  3SFD A;  2BS2 A;  1SP3 A;  1YQ4 A;  3G5R A;  4YSX A;  4J57 A;  1OJA A;  2E4G A;  3Q9T A;  1KSU A;  4CCR A;  1IUU A;  2ARD A;  3B6D A;  3K7M X;  5ER0 A;  4AP3 A;  5EBK A;  3UU9 A;  1L0V A;  2GV8 A;  2VZ2 A;  1IUV A;  3KD9 A;  4Z24 A;  3UBR A;  2AQJ A;  1YQZ A;  3GRT A;  3KPK A;  3QVR A;  3NT6 A;  1ZOV A;  4AP1 A;  4NWZ A;  1K0L A;  3LB8 A;  1ZK7 A;  3NLC A;  5KMR A;  3NNE A;  3NYF A;  5KMP A;  4X9M A;  1GTH A;  3AYL A;  1GRA A;  2YVG A;  4H4P A;  3RP6 A;  2H88 A;  1PBF A;  2RDZ A;  1PXB A;  1MO9 A;  2XCG A;  2GB0 A;  2YR4 A;  1NPX A;  2GAG B;  4ZCC A;  2R46 A;  3NN0 X;  2VR0 A;  3M13 A;  3AE9 A;  5KOX A;  3GM6 A;  3ADA B;  3HYW A;  1PXA A;  1H7W A;  1H7X A;  1NEN A;  3D8X A;  3NTD A;  1CC4 A;  4H4T A;  4U8L A;  1YQ3 A;  3GD3 A;  2BXR A;  4Y4M A;  2E80 A;  2HQM A;  1S2Q A;  4UDQ A;  4DNA A;  3R9U A;  1H6V A;  4C3X A;  1XAN A;  3T0K A;  2C70 A;  2WPE A;  2XVE A;  4A6N A;  1VG9 A;  3CIR A;  3ICS A;  2V61 A;  3URH A;  1M64 A;  1N4V A;  2GAH B;  1RP0 A;  3DGZ A;  2XFN A;  2E5V A;  1NHP A;  2BK3 A;  2BC0 A;  3C4N A;  4OPD A;  2IVD A;  1ZKQ A;  3DJG X;  3CGC A;  1GPE A;  2V6O A;  4G74 A;  4AOX A;  2JB2 A;  3GWF A;  3CTY A;  4H4W A;  4EM3 A;  2C66 A;  2FJB A;  1L9D A;  2YR5 A;  4FDC B;  4H4R A;  4OPI A;  4YKF A;  5BRT A;  2VRM A;  4Q1O A;  4Z43 A;  1TDK A;  2CUL A;  3UKQ A;  2YLX A;  2B76 A;  3VRB A;  2C3C A;  4WCT A;  3AE8 A;  4NTC A;  2B9Y A;  1KFY A;  3CPH G;  4TM4 A;  1IUT A;  3ATQ A;  1GRF A;  2WQY A;  1LVL A;  5U63 A;  3H8I A;  5J60 A;  1DNC A;  3EAN A;  1QJD A;  3NKS A;  3II4 A;  3CGE A;  5DBJ A;  2J3N A;  2Q0K A;  3FIM B;  5LV9 A;  1K4Q A;  5FS6 A;  1LPF A;  3IF9 A;  1VG0 A;  5CQF A;  1ZP0 A;  3UOX A;  4Z25 A;  1E1L A;  1PBB A;  2X8G A;  4MJW A;  5JCN A;  4IA5 A;  4B63 A;  3HYV A;  1GER A;  3AEG A;  2Z5Y A;  1V59 A;  3EF6 A;  3SZ0 A;  2IID A;  2XVF A;  2X99 A;  1CC6 A;  3AE1 A;  4YXD A;  3IC9 A;  3BHF A;  2R4J A;  2GEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...