2B7RA

Structure of e378d mutant flavocytochrome c3
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTDAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fumarate reductase flavoprotein subunit
publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 191
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7rA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7rA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7rA03
3ATRA 4U8PA 1L0VA 2H88A 1JRXA 3AD8B 1EL9A 3LGQA 3NHOX 5EOWA 4Z24A 1N1PA 1GESA 1H83A 3GRTA 2LFCA 4C5OA 5J7XA 1E39A 4OPDA 3DK8A 3SQPA 3KD9A 3QFBA 4YT0A 4XWRA 3AE8A 2DKHA 5U1OA 3BNHA 3NT6A 3DJDA 2AQJA 2B9XA 4BJZA 3OZ2A 4YKGA 2ZZBA 2BABA 4CY6A 4K5RA 4B1BA 3UKKA 2R4JA 1GTHA 4J2WA 1GETA 4OCGA 1IUWA 1GRTA 1GOSA 2XVJA 3F8RA 3ICSA 1YY5A 2GAGB 3F29A 4H2RA 1Q1WA 3BNJA 2AAQA 2VVMA 4A99A 2YLRA 2Q0KA 1PBFA 4H4YA 4H50A 1H7WA 1GSNA 1TYPA 2JBVA 3K7TA 3LJPA 4H4XA 1KFYA 4JQ9A 1KNRA 4FK1C 3V76A 1KDGA 3ISHA 4WJYA 2H89A 3AXBA 2OT4A 1L9EA 3QVRA 1E1MA 4NTCA 3AYLA 1ZOVA 1JRYA 3GSIA 5ER0A 4EIPA 4O5QA 3RHAA 4DSGA 3BI4A 2BA9A 2PHHA 2F5ZA 2XLUA 1REOA 2R4EA 1SP3A 1JNIA 2GQFA 2V3AA 3M12A 3UCLA 1XHCA 2CVJA 5FS8A 3VQRA 4WX1A 3DJJA 2YG3A 4K5SA 3UP5A 4REKA 1CJ3A 2GR1A 1S3BA 3CGBA 4XXGA 5FS9A 2BACA 3IHGA 1OAHA 2YWLA 3NYFA 3QJ4A 4DSHA 3D8XA 4EMIA 4IV9A 4Y4MA 1V59A 1F8WA 3UBRA 3S61A 3NK1X 5KRQA 2WESA 4LA1A 2QCUA 3IC9A 4HA6A 4NTEA 5FMHA 3SM8A 2YG7A 2WQYA 4NTDA 3L1RA 2X50A 1B5QA 1F8SA 3GYXA 3IWAA 2JAEA 1GRHA 3L8KA 5IQ4A 1M6IA 3K30A 2NPXA 1B4VA 2YLXA 4GDPA 2FBWA 1VG0A 4EMJA 4UDRA 5HHFA 1O95A 2GVCA 2RABA 3SFEA 1PXAA 3TTBA 4E0VA 3BNMA 2E4GA 3NIXA 2VRLA 3AECA 4EIQA 4Z2RA 2XYOA 1QDBA 1GREA 1QLBA 4FX9A 1DOEA 1DJNA 1IUSA 4ZCCA 4U8MA 1MO9A 1ZK7A 2B9WA 3IF9A 4U8NA 1PJ6A 2CFYA 3V3NA 2C64A 1JOAA 3CGEA 3QSMA 2I0ZA 1AOGA 3UOZA 4JN9A 1FS7A 2XLRA 3JSKA 1FECA 3R9UA 3AE7A 1GV4A 4Z25A 3AD9B 2V3BA 1IUXA 4CY8A 1Y56B 1XDIA 4B65A 3COXA 1MOKA 3UTFA 3P4RA 2BK5A 5KVHA 1Q9IA 2VQ7A 3P4SA 3QSEA 3D1IA 1L9DA 1TDKA 4U8KA 5EBKA 1PBBA 4L38A 3AYIA 1TDFA 2HQMA 1YQZA 3NKSA 3UKQA 1Y0PA 3SGLA 2PYXA 4H2QA 1IUVA 3WE0A 1M1PA 2VR0A 2B76A 3DMEA 3FMWA 3LOVA 2FJAA 3EAOA 4H4VA 1ZDLA 1BF3A 1E1LA 4WCTA 3E1TA 4H4PA 1GNDA 2YLSA 4APNA 4EQRA 3PO7A 1CC4A 1ONFA 2ARDA 3AYJA 3CIRA 1NDAA 4O5UA 2RGJA 1D7YA 4H4TA 1NAAA 1NHRA 2E5VA 2ZBWA 3DGHA 5CKUA 1KSUA 1JRZA 2YR4A 1B37A 2WP6A 4CNKA 3UKHA 2B7SA 1P2HA 4B63A 4EM4A 2K3VA 3AE2A 3GYIA 3OC4A 4BJYA 3P4PA 1D7LA 2BCGG 3ABVA 1Q1RA 4HB9A 2C67A 4EQXA 4M52A 1OJCA 2YR6A 3MMOA 3C96A 1EBDA 3CNDA 1DJQA 1PBCA 2XFUA 3M0OA 2WDVA 4K22A 2GH5A 4YSZA 1VRQB 3ICTA 1KSSA 1EL7A 1M1RA 5J60A 3I6DA 4BK3A 1FL2A 3GD4A 3NLCA 2YQUA 3AE3A 1GT8A 3DJEA 1VG9A 5HY5A 4B66A 1N4WA 2XLTA 2R46A 4FK1A 2WBAA 3GDNA 2IVEA 1GU6A 4H7UA 4ICYA 3AEEA 4U8OA 2R0CA 3ZYXA 1YQ4A 2NVKX 2X8GA 4GRTA 3NNEA 5C2TA 2QAEA 4AOSA 3FO3A 5KOWA 3CPHG 1CJ4A 2BXRA 2E1MA 3O0HA 4X9MA 3CPJG 3AE9A 1W4XA 3FBSA 1RYIA 2YM2A 1LJ1A 3K7MX 4TM1A 2YLTA 3I3LA 5LV9A 1UKVG 4U2LA 2AR8A 1NHQA 3G5RA 3F8DA 2V60A 1LPFA 2XLPA 2GR3A 2RGOA 4C74A 1GRGA 1PJ7A 4TM0A 2C66A 1H84A 2Q7VA 1NPXA 2BS3A 3C4AA 3G5SA 4NZHA 4AP3A 2B7RA 1GPEA 2XFNA 4YSHA 3GDPA 3GM6A 2DKIA 1GRAA 1N4UA 2YVJA 1ZOYA 2R0GA 2YM1A 3QVPA 3NH3X 3NGCX 3Q6JA 1O5WA 3SCEA 4GDEA 3KKJA 2RDZA 1DOBA 3SFDA 1OJ9A 3ALJA 4Y4LA 3OWMA 3AB1A 4ECHA 2C72A 1RP0A 4TM4A 1BVBA 1F6MA 4YTPA 3RP8A 5M10A 1OJTA 2XFQA 1TDEA 3AD7B 3AEGA 3C4NA 3GWFA 4H4SA 5EB4A 4YWOA 3CNTA 2YVFA 2BS4A 2RF7A 3EPTA 4A5LA 5DBJA 4DNAA 1IUTA 4H4RA 2FJDA 4U2TA 5FS6A 1ZMCA 3AE6A 3NTDA 5U25A 2X99A 2ZO5A 1CBOA 2YR5A 3NN6X 3PVCA 3VR8A 5C3JA 1H86A 2V61A 2XDOA 1GXFA 5BVAA 1O94A 2QA2A 2XFOA 4AT0A 4GUVA 4K2XA 4NEWA 2FJEA 3CNSA 3UKLA 3GD3A 5KWFA 3BNUA 2VVLA 2GEWA 3BI5A 4L3ZA 4H4WA 1XANA 1Z6LA 1LV0A 1E7PA 3UTGA 1TRBA 4J56A 2J3NA 3D1CA 2TMDA 3KU9A 2WOIA 1VDCA 2CULA 3ALLA 3CNPA 4H2NA 3BNFA 2BS2A 3DJGX 2YLZA 3ADAB 4OPGA 1PDHA 1GRBA 2V6OA 4MJWA 1FEBA 2GR0A 4EM3A 4IVMB 3RP7A 2WP9A 5BRTA 3FG2P 3BHKA 3DK4A 5JCMA 1FT5A 2WHDA 3NYEA 1BWCA 3P4QA 2O9ZA 1K0LA 1XPQA 2IVDA 4Z26A 4JY3A 3QSSA 1CC2A 4H2PA 1KF6A 4N9XA 5JCKA 4Z43A 3AE1A 4OPLA 4Q5CA 4Q4UA 2VOUA 3PS9A 3CGCA 2XFPA 4H4UA 2WDQA 2WPEA 1FT6A 2WPCA 4U8IA 4XWZA 3RKHA 4UDPA 3KPFA 2BCPA 4RG4A 4C3YA 2WETA 3FPZA 3UU9A 3NK2X 4OVIA 4UP3A 5KVIA 4Z2TA 4X4JA 1LVLA 4EMWA 4H4ZA 3ATQA 3RP6A 2WDRA 4Q17A 3ITJA 2ZZ0A 4H4QA 1D4DA 2WOWA 4NEVA 2GMHA 4I58A 2A8XA 2CDUA 2OAMA 2YAUA 2GB0A 5EB5A 1PXCA 2C7GA 4U2SA 2X8HA 1VQWA 3CPIG 3IHMA 1TDNA 4YTMA 4A6NB 2TPRA 4BK2A 3B3RA 1BZLA 1PHHA 2X8CA 4DGKA 1PS9A 4Y4NA 4X9NA 4K8DA 3UP4A 4AT2A 3K7QX 4GF7A 3G5QA 4ADWA 2BC0A 1B8SA 4TM3A 3VRDB 2APGA 1S2QA 4D03A 2C3CA 4A9WA 4CCQA 4OPCA 2R0PA 4USRA 3EF6A 4BK1A 3VR9A 4JNQA 1X31B 3LZXA 3LG1A 2GF3A 1DOCA 4ZCDA 1EL5A 4CNJA 1M64A 2VVLG 1FS9A 2V5ZA 1LTXR 2VQBA 4Q0TA 1YKJA 2W0HA 4OPIA 2E80A 3P9UA 3HZLA 2UZZA 3H8LA 1E1KA 1JNZA 3AE4A 4IA6A 5IQ1A 4C77A 4P9SA 4A6NA 2JKCA 4CBQA 2WP5A 4U8JA 2WEUA 1NG4A 4OPTA 4TLZA 2XVIA 4JNAA 5BUKA 5JCLA 2Y6RA 4J36A 1QJDA 2YLWA 1NHPA 2EQ9A 1ZKQA 1PXBA 2RGHA 3NRNA 1NENA 3EANA 4PAAA 3UKPA 2EQ7A 4B64A 1GTEA 2EQ8A 1RSGA 3AEBA 3BI2A 1N4VA 3GWDA 3KLJA 2JB2A 3B6DA 4Z44A 3UOYA 4U8LA 4YXDA 2Z5YA 2J7AA 2C70A 4CRTA 2QA1A 1LQUA 3GRSA 1TDOA 1D5TA 5FS7A 4GR1A 1NHSA 2BK4A 3S7WA 3QFAA 4OPUA 5M0ZA 4B67A 4YSXA 4GCMA 2YG6A 2XVFA 1ZMDA 4RG3A 2GMJA 2EQ6A 4J57A 1BKWA 2YG4A 2C3DA 1ELIA 3NTAA 5BULA 1CHUA 4L3XA 1QO8A 2Q0LA 4JDRA 3ZDNA 2OA1A 2YVGA 4A65A 3Q9TA 3KVEA 4PABA 4EQWA 1OJAA 2OLNA 3UOXA 3UTHA 2GRTA 2ZZCA 3FIMB 1K4QA 3P1WA 3DH9A 2ACZA 3ICRA 1DODA 4Q5BA 1FS8A 5GRTA 2C76A 2C75A 4ZN0A 3DA1A 4BV6A 4BURA 5L46A 3S5WA 1K0IA 3CN8A 4YKFA 4B68A 3AEFA 1D4EA 3DK9A 4A7AA 3AWIA 1P2EA 1OJDA 3NG7X 2C73A 4Z2UA 3AE5A 5IPYA 4J33A 1CJ2A 1F8RA 1H6VA 4IVOB 2A87A 4A79A 2WOVA 1JNRA 3V3OA 3GMBA 4EQSA 5JCIA 2Y6QA 1BGNA 5GSNA 1GALA 2GV8A 2IIDA 2X3NA 4FDCB 3UTEA 2WS3A 4USQA 3REDA 4Q1OA 3ALMA 3T37A 2JB1A 2Q6UA 3NK0X 1K0JA 4CCRA 1MXTA 3UOVA 4RSLA 1IJHA 1L9CA 3II4A 5U63A 4KX6A 1S3EA 2VRMA 2C65A 1PBDA 1D4CA 3M13A 2B9YA 2JB3A 2R9ZA 4I59A 5HYMA 1GRFA 3UKFA 2XVHA 4TLXA 1SEZA 2BXSA 3NN0X 2E81A 1JU2A 1YQ3A 1F3PA 2WPFA 3UKAA 2A89A 2XCGA 3GYJA 1FEAA 4AP1A 1DNCA 3DGZA 2OALA 1PJ5A 1ZY8A 3RNMA 1CL0A 3URHA 3LADA 1E6EA 1GERA 1LQTA 2JK6A 2YG5A 4JY2A 1HYUA 4C3XA 1CC6A 1M1QA 3H4KA 1H81A 1IUUA 2Z5XA 3LXDA 3KA7A 5CQFA 3CNJA 1DXLA 3NYCA 2BYBA 2OLOA 1CF3A 5HXIA 1CJCA 1TYTA 1GEUA 1E1NA 2XLSA 3BHFA 3H8IA 2BK3A 4KPRA 4LU6A 2BC1A 4LIIA 1JEHA 3F8PA 5KXJA 3VRAA 2GAHB 2WU2A 3BNGA 5TR3A 1NEKA 2XVEA 4AOXA 1COYA 1ZX9A 1BGJA 1KNPA 4YTNA 3AEDA 4IA5A 3VRBA 1FOHA 4YSYA 3AEAA 2WU5A 1FCDA 3LZWA 4J31A 3GMCA 3CTYA 1ZP0A 2R45A 1PN0A 5KOXA 3L1TA 1NG3A 2GQWA 4J34A 5JCNA 2FJBA 3LB8A 2VZ2A 3SXQA 4B69A 4K7ZA 1Y56A 3TORA 1H7XA 4D04A 1PBEA 1H82A 2GR2A 3CGDA 4L3YA 1EL8A 1S2YA 4UDQA
chains in the Genus database with same CATH superfamily
3ATRA 4U8PA 1L0VA 2H88A 1JRXA 3AD8B 1EL9A 3LGQA 3NHOX 5EOWA 5KMQA 4Z24A 1N1PA 1GESA 1H83A 3GRTA 2LFCA 4C5OA 5J7XA 1E39A 4OPDA 3SZWA 3DK8A 3SQPA 3KD9A 3QFBA 4YT0A 4XWRA 3AE8A 2DKHA 5U1OA 3BNHA 3NT6A 3DJDA 2AQJA 2B9XA 4BJZA 3OZ2A 4YKGA 2ZZBA 2BABA 4CY6A 4K5RA 4B1BA 3UKKA 2R4JA 3T31A 1GTHA 2BRAA 4J2WA 1GETA 4OCGA 1IUWA 1GRTA 1GOSA 2XVJA 3F8RA 3ICSA 1YY5A 2GAGB 3F29A 4H2RA 1Q1WA 3BNJA 2AAQA 2VVMA 4A99A 2YLRA 2Q0KA 1PBFA 4H4YA 4H50A 1H7WA 1GSNA 5KMRA 1TYPA 2JBVA 3K7TA 3LJPA 4H4XA 1KFYA 4JQ9A 1KNRA 4FK1C 3V76A 1KDGA 3ISHA 4WJYA 2H89A 3AXBA 2OT4A 1L9EA 3QVRA 1E1MA 4NTCA 3SXIA 3AYLA 1ZOVA 1JRYA 3GSIA 5ER0A 4EIPA 4O5QA 3RHAA 4DSGA 3BI4A 2BA9A 2PHHA 2F5ZA 2XLUA 1REOA 2R4EA 1SP3A 1JNIA 2GQFA 2V3AA 3M12A 3UCLA 1XHCA 2CVJA 5FS8A 3VQRA 4WX1A 3DJJA 2YG3A 4K5SA 3UP5A 4REKA 1CJ3A 2GR1A 1S3BA 3CGBA 4XXGA 5FS9A 2BACA 3IHGA 1OAHA 2YWLA 3NYFA 3QJ4A 4DSHA 3D8XA 4EMIA 4IV9A 4Y4MA 1V59A 1F8WA 3UBRA 3S61A 3NK1X 5KRQA 2WESA 4LA1A 2QCUA 3IC9A 4HA6A 4NTEA 5FMHA 3SM8A 2YG7A 2WQYA 4NTDA 3L1RA 2X50A 1B5QA 1F8SA 3GYXA 4NWZA 3IWAA 2JAEA 1GRHA 3L8KA 5IQ4A 1M6IA 3K30A 2NPXA 1B4VA 2YLXA 4GDPA 2FBWA 1VG0A 3SY4A 4EMJA 4UDRA 5HHFA 1O95A 2GVCA 2RABA 3SFEA 1PXAA 3TTBA 4E0VA 3BNMA 2E4GA 3NIXA 2VRLA 3AECA 4EIQA 4Z2RA 2XYOA 1QDBA 1GREA 1QLBA 4FX9A 1DOEA 1DJNA 1IUSA 4ZCCA 4U8MA 1MO9A 1ZK7A 2B9WA 3IF9A 4U8NA 1PJ6A 2CFYA 3V3NA 2C64A 1JOAA 3CGEA 3QSMA 2I0ZA 1AOGA 3UOZA 4JN9A 1FS7A 2XLRA 3JSKA 1FECA 3R9UA 5KMSA 3AE7A 1GV4A 4Z25A 3AD9B 2V3BA 1IUXA 4CY8A 1Y56B 1XDIA 4B65A 3COXA 1MOKA 3UTFA 3P4RA 2BK5A 5KVHA 1Q9IA 2VQ7A 3P4SA 3QSEA 3D1IA 1L9DA 1TDKA 4U8KA 5EBKA 1PBBA 4L38A 3AYIA 1TDFA 2HQMA 1YQZA 3NKSA 3UKQA 1Y0PA 3SGLA 2PYXA 4H2QA 1IUVA 3SZ0A 3WE0A 1M1PA 2VR0A 2B76A 3DMEA 3FMWA 3LOVA 2FJAA 3EAOA 4H4VA 4GAPA 1ZDLA 1BF3A 1E1LA 4WCTA 3E1TA 4H4PA 1GNDA 2YLSA 4APNA 4EQRA 3PO7A 3KPKA 1CC4A 1ONFA 2ARDA 3AYJA 3CIRA 1NDAA 4O5UA 2RGJA 1D7YA 4H4TA 1NAAA 1NHRA 2E5VA 2ZBWA 3DGHA 4II2A 5CKUA 1KSUA 1JRZA 2YR4A 1B37A 2WP6A 4II3A 4CNKA 3UKHA 2B7SA 1P2HA 4B63A 4EM4A 2K3VA 3AE2A 3GYIA 3OC4A 4BJYA 3P4PA 1D7LA 2BCGG 3ABVA 1Q1RA 4HB9A 2C67A 4EQXA 4M52A 1OJCA 2YR6A 3MMOA 3C96A 1EBDA 3CNDA 3T0KA 1DJQA 1PBCA 2XFUA 3M0OA 2WDVA 4K22A 2GH5A 4YSZA 1VRQB 3ICTA 1KSSA 1EL7A 1M1RA 5J60A 3I6DA 4BK3A 1FL2A 3GD4A 3NLCA 2YQUA 3AE3A 1GT8A 3DJEA 1VG9A 5HY5A 4B66A 1N4WA 2XLTA 2R46A 4FK1A 2WBAA 3GDNA 2IVEA 1GU6A 4H7UA 4ICYA 3AEEA 4U8OA 2R0CA 3ZYXA 1YQ4A 2NVKX 2X8GA 4GRTA 3NNEA 5C2TA 2QAEA 4AOSA 3FO3A 5KOWA 3CPHG 1CJ4A 2BXRA 2E1MA 3O0HA 4X9MA 3CPJG 3AE9A 3SZFA 1W4XA 3FBSA 1RYIA 2YM2A 1LJ1A 3K7MX 4TM1A 2YLTA 3I3LA 5LV9A 1UKVG 4U2LA 2AR8A 1NHQA 3G5RA 3F8DA 2V60A 1LPFA 2XLPA 2GR3A 2RGOA 4C74A 1GRGA 1PJ7A 4TM0A 2C66A 1H84A 2Q7VA 1NPXA 2BS3A 3C4AA 3G5SA 4NZHA 4AP3A 2B7RA 1GPEA 2XFNA 4YSHA 3GDPA 3GM6A 2DKIA 1GRAA 1N4UA 2YVJA 1ZOYA 2R0GA 4NNJA 2YM1A 3QVPA 3NH3X 3NGCX 3Q6JA 1O5WA 3SCEA 4GDEA 3KKJA 2RDZA 1DOBA 3SFDA 1OJ9A 3ALJA 4Y4LA 3OWMA 3AB1A 4ECHA 2C72A 1RP0A 4TM4A 1BVBA 1F6MA 4YTPA 3RP8A 5M10A 1OJTA 2XFQA 1TDEA 3AD7B 3AEGA 3C4NA 3GWFA 4H4SA 5EB4A 4YWOA 3CNTA 2YVFA 2BS4A 2RF7A 3EPTA 4A5LA 5DBJA 3T2KA 4DNAA 1IUTA 4H4RA 2FJDA 4U2TA 5FS6A 1ZMCA 3AE6A 3NTDA 5U25A 2X99A 2ZO5A 1CBOA 2YR5A 3NN6X 3PVCA 3VR8A 5C3JA 1H86A 2V61A 2XDOA 1GXFA 5BVAA 1O94A 2QA2A 2XFOA 3SZCA 4AT0A 4GUVA 4K2XA 4NEWA 2FJEA 3CNSA 3UKLA 3GD3A 5KWFA 3BNUA 2VVLA 2GEWA 3BI5A 4L3ZA 4H4WA 1XANA 1Z6LA 1LV0A 1E7PA 3UTGA 1TRBA 4J56A 3SX6A 2J3NA 3D1CA 4G6HA 2TMDA 3KU9A 2WOIA 1VDCA 2CULA 3ALLA 3CNPA 4H2NA 3BNFA 2BS2A 4G6GA 3DJGX 2YLZA 3ADAB 4OPGA 1PDHA 1GRBA 2V6OA 4MJWA 1FEBA 2GR0A 4EM3A 4IVMB 3T2ZA 3RP7A 2WP9A 5BRTA 3FG2P 3BHKA 3DK4A 5JCMA 1FT5A 2WHDA 3NYEA 1BWCA 3P4QA 2O9ZA 1K0LA 1XPQA 2IVDA 4Z26A 4JY3A 3QSSA 1CC2A 4H2PA 1KF6A 4N9XA 5JCKA 4Z43A 3AE1A 4OPLA 4Q5CA 4Q4UA 2VOUA 3PS9A 3CGCA 2XFPA 4H4UA 2WDQA 2WPEA 1FT6A 2WPCA 3HYWA 4U8IA 4XWZA 3RKHA 4UDPA 3KPFA 2BCPA 4RG4A 4C3YA 2WETA 3FPZA 3UU9A 3NK2X 4OVIA 4UP3A 5KVIA 4Z2TA 4X4JA 1LVLA 4EMWA 4H4ZA 3ATQA 3RP6A 2WDRA 4Q17A 3ITJA 2ZZ0A 4H4QA 1D4DA 2WOWA 4NEVA 2GMHA 4I58A 2A8XA 2CDUA 2OAMA 2YAUA 2GB0A 5EB5A 1PXCA 2C7GA 4U2SA 2X8HA 1VQWA 3CPIG 3IHMA 1TDNA 4YTMA 4A6NB 2TPRA 4BK2A 3B3RA 1BZLA 1PHHA 2X8CA 4DGKA 1PS9A 4Y4NA 4X9NA 4K8DA 3UP4A 4AT2A 3K7QX 4GF7A 3G5QA 4ADWA 2BC0A 1B8SA 4G9KA 4TM3A 3VRDB 2APGA 1S2QA 4D03A 2C3CA 4A9WA 4CCQA 4G73A 4OPCA 2R0PA 4USRA 3EF6A 4BK1A 3VR9A 4JNQA 3T2YA 1X31B 3LZXA 3LG1A 2GF3A 1DOCA 4ZCDA 1EL5A 4CNJA 1M64A 2VVLG 1FS9A 2V5ZA 1LTXR 2VQBA 4Q0TA 1YKJA 2W0HA 4OPIA 2E80A 3P9UA 3HZLA 2UZZA 3H8LA 1E1KA 1JNZA 3AE4A 4IA6A 5IQ1A 4C77A 4P9SA 3HYXA 4A6NA 2JKCA 4CBQA 2WP5A 4U8JA 2WEUA 1NG4A 4OPTA 4TLZA 2XVIA 4JNAA 5BUKA 5JCLA 2Y6RA 4J36A 5KMPA 1QJDA 2YLWA 1NHPA 2EQ9A 1ZKQA 1PXBA 2RGHA 3NRNA 1NENA 3EANA 4PAAA 3UKPA 2EQ7A 4B64A 1GTEA 2EQ8A 1RSGA 3AEBA 3BI2A 1N4VA 3GWDA 3KLJA 2JB2A 3B6DA 4Z44A 3UOYA 4U8LA 4YXDA 2Z5YA 2J7AA 2C70A 4CRTA 2QA1A 1LQUA 3GRSA 1TDOA 1D5TA 5FS7A 4GR1A 1NHSA 2BK4A 3S7WA 3QFAA 4OPUA 5M0ZA 3SYIA 4B67A 4YSXA 4GCMA 2YG6A 2XVFA 1ZMDA 4RG3A 2GMJA 2EQ6A 4J57A 1BKWA 2YG4A 2C3DA 1ELIA 3NTAA 5BULA 1CHUA 4L3XA 1QO8A 2Q0LA 4JDRA 3ZDNA 2OA1A 2YVGA 4A65A 3Q9TA 3KVEA 4PABA 4EQWA 1OJAA 2OLNA 3CMMA 3UOXA 3UTHA 2GRTA 2ZZCA 3FIMB 1K4QA 3P1WA 3DH9A 2ACZA 3ICRA 1DODA 4Q5BA 1FS8A 5GRTA 2C76A 2C75A 4ZN0A 3DA1A 4BV6A 4BURA 5L46A 3S5WA 1K0IA 3CN8A 4GAVA 4YKFA 3AEFA 4B68A 1D4EA 3DK9A 4A7AA 3AWIA 1P2EA 1OJDA 3NG7X 2C73A 4Z2UA 3AE5A 5IPYA 4J33A 1CJ2A 1F8RA 1H6VA 4IVOB 2A87A 4A79A 2WOVA 1JNRA 3V3OA 3GMBA 4EQSA 5JCIA 2Y6QA 1BGNA 5GSNA 1GALA 2GV8A 2IIDA 2X3NA 4FDCB 3UTEA 2WS3A 4USQA 3REDA 4Q1OA 3ALMA 3T37A 2JB1A 2Q6UA 3NK0X 1K0JA 4CCRA 1MXTA 5KNLA 3UOVA 4RSLA 1IJHA 1L9CA 3II4A 5U63A 4KX6A 1S3EA 2VRMA 2C65A 1PBDA 1D4CA 3M13A 2B9YA 2JB3A 2R9ZA 4I59A 5HYMA 1GRFA 3UKFA 2XVHA 4TLXA 1SEZA 2BXSA 3NN0X 2E81A 1JU2A 1YQ3A 1F3PA 2WPFA 4G74A 3UKAA 2A89A 2XCGA 3GYJA 1FEAA 4AP1A 1DNCA 3DGZA 2OALA 1PJ5A 1ZY8A 3RNMA 1CL0A 3URHA 3LADA 1E6EA 1GERA 1LQTA 2JK6A 2YG5A 4JY2A 1HYUA 3T14A 4C3XA 1CC6A 1M1QA 2C4CA 3H4KA 1H81A 1IUUA 2Z5XA 3LXDA 3KA7A 5CQFA 3CNJA 1DXLA 3NYCA 2BYBA 2OLOA 1CF3A 5HXIA 1CJCA 1TYTA 1GEUA 1E1NA 2XLSA 3BHFA 3H8IA 2BK3A 4KPRA 4LU6A 2BC1A 4LIIA 1JEHA 3F8PA 5KXJA 2BRYA 3VRAA 2GAHB 2WU2A 3BNGA 5TR3A 1NEKA 2CZSA 2XVEA 4AOXA 1COYA 1ZX9A 1BGJA 1KNPA 4YTNA 3AEDA 4IA5A 3VRBA 1FOHA 4YSYA 3AEAA 2WU5A 1FCDA 3LZWA 3HYVA 4J31A 3GMCA 3CTYA 1ZP0A 2R45A 1PN0A 5KOXA 3L1TA 1NG3A 2GQWA 4J34A 5JCNA 2FJBA 3LB8A 2VZ2A 3SXQA 4B69A 4K7ZA 1Y56A 3TORA 1H7XA 4D04A 1PBEA 1H82A 2GR2A 3CGDA 4L3YA 1EL8A 1S2YA 4UDQA
chains in the Genus database with same CATH topology
3ATRA 4U8PA 1L0VA 2H88A 1JRXA 3AD8B 1EL9A 3LGQA 3NHOX 5EOWA 5KMQA 4Z24A 1N1PA 1GESA 1H83A 3GRTA 2LFCA 4C5OA 5J7XA 1E39A 4OPDA 3SZWA 3DK8A 3SQPA 3KD9A 3QFBA 4YT0A 4XWRA 3AE8A 2DKHA 5U1OA 3BNHA 3NT6A 3DJDA 2AQJA 2B9XA 4BJZA 3OZ2A 4YKGA 2ZZBA 2BABA 4CY6A 4K5RA 4B1BA 3UKKA 2R4JA 3T31A 1GTHA 2BRAA 4J2WA 1GETA 4OCGA 1IUWA 1GRTA 1GOSA 2XVJA 3F8RA 3ICSA 1YY5A 2GAGB 3F29A 4H2RA 1Q1WA 3BNJA 2AAQA 2VVMA 4A99A 2YLRA 2Q0KA 1PBFA 4H4YA 4H50A 1H7WA 1GSNA 5KMRA 1TYPA 2JBVA 3K7TA 3LJPA 4H4XA 1KFYA 4JQ9A 1KNRA 4FK1C 3V76A 1KDGA 3ISHA 4WJYA 2H89A 3AXBA 2OT4A 1L9EA 3QVRA 1E1MA 4NTCA 3SXIA 3AYLA 1ZOVA 1JRYA 3GSIA 5ER0A 4EIPA 4O5QA 3RHAA 4DSGA 3BI4A 2BA9A 2PHHA 2F5ZA 2XLUA 1REOA 2R4EA 1SP3A 1JNIA 2GQFA 2V3AA 3M12A 3UCLA 1XHCA 2CVJA 5FS8A 3VQRA 4WX1A 3DJJA 2YG3A 4K5SA 3UP5A 4REKA 1CJ3A 2GR1A 1S3BA 3CGBA 4XXGA 5FS9A 2BACA 3IHGA 1OAHA 2YWLA 3NYFA 3QJ4A 4DSHA 3D8XA 4EMIA 4IV9A 4Y4MA 1V59A 1F8WA 3UBRA 3S61A 3NK1X 5KRQA 2WESA 4LA1A 2QCUA 3IC9A 4HA6A 4NTEA 5FMHA 3SM8A 2YG7A 2WQYA 4NTDA 3L1RA 2X50A 1B5QA 1F8SA 3GYXA 4NWZA 3IWAA 2JAEA 1GRHA 3L8KA 5IQ4A 1M6IA 3K30A 2NPXA 1B4VA 2YLXA 4GDPA 2FBWA 1VG0A 3SY4A 4EMJA 4UDRA 5HHFA 1O95A 2GVCA 2RABA 3SFEA 1PXAA 3TTBA 4E0VA 3BNMA 2E4GA 3NIXA 2VRLA 3AECA 4EIQA 4Z2RA 2XYOA 1QDBA 1GREA 1QLBA 4FX9A 1DOEA 1DJNA 1IUSA 4ZCCA 4U8MA 1MO9A 1ZK7A 2B9WA 3IF9A 4U8NA 1PJ6A 2CFYA 3V3NA 2C64A 1JOAA 3CGEA 3QSMA 2I0ZA 1AOGA 3UOZA 4JN9A 1FS7A 2XLRA 3JSKA 1FECA 3R9UA 5KMSA 3AE7A 1GV4A 4Z25A 3AD9B 2V3BA 1IUXA 4CY8A 1Y56B 1XDIA 4B65A 3COXA 1MOKA 3UTFA 3P4RA 2BK5A 5KVHA 1Q9IA 2VQ7A 3P4SA 3QSEA 3D1IA 1L9DA 1TDKA 4U8KA 5EBKA 1PBBA 4L38A 3AYIA 1TDFA 2HQMA 1YQZA 3NKSA 3UKQA 1Y0PA 3SGLA 2PYXA 4H2QA 1IUVA 3SZ0A 3WE0A 1M1PA 2VR0A 2B76A 3DMEA 3FMWA 3LOVA 2FJAA 3EAOA 4H4VA 4GAPA 1ZDLA 1BF3A 1E1LA 4WCTA 3E1TA 4H4PA 1GNDA 2YLSA 4APNA 4EQRA 3PO7A 3KPKA 1CC4A 1ONFA 2ARDA 3AYJA 3CIRA 1NDAA 4O5UA 2RGJA 1D7YA 4H4TA 1NAAA 1NHRA 2E5VA 2ZBWA 3DGHA 4II2A 5CKUA 1KSUA 1JRZA 2YR4A 1B37A 2WP6A 4II3A 4CNKA 3UKHA 2B7SA 1P2HA 4B63A 4EM4A 2K3VA 3AE2A 3GYIA 3OC4A 4BJYA 3P4PA 1D7LA 2BCGG 3ABVA 1Q1RA 4HB9A 2C67A 4EQXA 4M52A 1OJCA 2YR6A 3MMOA 3C96A 1EBDA 3CNDA 3T0KA 1DJQA 1PBCA 2XFUA 3M0OA 2WDVA 4K22A 2GH5A 4YSZA 1VRQB 3ICTA 1KSSA 1EL7A 1M1RA 5J60A 3I6DA 4BK3A 1FL2A 3GD4A 3NLCA 2YQUA 3AE3A 1GT8A 3DJEA 1VG9A 5HY5A 4B66A 1N4WA 2XLTA 2R46A 4FK1A 2WBAA 3GDNA 2IVEA 1GU6A 4H7UA 4ICYA 3AEEA 4U8OA 2R0CA 3ZYXA 1YQ4A 2NVKX 2X8GA 4GRTA 3NNEA 5C2TA 2QAEA 4AOSA 3FO3A 5KOWA 3CPHG 1CJ4A 2BXRA 2E1MA 3O0HA 4X9MA 3CPJG 3AE9A 3SZFA 1W4XA 3FBSA 1RYIA 2YM2A 1LJ1A 3K7MX 4TM1A 2YLTA 3I3LA 5LV9A 1UKVG 4U2LA 2AR8A 1NHQA 3G5RA 3F8DA 2V60A 1LPFA 2XLPA 2GR3A 2RGOA 4C74A 1GRGA 1PJ7A 4TM0A 2C66A 1H84A 2Q7VA 1NPXA 2BS3A 3C4AA 3G5SA 4NZHA 4AP3A 2B7RA 1GPEA 2XFNA 4YSHA 3GDPA 3GM6A 2DKIA 1GRAA 1N4UA 2YVJA 1ZOYA 2R0GA 4NNJA 2YM1A 3QVPA 3NH3X 3NGCX 3Q6JA 1O5WA 3SCEA 4GDEA 3KKJA 2RDZA 1DOBA 3SFDA 1OJ9A 3ALJA 4Y4LA 3OWMA 3AB1A 4ECHA 2C72A 1RP0A 4TM4A 1BVBA 1F6MA 4YTPA 3RP8A 5M10A 1OJTA 2XFQA 1TDEA 3AD7B 3AEGA 3C4NA 3GWFA 4H4SA 5EB4A 4YWOA 3CNTA 2YVFA 2BS4A 2RF7A 3EPTA 4A5LA 5DBJA 3T2KA 4DNAA 1IUTA 4H4RA 2FJDA 4U2TA 5FS6A 1ZMCA 3AE6A 3NTDA 5U25A 2X99A 2ZO5A 1CBOA 2YR5A 3NN6X 3PVCA 3VR8A 5C3JA 1H86A 2V61A 2XDOA 1GXFA 5BVAA 1O94A 2QA2A 2XFOA 3SZCA 4AT0A 4GUVA 4K2XA 4NEWA 2FJEA 3CNSA 3UKLA 3GD3A 5KWFA 3BNUA 2VVLA 2GEWA 3BI5A 4L3ZA 4H4WA 1XANA 1Z6LA 1LV0A 1E7PA 3UTGA 1TRBA 4J56A 3SX6A 2J3NA 3D1CA 4G6HA 2TMDA 3KU9A 2WOIA 1VDCA 2CULA 3ALLA 3CNPA 4H2NA 3BNFA 2BS2A 4G6GA 3DJGX 2YLZA 3ADAB 4OPGA 1PDHA 1GRBA 2V6OA 4MJWA 1FEBA 2GR0A 4EM3A 4IVMB 3T2ZA 3RP7A 2WP9A 5BRTA 3FG2P 3BHKA 3DK4A 5JCMA 1FT5A 2WHDA 3NYEA 1BWCA 3P4QA 2O9ZA 1K0LA 1XPQA 2IVDA 4Z26A 4JY3A 3QSSA 1CC2A 4H2PA 1KF6A 4N9XA 5JCKA 4Z43A 3AE1A 4OPLA 4Q5CA 4Q4UA 2VOUA 3PS9A 3CGCA 2XFPA 4H4UA 2WDQA 2WPEA 1FT6A 2WPCA 3HYWA 4U8IA 4XWZA 3RKHA 4UDPA 3KPFA 2BCPA 4RG4A 4C3YA 2WETA 3FPZA 3UU9A 3NK2X 4OVIA 4UP3A 5KVIA 4Z2TA 4X4JA 1LVLA 4EMWA 4H4ZA 3ATQA 3RP6A 2WDRA 4Q17A 3ITJA 2ZZ0A 4H4QA 1D4DA 2WOWA 4NEVA 2GMHA 4I58A 2A8XA 2CDUA 2OAMA 2YAUA 2GB0A 5EB5A 1PXCA 2C7GA 4U2SA 2X8HA 1VQWA 3CPIG 3IHMA 1TDNA 4YTMA 4A6NB 2TPRA 4BK2A 3B3RA 1BZLA 1PHHA 2X8CA 4DGKA 1PS9A 4Y4NA 4X9NA 4K8DA 3UP4A 4AT2A 3K7QX 4GF7A 3G5QA 4ADWA 2BC0A 1B8SA 4G9KA 4TM3A 3VRDB 2APGA 1S2QA 4D03A 2C3CA 4A9WA 4CCQA 4G73A 4OPCA 2R0PA 4USRA 3EF6A 4BK1A 3VR9A 4JNQA 3T2YA 1X31B 3LZXA 3LG1A 2GF3A 1DOCA 4ZCDA 1EL5A 4CNJA 1M64A 2VVLG 1FS9A 2V5ZA 1LTXR 2VQBA 4Q0TA 1YKJA 2W0HA 4OPIA 2E80A 3P9UA 3HZLA 2UZZA 3H8LA 1E1KA 1JNZA 3AE4A 4IA6A 5IQ1A 4C77A 4P9SA 3HYXA 4A6NA 2JKCA 4CBQA 2WP5A 4U8JA 2WEUA 1NG4A 4OPTA 4TLZA 2XVIA 4JNAA 5BUKA 5JCLA 2Y6RA 4J36A 5KMPA 1QJDA 2YLWA 1NHPA 2EQ9A 1ZKQA 1PXBA 2RGHA 3NRNA 1NENA 3EANA 4PAAA 3UKPA 2EQ7A 4B64A 1GTEA 2EQ8A 1RSGA 3AEBA 3BI2A 1N4VA 3GWDA 3KLJA 2JB2A 3B6DA 4Z44A 3UOYA 4U8LA 4YXDA 2Z5YA 2J7AA 2C70A 4CRTA 2QA1A 1LQUA 3GRSA 1TDOA 1D5TA 5FS7A 4GR1A 1NHSA 2BK4A 3S7WA 3QFAA 4OPUA 5M0ZA 3SYIA 4B67A 4YSXA 4GCMA 2YG6A 2XVFA 1ZMDA 4RG3A 2GMJA 2EQ6A 4J57A 1BKWA 2YG4A 2C3DA 1ELIA 3NTAA 5BULA 1CHUA 4L3XA 1QO8A 2Q0LA 4JDRA 3ZDNA 2OA1A 2YVGA 4A65A 3Q9TA 3KVEA 4PABA 4EQWA 1OJAA 2OLNA 3CMMA 3UOXA 3UTHA 2GRTA 2ZZCA 3FIMB 1K4QA 3P1WA 3DH9A 2ACZA 3ICRA 1DODA 4Q5BA 1FS8A 5GRTA 2C76A 2C75A 4ZN0A 3DA1A 4BV6A 4BURA 5L46A 3S5WA 1K0IA 3CN8A 4GAVA 4YKFA 3AEFA 4B68A 1D4EA 3DK9A 4A7AA 3AWIA 1P2EA 1OJDA 3NG7X 2C73A 4Z2UA 3AE5A 5IPYA 4J33A 1CJ2A 1F8RA 1H6VA 4IVOB 2A87A 4A79A 2WOVA 1JNRA 3V3OA 3GMBA 4EQSA 5JCIA 2Y6QA 1BGNA 5GSNA 1GALA 2GV8A 2IIDA 2X3NA 4FDCB 3UTEA 2WS3A 4USQA 3REDA 4Q1OA 3ALMA 3T37A 2JB1A 2Q6UA 3NK0X 1K0JA 4CCRA 1MXTA 5KNLA 3UOVA 4RSLA 1IJHA 1L9CA 3II4A 5U63A 4KX6A 1S3EA 2VRMA 2C65A 1PBDA 1D4CA 3M13A 2B9YA 2JB3A 2R9ZA 4I59A 5HYMA 1GRFA 3UKFA 2XVHA 4TLXA 1SEZA 2BXSA 3NN0X 2E81A 1JU2A 1YQ3A 1F3PA 2WPFA 4G74A 3UKAA 2A89A 2XCGA 3GYJA 1FEAA 4AP1A 1DNCA 3DGZA 2OALA 1PJ5A 1ZY8A 3RNMA 1CL0A 3URHA 3LADA 1E6EA 1GERA 1LQTA 2JK6A 2YG5A 4JY2A 1HYUA 3T14A 4C3XA 1CC6A 1M1QA 2C4CA 3H4KA 1H81A 1IUUA 2Z5XA 3LXDA 3KA7A 5CQFA 3CNJA 1DXLA 3NYCA 2BYBA 2OLOA 1CF3A 5HXIA 1CJCA 1TYTA 1GEUA 1E1NA 2XLSA 3BHFA 3H8IA 2BK3A 4KPRA 4LU6A 2BC1A 4LIIA 1JEHA 3F8PA 5KXJA 2BRYA 3VRAA 2GAHB 2WU2A 3BNGA 5TR3A 1NEKA 2XVEA 4AOXA 1COYA 1ZX9A 1BGJA 1KNPA 4YTNA 3AEDA 4IA5A 3VRBA 1FOHA 4YSYA 3AEAA 2WU5A 1FCDA 3LZWA 3HYVA 4J31A 3GMCA 3CTYA 1ZP0A 2R45A 1PN0A 5KOXA 3L1TA 1NG3A 2GQWA 4J34A 5JCNA 2FJBA 3LB8A 2VZ2A 3SXQA 4B69A 4K7ZA 1Y56A 3TORA 1H7XA 4D04A 1PBEA 1H82A 2GR2A 3CGDA 4L3YA 1EL8A 1S2YA 4UDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ATR A;  4U8P A;  1L0V A;  2H88 A;  1JRX A;  3AD8 B;  1EL9 A;  3LGQ A;  3NHO X;  5EOW A;  4Z24 A;  1N1P A;  1GES A;  1H83 A;  3GRT A;  2LFC A;  4C5O A;  5J7X A;  1E39 A;  4OPD A;  3DK8 A;  3SQP A;  3KD9 A;  3QFB A;  4YT0 A;  4XWR A;  3AE8 A;  2DKH A;  5U1O A;  3BNH A;  3NT6 A;  3DJD A;  2AQJ A;  2B9X A;  4BJZ A;  3OZ2 A;  4YKG A;  2ZZB A;  2BAB A;  4CY6 A;  4K5R A;  4B1B A;  3UKK A;  2R4J A;  1GTH A;  4J2W A;  1GET A;  4OCG A;  1IUW A;  1GRT A;  1GOS A;  2XVJ A;  3F8R A;  3ICS A;  1YY5 A;  2GAG B;  3F29 A;  4H2R A;  1Q1W A;  3BNJ A;  2AAQ A;  2VVM A;  4A99 A;  2YLR A;  2Q0K A;  1PBF A;  4H4Y A;  4H50 A;  1H7W A;  1GSN A;  1TYP A;  2JBV A;  3K7T A;  3LJP A;  4H4X A;  1KFY A;  4JQ9 A;  1KNR A;  4FK1 C;  3V76 A;  1KDG A;  3ISH A;  4WJY A;  2H89 A;  3AXB A;  2OT4 A;  1L9E A;  3QVR A;  1E1M A;  4NTC A;  3AYL A;  1ZOV A;  1JRY A;  3GSI A;  5ER0 A;  4EIP A;  4O5Q A;  3RHA A;  4DSG A;  3BI4 A;  2BA9 A;  2PHH A;  2F5Z A;  2XLU A;  1REO A;  2R4E A;  1SP3 A;  1JNI A;  2GQF A;  2V3A A;  3M12 A;  3UCL A;  1XHC A;  2CVJ A;  5FS8 A;  3VQR A;  4WX1 A;  3DJJ A;  2YG3 A;  4K5S A;  3UP5 A;  4REK A;  1CJ3 A;  2GR1 A;  1S3B A;  3CGB A;  4XXG A;  5FS9 A;  2BAC A;  3IHG A;  1OAH A;  2YWL A;  3NYF A;  3QJ4 A;  4DSH A;  3D8X A;  4EMI A;  4IV9 A;  4Y4M A;  1V59 A;  1F8W A;  3UBR A;  3S61 A;  3NK1 X;  5KRQ A;  2WES A;  4LA1 A;  2QCU A;  3IC9 A;  4HA6 A;  4NTE A;  5FMH A;  3SM8 A;  2YG7 A;  2WQY A;  4NTD A;  3L1R A;  2X50 A;  1B5Q A;  1F8S A;  3GYX A;  3IWA A;  2JAE A;  1GRH A;  3L8K A;  5IQ4 A;  1M6I A;  3K30 A;  2NPX A;  1B4V A;  2YLX A;  4GDP A;  2FBW A;  1VG0 A;  4EMJ A;  4UDR A;  5HHF A;  1O95 A;  2GVC A;  2RAB A;  3SFE A;  1PXA A;  3TTB A;  4E0V A;  3BNM A;  2E4G A;  3NIX A;  2VRL A;  3AEC A;  4EIQ A;  4Z2R A;  2XYO A;  1QDB A;  1GRE A;  1QLB A;  4FX9 A;  1DOE A;  1DJN A;  1IUS A;  4ZCC A;  4U8M A;  1MO9 A;  1ZK7 A;  2B9W A;  3IF9 A;  4U8N A;  1PJ6 A;  2CFY A;  3V3N A;  2C64 A;  1JOA A;  3CGE A;  3QSM A;  2I0Z A;  1AOG A;  3UOZ A;  4JN9 A;  1FS7 A;  2XLR A;  3JSK A;  1FEC A;  3R9U A;  3AE7 A;  1GV4 A;  4Z25 A;  3AD9 B;  2V3B A;  1IUX A;  4CY8 A;  1Y56 B;  1XDI A;  4B65 A;  3COX A;  1MOK A;  3UTF A;  3P4R A;  2BK5 A;  5KVH A;  1Q9I A;  2VQ7 A;  3P4S A;  3QSE A;  3D1I A;  1L9D A;  1TDK A;  4U8K A;  5EBK A;  1PBB A;  4L38 A;  3AYI A;  1TDF A;  2HQM A;  1YQZ A;  3NKS A;  3UKQ A;  1Y0P A;  3SGL A;  2PYX A;  4H2Q A;  1IUV A;  3WE0 A;  1M1P A;  2VR0 A;  2B76 A;  3DME A;  3FMW A;  3LOV A;  2FJA A;  3EAO A;  4H4V A;  1ZDL A;  1BF3 A;  1E1L A;  4WCT A;  3E1T A;  4H4P A;  1GND A;  2YLS A;  4APN A;  4EQR A;  3PO7 A;  1CC4 A;  1ONF A;  2ARD A;  3AYJ A;  3CIR A;  1NDA A;  4O5U A;  2RGJ A;  1D7Y A;  4H4T A;  1NAA A;  1NHR A;  2E5V A;  2ZBW A;  3DGH A;  5CKU A;  1KSU A;  1JRZ A;  2YR4 A;  1B37 A;  2WP6 A;  4CNK A;  3UKH A;  2B7S A;  1P2H A;  4B63 A;  4EM4 A;  2K3V A;  3AE2 A;  3GYI A;  3OC4 A;  4BJY A;  3P4P A;  1D7L A;  2BCG G;  3ABV A;  1Q1R A;  4HB9 A;  2C67 A;  4EQX A;  4M52 A;  1OJC A;  2YR6 A;  3MMO A;  3C96 A;  1EBD A;  3CND A;  1DJQ A;  1PBC A;  2XFU A;  3M0O A;  2WDV A;  4K22 A;  2GH5 A;  4YSZ A;  1VRQ B;  3ICT A;  1KSS A;  1EL7 A;  1M1R A;  5J60 A;  3I6D A;  4BK3 A;  1FL2 A;  3GD4 A;  3NLC A;  2YQU A;  3AE3 A;  1GT8 A;  3DJE A;  1VG9 A;  5HY5 A;  4B66 A;  1N4W A;  2XLT A;  2R46 A;  4FK1 A;  2WBA A;  3GDN A;  2IVE A;  1GU6 A;  4H7U A;  4ICY A;  3AEE A;  4U8O A;  2R0C A;  3ZYX A;  1YQ4 A;  2NVK X;  2X8G A;  4GRT A;  3NNE A;  5C2T A;  2QAE A;  4AOS A;  3FO3 A;  5KOW A;  3CPH G;  1CJ4 A;  2BXR A;  2E1M A;  3O0H A;  4X9M A;  3CPJ G;  3AE9 A;  1W4X A;  3FBS A;  1RYI A;  2YM2 A;  1LJ1 A;  3K7M X;  4TM1 A;  2YLT A;  3I3L A;  5LV9 A;  1UKV G;  4U2L A;  2AR8 A;  1NHQ A;  3G5R A;  3F8D A;  2V60 A;  1LPF A;  2XLP A;  2GR3 A;  2RGO A;  4C74 A;  1GRG A;  1PJ7 A;  4TM0 A;  2C66 A;  1H84 A;  2Q7V A;  1NPX A;  2BS3 A;  3C4A A;  3G5S A;  4NZH A;  4AP3 A;  2B7R A;  1GPE A;  2XFN A;  4YSH A;  3GDP A;  3GM6 A;  2DKI A;  1GRA A;  1N4U A;  2YVJ A;  1ZOY A;  2R0G A;  2YM1 A;  3QVP A;  3NH3 X;  3NGC X;  3Q6J A;  1O5W A;  3SCE A;  4GDE A;  3KKJ A;  2RDZ A;  1DOB A;  3SFD A;  1OJ9 A;  3ALJ A;  4Y4L A;  3OWM A;  3AB1 A;  4ECH A;  2C72 A;  1RP0 A;  4TM4 A;  1BVB A;  1F6M A;  4YTP A;  3RP8 A;  5M10 A;  1OJT A;  2XFQ A;  1TDE A;  3AD7 B;  3AEG A;  3C4N A;  3GWF A;  4H4S A;  5EB4 A;  4YWO A;  3CNT A;  2YVF A;  2BS4 A;  2RF7 A;  3EPT A;  4A5L A;  5DBJ A;  4DNA A;  1IUT A;  4H4R A;  2FJD A;  4U2T A;  5FS6 A;  1ZMC A;  3AE6 A;  3NTD A;  5U25 A;  2X99 A;  2ZO5 A;  1CBO A;  2YR5 A;  3NN6 X;  3PVC A;  3VR8 A;  5C3J A;  1H86 A;  2V61 A;  2XDO A;  1GXF A;  5BVA A;  1O94 A;  2QA2 A;  2XFO A;  4AT0 A;  4GUV A;  4K2X A;  4NEW A;  2FJE A;  3CNS A;  3UKL A;  3GD3 A;  5KWF A;  3BNU A;  2VVL A;  2GEW A;  3BI5 A;  4L3Z A;  4H4W A;  1XAN A;  1Z6L A;  1LV0 A;  1E7P A;  3UTG A;  1TRB A;  4J56 A;  2J3N A;  3D1C A;  2TMD A;  3KU9 A;  2WOI A;  1VDC A;  2CUL A;  3ALL A;  3CNP A;  4H2N A;  3BNF A;  2BS2 A;  3DJG X;  2YLZ A;  3ADA B;  4OPG A;  1PDH A;  1GRB A;  2V6O A;  4MJW A;  1FEB A;  2GR0 A;  4EM3 A;  4IVM B;  3RP7 A;  2WP9 A;  5BRT A;  3FG2 P;  3BHK A;  3DK4 A;  5JCM A;  1FT5 A;  2WHD A;  3NYE A;  1BWC A;  3P4Q A;  2O9Z A;  1K0L A;  1XPQ A;  2IVD A;  4Z26 A;  4JY3 A;  3QSS A;  1CC2 A;  4H2P A;  1KF6 A;  4N9X A;  5JCK A;  4Z43 A;  3AE1 A;  4OPL A;  4Q5C A;  4Q4U A;  2VOU A;  3PS9 A;  3CGC A;  2XFP A;  4H4U A;  2WDQ A;  2WPE A;  1FT6 A;  2WPC A;  4U8I A;  4XWZ A;  3RKH A;  4UDP A;  3KPF A;  2BCP A;  4RG4 A;  4C3Y A;  2WET A;  3FPZ A;  3UU9 A;  3NK2 X;  4OVI A;  4UP3 A;  5KVI A;  4Z2T A;  4X4J A;  1LVL A;  4EMW A;  4H4Z A;  3ATQ A;  3RP6 A;  2WDR A;  4Q17 A;  3ITJ A;  2ZZ0 A;  4H4Q A;  1D4D A;  2WOW A;  4NEV A;  2GMH A;  4I58 A;  2A8X A;  2CDU A;  2OAM A;  2YAU A;  2GB0 A;  5EB5 A;  1PXC A;  2C7G A;  4U2S A;  2X8H A;  1VQW A;  3CPI G;  3IHM A;  1TDN A;  4YTM A;  4A6N B;  2TPR A;  4BK2 A;  3B3R A;  1BZL A;  1PHH A;  2X8C A;  4DGK A;  1PS9 A;  4Y4N A;  4X9N A;  4K8D A;  3UP4 A;  4AT2 A;  3K7Q X;  4GF7 A;  3G5Q A;  4ADW A;  2BC0 A;  1B8S A;  4TM3 A;  3VRD B;  2APG A;  1S2Q A;  4D03 A;  2C3C A;  4A9W A;  4CCQ A;  4OPC A;  2R0P A;  4USR A;  3EF6 A;  4BK1 A;  3VR9 A;  4JNQ A;  1X31 B;  3LZX A;  3LG1 A;  2GF3 A;  1DOC A;  4ZCD A;  1EL5 A;  4CNJ A;  1M64 A;  2VVL G;  1FS9 A;  2V5Z A;  1LTX R;  2VQB A;  4Q0T A;  1YKJ A;  2W0H A;  4OPI A;  2E80 A;  3P9U A;  3HZL A;  2UZZ A;  3H8L A;  1E1K A;  1JNZ A;  3AE4 A;  4IA6 A;  5IQ1 A;  4C77 A;  4P9S A;  4A6N A;  2JKC A;  4CBQ A;  2WP5 A;  4U8J A;  2WEU A;  1NG4 A;  4OPT A;  4TLZ A;  2XVI A;  4JNA A;  5BUK A;  5JCL A;  2Y6R A;  4J36 A;  1QJD A;  2YLW A;  1NHP A;  2EQ9 A;  1ZKQ A;  1PXB A;  2RGH A;  3NRN A;  1NEN A;  3EAN A;  4PAA A;  3UKP A;  2EQ7 A;  4B64 A;  1GTE A;  2EQ8 A;  1RSG A;  3AEB A;  3BI2 A;  1N4V A;  3GWD A;  3KLJ A;  2JB2 A;  3B6D A;  4Z44 A;  3UOY A;  4U8L A;  4YXD A;  2Z5Y A;  2J7A A;  2C70 A;  4CRT A;  2QA1 A;  1LQU A;  3GRS A;  1TDO A;  1D5T A;  5FS7 A;  4GR1 A;  1NHS A;  2BK4 A;  3S7W A;  3QFA A;  4OPU A;  5M0Z A;  4B67 A;  4YSX A;  4GCM A;  2YG6 A;  2XVF A;  1ZMD A;  4RG3 A;  2GMJ A;  2EQ6 A;  4J57 A;  1BKW A;  2YG4 A;  2C3D A;  1ELI A;  3NTA A;  5BUL A;  1CHU A;  4L3X A;  1QO8 A;  2Q0L A;  4JDR A;  3ZDN A;  2OA1 A;  2YVG A;  4A65 A;  3Q9T A;  3KVE A;  4PAB A;  4EQW A;  1OJA A;  2OLN A;  3UOX A;  3UTH A;  2GRT A;  2ZZC A;  3FIM B;  1K4Q A;  3P1W A;  3DH9 A;  2ACZ A;  3ICR A;  1DOD A;  4Q5B A;  1FS8 A;  5GRT A;  2C76 A;  2C75 A;  4ZN0 A;  3DA1 A;  4BV6 A;  4BUR A;  5L46 A;  3S5W A;  1K0I A;  3CN8 A;  4YKF A;  4B68 A;  3AEF A;  1D4E A;  3DK9 A;  4A7A A;  3AWI A;  1P2E A;  1OJD A;  3NG7 X;  2C73 A;  4Z2U A;  3AE5 A;  5IPY A;  4J33 A;  1CJ2 A;  1F8R A;  1H6V A;  4IVO B;  2A87 A;  4A79 A;  2WOV A;  1JNR A;  3V3O A;  3GMB A;  4EQS A;  5JCI A;  2Y6Q A;  1BGN A;  5GSN A;  1GAL A;  2GV8 A;  2IID A;  2X3N A;  4FDC B;  3UTE A;  2WS3 A;  4USQ A;  3RED A;  4Q1O A;  3ALM A;  3T37 A;  2JB1 A;  2Q6U A;  3NK0 X;  1K0J A;  4CCR A;  1MXT A;  3UOV A;  4RSL A;  1IJH A;  1L9C A;  3II4 A;  5U63 A;  4KX6 A;  1S3E A;  2VRM A;  2C65 A;  1PBD A;  1D4C A;  3M13 A;  2B9Y A;  2JB3 A;  2R9Z A;  4I59 A;  5HYM A;  1GRF A;  3UKF A;  2XVH A;  4TLX A;  1SEZ A;  2BXS A;  3NN0 X;  2E81 A;  1JU2 A;  1YQ3 A;  1F3P A;  2WPF A;  3UKA A;  2A89 A;  2XCG A;  3GYJ A;  1FEA A;  4AP1 A;  1DNC A;  3DGZ A;  2OAL A;  1PJ5 A;  1ZY8 A;  3RNM A;  1CL0 A;  3URH A;  3LAD A;  1E6E A;  1GER A;  1LQT A;  2JK6 A;  2YG5 A;  4JY2 A;  1HYU A;  4C3X A;  1CC6 A;  1M1Q A;  3H4K A;  1H81 A;  1IUU A;  2Z5X A;  3LXD A;  3KA7 A;  5CQF A;  3CNJ A;  1DXL A;  3NYC A;  2BYB A;  2OLO A;  1CF3 A;  5HXI A;  1CJC A;  1TYT A;  1GEU A;  1E1N A;  2XLS A;  3BHF A;  3H8I A;  2BK3 A;  4KPR A;  4LU6 A;  2BC1 A;  4LII A;  1JEH A;  3F8P A;  5KXJ A;  3VRA A;  2GAH B;  2WU2 A;  3BNG A;  5TR3 A;  1NEK A;  2XVE A;  4AOX A;  1COY A;  1ZX9 A;  1BGJ A;  1KNP A;  4YTN A;  3AED A;  4IA5 A;  3VRB A;  1FOH A;  4YSY A;  3AEA A;  2WU5 A;  1FCD A;  3LZW A;  4J31 A;  3GMC A;  3CTY A;  1ZP0 A;  2R45 A;  1PN0 A;  5KOX A;  3L1T A;  1NG3 A;  2GQW A;  4J34 A;  5JCN A;  2FJB A;  3LB8 A;  2VZ2 A;  3SXQ A;  4B69 A;  4K7Z A;  1Y56 A;  3TOR A;  1H7X A;  4D04 A;  1PBE A;  1H82 A;  2GR2 A;  3CGD A;  4L3Y A;  1EL8 A;  1S2Y A;  4UDQ A; 
#chains in the Genus database with same CATH topology
 3ATR A;  4U8P A;  1L0V A;  2H88 A;  1JRX A;  3AD8 B;  1EL9 A;  3LGQ A;  3NHO X;  5EOW A;  5KMQ A;  4Z24 A;  1N1P A;  1GES A;  1H83 A;  3GRT A;  2LFC A;  4C5O A;  5J7X A;  1E39 A;  4OPD A;  3SZW A;  3DK8 A;  3SQP A;  3KD9 A;  3QFB A;  4YT0 A;  4XWR A;  3AE8 A;  2DKH A;  5U1O A;  3BNH A;  3NT6 A;  3DJD A;  2AQJ A;  2B9X A;  4BJZ A;  3OZ2 A;  4YKG A;  2ZZB A;  2BAB A;  4CY6 A;  4K5R A;  4B1B A;  3UKK A;  2R4J A;  3T31 A;  1GTH A;  2BRA A;  4J2W A;  1GET A;  4OCG A;  1IUW A;  1GRT A;  1GOS A;  2XVJ A;  3F8R A;  3ICS A;  1YY5 A;  2GAG B;  3F29 A;  4H2R A;  1Q1W A;  3BNJ A;  2AAQ A;  2VVM A;  4A99 A;  2YLR A;  2Q0K A;  1PBF A;  4H4Y A;  4H50 A;  1H7W A;  1GSN A;  5KMR A;  1TYP A;  2JBV A;  3K7T A;  3LJP A;  4H4X A;  1KFY A;  4JQ9 A;  1KNR A;  4FK1 C;  3V76 A;  1KDG A;  3ISH A;  4WJY A;  2H89 A;  3AXB A;  2OT4 A;  1L9E A;  3QVR A;  1E1M A;  4NTC A;  3SXI A;  3AYL A;  1ZOV A;  1JRY A;  3GSI A;  5ER0 A;  4EIP A;  4O5Q A;  3RHA A;  4DSG A;  3BI4 A;  2BA9 A;  2PHH A;  2F5Z A;  2XLU A;  1REO A;  2R4E A;  1SP3 A;  1JNI A;  2GQF A;  2V3A A;  3M12 A;  3UCL A;  1XHC A;  2CVJ A;  5FS8 A;  3VQR A;  4WX1 A;  3DJJ A;  2YG3 A;  4K5S A;  3UP5 A;  4REK A;  1CJ3 A;  2GR1 A;  1S3B A;  3CGB A;  4XXG A;  5FS9 A;  2BAC A;  3IHG A;  1OAH A;  2YWL A;  3NYF A;  3QJ4 A;  4DSH A;  3D8X A;  4EMI A;  4IV9 A;  4Y4M A;  1V59 A;  1F8W A;  3UBR A;  3S61 A;  3NK1 X;  5KRQ A;  2WES A;  4LA1 A;  2QCU A;  3IC9 A;  4HA6 A;  4NTE A;  5FMH A;  3SM8 A;  2YG7 A;  2WQY A;  4NTD A;  3L1R A;  2X50 A;  1B5Q A;  1F8S A;  3GYX A;  4NWZ A;  3IWA A;  2JAE A;  1GRH A;  3L8K A;  5IQ4 A;  1M6I A;  3K30 A;  2NPX A;  1B4V A;  2YLX A;  4GDP A;  2FBW A;  1VG0 A;  3SY4 A;  4EMJ A;  4UDR A;  5HHF A;  1O95 A;  2GVC A;  2RAB A;  3SFE A;  1PXA A;  3TTB A;  4E0V A;  3BNM A;  2E4G A;  3NIX A;  2VRL A;  3AEC A;  4EIQ A;  4Z2R A;  2XYO A;  1QDB A;  1GRE A;  1QLB A;  4FX9 A;  1DOE A;  1DJN A;  1IUS A;  4ZCC A;  4U8M A;  1MO9 A;  1ZK7 A;  2B9W A;  3IF9 A;  4U8N A;  1PJ6 A;  2CFY A;  3V3N A;  2C64 A;  1JOA A;  3CGE A;  3QSM A;  2I0Z A;  1AOG A;  3UOZ A;  4JN9 A;  1FS7 A;  2XLR A;  3JSK A;  1FEC A;  3R9U A;  5KMS A;  3AE7 A;  1GV4 A;  4Z25 A;  3AD9 B;  2V3B A;  1IUX A;  4CY8 A;  1Y56 B;  1XDI A;  4B65 A;  3COX A;  1MOK A;  3UTF A;  3P4R A;  2BK5 A;  5KVH A;  1Q9I A;  2VQ7 A;  3P4S A;  3QSE A;  3D1I A;  1L9D A;  1TDK A;  4U8K A;  5EBK A;  1PBB A;  4L38 A;  3AYI A;  1TDF A;  2HQM A;  1YQZ A;  3NKS A;  3UKQ A;  1Y0P A;  3SGL A;  2PYX A;  4H2Q A;  1IUV A;  3SZ0 A;  3WE0 A;  1M1P A;  2VR0 A;  2B76 A;  3DME A;  3FMW A;  3LOV A;  2FJA A;  3EAO A;  4H4V A;  4GAP A;  1ZDL A;  1BF3 A;  1E1L A;  4WCT A;  3E1T A;  4H4P A;  1GND A;  2YLS A;  4APN A;  4EQR A;  3PO7 A;  3KPK A;  1CC4 A;  1ONF A;  2ARD A;  3AYJ A;  3CIR A;  1NDA A;  4O5U A;  2RGJ A;  1D7Y A;  4H4T A;  1NAA A;  1NHR A;  2E5V A;  2ZBW A;  3DGH A;  4II2 A;  5CKU A;  1KSU A;  1JRZ A;  2YR4 A;  1B37 A;  2WP6 A;  4II3 A;  4CNK A;  3UKH A;  2B7S A;  1P2H A;  4B63 A;  4EM4 A;  2K3V A;  3AE2 A;  3GYI A;  3OC4 A;  4BJY A;  3P4P A;  1D7L A;  2BCG G;  3ABV A;  1Q1R A;  4HB9 A;  2C67 A;  4EQX A;  4M52 A;  1OJC A;  2YR6 A;  3MMO A;  3C96 A;  1EBD A;  3CND A;  3T0K A;  1DJQ A;  1PBC A;  2XFU A;  3M0O A;  2WDV A;  4K22 A;  2GH5 A;  4YSZ A;  1VRQ B;  3ICT A;  1KSS A;  1EL7 A;  1M1R A;  5J60 A;  3I6D A;  4BK3 A;  1FL2 A;  3GD4 A;  3NLC A;  2YQU A;  3AE3 A;  1GT8 A;  3DJE A;  1VG9 A;  5HY5 A;  4B66 A;  1N4W A;  2XLT A;  2R46 A;  4FK1 A;  2WBA A;  3GDN A;  2IVE A;  1GU6 A;  4H7U A;  4ICY A;  3AEE A;  4U8O A;  2R0C A;  3ZYX A;  1YQ4 A;  2NVK X;  2X8G A;  4GRT A;  3NNE A;  5C2T A;  2QAE A;  4AOS A;  3FO3 A;  5KOW A;  3CPH G;  1CJ4 A;  2BXR A;  2E1M A;  3O0H A;  4X9M A;  3CPJ G;  3AE9 A;  3SZF A;  1W4X A;  3FBS A;  1RYI A;  2YM2 A;  1LJ1 A;  3K7M X;  4TM1 A;  2YLT A;  3I3L A;  5LV9 A;  1UKV G;  4U2L A;  2AR8 A;  1NHQ A;  3G5R A;  3F8D A;  2V60 A;  1LPF A;  2XLP A;  2GR3 A;  2RGO A;  4C74 A;  1GRG A;  1PJ7 A;  4TM0 A;  2C66 A;  1H84 A;  2Q7V A;  1NPX A;  2BS3 A;  3C4A A;  3G5S A;  4NZH A;  4AP3 A;  2B7R A;  1GPE A;  2XFN A;  4YSH A;  3GDP A;  3GM6 A;  2DKI A;  1GRA A;  1N4U A;  2YVJ A;  1ZOY A;  2R0G A;  4NNJ A;  2YM1 A;  3QVP A;  3NH3 X;  3NGC X;  3Q6J A;  1O5W A;  3SCE A;  4GDE A;  3KKJ A;  2RDZ A;  1DOB A;  3SFD A;  1OJ9 A;  3ALJ A;  4Y4L A;  3OWM A;  3AB1 A;  4ECH A;  2C72 A;  1RP0 A;  4TM4 A;  1BVB A;  1F6M A;  4YTP A;  3RP8 A;  5M10 A;  1OJT A;  2XFQ A;  1TDE A;  3AD7 B;  3AEG A;  3C4N A;  3GWF A;  4H4S A;  5EB4 A;  4YWO A;  3CNT A;  2YVF A;  2BS4 A;  2RF7 A;  3EPT A;  4A5L A;  5DBJ A;  3T2K A;  4DNA A;  1IUT A;  4H4R A;  2FJD A;  4U2T A;  5FS6 A;  1ZMC A;  3AE6 A;  3NTD A;  5U25 A;  2X99 A;  2ZO5 A;  1CBO A;  2YR5 A;  3NN6 X;  3PVC A;  3VR8 A;  5C3J A;  1H86 A;  2V61 A;  2XDO A;  1GXF A;  5BVA A;  1O94 A;  2QA2 A;  2XFO A;  3SZC A;  4AT0 A;  4GUV A;  4K2X A;  4NEW A;  2FJE A;  3CNS A;  3UKL A;  3GD3 A;  5KWF A;  3BNU A;  2VVL A;  2GEW A;  3BI5 A;  4L3Z A;  4H4W A;  1XAN A;  1Z6L A;  1LV0 A;  1E7P A;  3UTG A;  1TRB A;  4J56 A;  3SX6 A;  2J3N A;  3D1C A;  4G6H A;  2TMD A;  3KU9 A;  2WOI A;  1VDC A;  2CUL A;  3ALL A;  3CNP A;  4H2N A;  3BNF A;  2BS2 A;  4G6G A;  3DJG X;  2YLZ A;  3ADA B;  4OPG A;  1PDH A;  1GRB A;  2V6O A;  4MJW A;  1FEB A;  2GR0 A;  4EM3 A;  4IVM B;  3T2Z A;  3RP7 A;  2WP9 A;  5BRT A;  3FG2 P;  3BHK A;  3DK4 A;  5JCM A;  1FT5 A;  2WHD A;  3NYE A;  1BWC A;  3P4Q A;  2O9Z A;  1K0L A;  1XPQ A;  2IVD A;  4Z26 A;  4JY3 A;  3QSS A;  1CC2 A;  4H2P A;  1KF6 A;  4N9X A;  5JCK A;  4Z43 A;  3AE1 A;  4OPL A;  4Q5C A;  4Q4U A;  2VOU A;  3PS9 A;  3CGC A;  2XFP A;  4H4U A;  2WDQ A;  2WPE A;  1FT6 A;  2WPC A;  3HYW A;  4U8I A;  4XWZ A;  3RKH A;  4UDP A;  3KPF A;  2BCP A;  4RG4 A;  4C3Y A;  2WET A;  3FPZ A;  3UU9 A;  3NK2 X;  4OVI A;  4UP3 A;  5KVI A;  4Z2T A;  4X4J A;  1LVL A;  4EMW A;  4H4Z A;  3ATQ A;  3RP6 A;  2WDR A;  4Q17 A;  3ITJ A;  2ZZ0 A;  4H4Q A;  1D4D A;  2WOW A;  4NEV A;  2GMH A;  4I58 A;  2A8X A;  2CDU A;  2OAM A;  2YAU A;  2GB0 A;  5EB5 A;  1PXC A;  2C7G A;  4U2S A;  2X8H A;  1VQW A;  3CPI G;  3IHM A;  1TDN A;  4YTM A;  4A6N B;  2TPR A;  4BK2 A;  3B3R A;  1BZL A;  1PHH A;  2X8C A;  4DGK A;  1PS9 A;  4Y4N A;  4X9N A;  4K8D A;  3UP4 A;  4AT2 A;  3K7Q X;  4GF7 A;  3G5Q A;  4ADW A;  2BC0 A;  1B8S A;  4G9K A;  4TM3 A;  3VRD B;  2APG A;  1S2Q A;  4D03 A;  2C3C A;  4A9W A;  4CCQ A;  4G73 A;  4OPC A;  2R0P A;  4USR A;  3EF6 A;  4BK1 A;  3VR9 A;  4JNQ A;  3T2Y A;  1X31 B;  3LZX A;  3LG1 A;  2GF3 A;  1DOC A;  4ZCD A;  1EL5 A;  4CNJ A;  1M64 A;  2VVL G;  1FS9 A;  2V5Z A;  1LTX R;  2VQB A;  4Q0T A;  1YKJ A;  2W0H A;  4OPI A;  2E80 A;  3P9U A;  3HZL A;  2UZZ A;  3H8L A;  1E1K A;  1JNZ A;  3AE4 A;  4IA6 A;  5IQ1 A;  4C77 A;  4P9S A;  3HYX A;  4A6N A;  2JKC A;  4CBQ A;  2WP5 A;  4U8J A;  2WEU A;  1NG4 A;  4OPT A;  4TLZ A;  2XVI A;  4JNA A;  5BUK A;  5JCL A;  2Y6R A;  4J36 A;  5KMP A;  1QJD A;  2YLW A;  1NHP A;  2EQ9 A;  1ZKQ A;  1PXB A;  2RGH A;  3NRN A;  1NEN A;  3EAN A;  4PAA A;  3UKP A;  2EQ7 A;  4B64 A;  1GTE A;  2EQ8 A;  1RSG A;  3AEB A;  3BI2 A;  1N4V A;  3GWD A;  3KLJ A;  2JB2 A;  3B6D A;  4Z44 A;  3UOY A;  4U8L A;  4YXD A;  2Z5Y A;  2J7A A;  2C70 A;  4CRT A;  2QA1 A;  1LQU A;  3GRS A;  1TDO A;  1D5T A;  5FS7 A;  4GR1 A;  1NHS A;  2BK4 A;  3S7W A;  3QFA A;  4OPU A;  5M0Z A;  3SYI A;  4B67 A;  4YSX A;  4GCM A;  2YG6 A;  2XVF A;  1ZMD A;  4RG3 A;  2GMJ A;  2EQ6 A;  4J57 A;  1BKW A;  2YG4 A;  2C3D A;  1ELI A;  3NTA A;  5BUL A;  1CHU A;  4L3X A;  1QO8 A;  2Q0L A;  4JDR A;  3ZDN A;  2OA1 A;  2YVG A;  4A65 A;  3Q9T A;  3KVE A;  4PAB A;  4EQW A;  1OJA A;  2OLN A;  3CMM A;  3UOX A;  3UTH A;  2GRT A;  2ZZC A;  3FIM B;  1K4Q A;  3P1W A;  3DH9 A;  2ACZ A;  3ICR A;  1DOD A;  4Q5B A;  1FS8 A;  5GRT A;  2C76 A;  2C75 A;  4ZN0 A;  3DA1 A;  4BV6 A;  4BUR A;  5L46 A;  3S5W A;  1K0I A;  3CN8 A;  4GAV A;  4YKF A;  3AEF A;  4B68 A;  1D4E A;  3DK9 A;  4A7A A;  3AWI A;  1P2E A;  1OJD A;  3NG7 X;  2C73 A;  4Z2U A;  3AE5 A;  5IPY A;  4J33 A;  1CJ2 A;  1F8R A;  1H6V A;  4IVO B;  2A87 A;  4A79 A;  2WOV A;  1JNR A;  3V3O A;  3GMB A;  4EQS A;  5JCI A;  2Y6Q A;  1BGN A;  5GSN A;  1GAL A;  2GV8 A;  2IID A;  2X3N A;  4FDC B;  3UTE A;  2WS3 A;  4USQ A;  3RED A;  4Q1O A;  3ALM A;  3T37 A;  2JB1 A;  2Q6U A;  3NK0 X;  1K0J A;  4CCR A;  1MXT A;  5KNL A;  3UOV A;  4RSL A;  1IJH A;  1L9C A;  3II4 A;  5U63 A;  4KX6 A;  1S3E A;  2VRM A;  2C65 A;  1PBD A;  1D4C A;  3M13 A;  2B9Y A;  2JB3 A;  2R9Z A;  4I59 A;  5HYM A;  1GRF A;  3UKF A;  2XVH A;  4TLX A;  1SEZ A;  2BXS A;  3NN0 X;  2E81 A;  1JU2 A;  1YQ3 A;  1F3P A;  2WPF A;  4G74 A;  3UKA A;  2A89 A;  2XCG A;  3GYJ A;  1FEA A;  4AP1 A;  1DNC A;  3DGZ A;  2OAL A;  1PJ5 A;  1ZY8 A;  3RNM A;  1CL0 A;  3URH A;  3LAD A;  1E6E A;  1GER A;  1LQT A;  2JK6 A;  2YG5 A;  4JY2 A;  1HYU A;  3T14 A;  4C3X A;  1CC6 A;  1M1Q A;  2C4C A;  3H4K A;  1H81 A;  1IUU A;  2Z5X A;  3LXD A;  3KA7 A;  5CQF A;  3CNJ A;  1DXL A;  3NYC A;  2BYB A;  2OLO A;  1CF3 A;  5HXI A;  1CJC A;  1TYT A;  1GEU A;  1E1N A;  2XLS A;  3BHF A;  3H8I A;  2BK3 A;  4KPR A;  4LU6 A;  2BC1 A;  4LII A;  1JEH A;  3F8P A;  5KXJ A;  2BRY A;  3VRA A;  2GAH B;  2WU2 A;  3BNG A;  5TR3 A;  1NEK A;  2CZS A;  2XVE A;  4AOX A;  1COY A;  1ZX9 A;  1BGJ A;  1KNP A;  4YTN A;  3AED A;  4IA5 A;  3VRB A;  1FOH A;  4YSY A;  3AEA A;  2WU5 A;  1FCD A;  3LZW A;  3HYV A;  4J31 A;  3GMC A;  3CTY A;  1ZP0 A;  2R45 A;  1PN0 A;  5KOX A;  3L1T A;  1NG3 A;  2GQW A;  4J34 A;  5JCN A;  2FJB A;  3LB8 A;  2VZ2 A;  3SXQ A;  4B69 A;  4K7Z A;  1Y56 A;  3TOR A;  1H7X A;  4D04 A;  1PBE A;  1H82 A;  2GR2 A;  3CGD A;  4L3Y A;  1EL8 A;  1S2Y A;  4UDQ A; 
#chains in the Genus database with same CATH homology
 3ATR A;  4U8P A;  1L0V A;  2H88 A;  1JRX A;  3AD8 B;  1EL9 A;  3LGQ A;  3NHO X;  5EOW A;  5KMQ A;  4Z24 A;  1N1P A;  1GES A;  1H83 A;  3GRT A;  2LFC A;  4C5O A;  5J7X A;  1E39 A;  4OPD A;  3SZW A;  3DK8 A;  3SQP A;  3KD9 A;  3QFB A;  4YT0 A;  4XWR A;  3AE8 A;  2DKH A;  5U1O A;  3BNH A;  3NT6 A;  3DJD A;  2AQJ A;  2B9X A;  4BJZ A;  3OZ2 A;  4YKG A;  2ZZB A;  2BAB A;  4CY6 A;  4K5R A;  4B1B A;  3UKK A;  2R4J A;  3T31 A;  1GTH A;  2BRA A;  4J2W A;  1GET A;  4OCG A;  1IUW A;  1GRT A;  1GOS A;  2XVJ A;  3F8R A;  3ICS A;  1YY5 A;  2GAG B;  3F29 A;  4H2R A;  1Q1W A;  3BNJ A;  2AAQ A;  2VVM A;  4A99 A;  2YLR A;  2Q0K A;  1PBF A;  4H4Y A;  4H50 A;  1H7W A;  1GSN A;  5KMR A;  1TYP A;  2JBV A;  3K7T A;  3LJP A;  4H4X A;  1KFY A;  4JQ9 A;  1KNR A;  4FK1 C;  3V76 A;  1KDG A;  3ISH A;  4WJY A;  2H89 A;  3AXB A;  2OT4 A;  1L9E A;  3QVR A;  1E1M A;  4NTC A;  3SXI A;  3AYL A;  1ZOV A;  1JRY A;  3GSI A;  5ER0 A;  4EIP A;  4O5Q A;  3RHA A;  4DSG A;  3BI4 A;  2BA9 A;  2PHH A;  2F5Z A;  2XLU A;  1REO A;  2R4E A;  1SP3 A;  1JNI A;  2GQF A;  2V3A A;  3M12 A;  3UCL A;  1XHC A;  2CVJ A;  5FS8 A;  3VQR A;  4WX1 A;  3DJJ A;  2YG3 A;  4K5S A;  3UP5 A;  4REK A;  1CJ3 A;  2GR1 A;  1S3B A;  3CGB A;  4XXG A;  5FS9 A;  2BAC A;  3IHG A;  1OAH A;  2YWL A;  3NYF A;  3QJ4 A;  4DSH A;  3D8X A;  4EMI A;  4IV9 A;  4Y4M A;  1V59 A;  1F8W A;  3UBR A;  3S61 A;  3NK1 X;  5KRQ A;  2WES A;  4LA1 A;  2QCU A;  3IC9 A;  4HA6 A;  4NTE A;  5FMH A;  3SM8 A;  2YG7 A;  2WQY A;  4NTD A;  3L1R A;  2X50 A;  1B5Q A;  1F8S A;  3GYX A;  4NWZ A;  3IWA A;  2JAE A;  1GRH A;  3L8K A;  5IQ4 A;  1M6I A;  3K30 A;  2NPX A;  1B4V A;  2YLX A;  4GDP A;  2FBW A;  1VG0 A;  3SY4 A;  4EMJ A;  4UDR A;  5HHF A;  1O95 A;  2GVC A;  2RAB A;  3SFE A;  1PXA A;  3TTB A;  4E0V A;  3BNM A;  2E4G A;  3NIX A;  2VRL A;  3AEC A;  4EIQ A;  4Z2R A;  2XYO A;  1QDB A;  1GRE A;  1QLB A;  4FX9 A;  1DOE A;  1DJN A;  1IUS A;  4ZCC A;  4U8M A;  1MO9 A;  1ZK7 A;  2B9W A;  3IF9 A;  4U8N A;  1PJ6 A;  2CFY A;  3V3N A;  2C64 A;  1JOA A;  3CGE A;  3QSM A;  2I0Z A;  1AOG A;  3UOZ A;  4JN9 A;  1FS7 A;  2XLR A;  3JSK A;  1FEC A;  3R9U A;  5KMS A;  3AE7 A;  1GV4 A;  4Z25 A;  3AD9 B;  2V3B A;  1IUX A;  4CY8 A;  1Y56 B;  1XDI A;  4B65 A;  3COX A;  1MOK A;  3UTF A;  3P4R A;  2BK5 A;  5KVH A;  1Q9I A;  2VQ7 A;  3P4S A;  3QSE A;  3D1I A;  1L9D A;  1TDK A;  4U8K A;  5EBK A;  1PBB A;  4L38 A;  3AYI A;  1TDF A;  2HQM A;  1YQZ A;  3NKS A;  3UKQ A;  1Y0P A;  3SGL A;  2PYX A;  4H2Q A;  1IUV A;  3SZ0 A;  3WE0 A;  1M1P A;  2VR0 A;  2B76 A;  3DME A;  3FMW A;  3LOV A;  2FJA A;  3EAO A;  4H4V A;  4GAP A;  1ZDL A;  1BF3 A;  1E1L A;  4WCT A;  3E1T A;  4H4P A;  1GND A;  2YLS A;  4APN A;  4EQR A;  3PO7 A;  3KPK A;  1CC4 A;  1ONF A;  2ARD A;  3AYJ A;  3CIR A;  1NDA A;  4O5U A;  2RGJ A;  1D7Y A;  4H4T A;  1NAA A;  1NHR A;  2E5V A;  2ZBW A;  3DGH A;  4II2 A;  5CKU A;  1KSU A;  1JRZ A;  2YR4 A;  1B37 A;  2WP6 A;  4II3 A;  4CNK A;  3UKH A;  2B7S A;  1P2H A;  4B63 A;  4EM4 A;  2K3V A;  3AE2 A;  3GYI A;  3OC4 A;  4BJY A;  3P4P A;  1D7L A;  2BCG G;  3ABV A;  1Q1R A;  4HB9 A;  2C67 A;  4EQX A;  4M52 A;  1OJC A;  2YR6 A;  3MMO A;  3C96 A;  1EBD A;  3CND A;  3T0K A;  1DJQ A;  1PBC A;  2XFU A;  3M0O A;  2WDV A;  4K22 A;  2GH5 A;  4YSZ A;  1VRQ B;  3ICT A;  1KSS A;  1EL7 A;  1M1R A;  5J60 A;  3I6D A;  4BK3 A;  1FL2 A;  3GD4 A;  3NLC A;  2YQU A;  3AE3 A;  1GT8 A;  3DJE A;  1VG9 A;  5HY5 A;  4B66 A;  1N4W A;  2XLT A;  2R46 A;  4FK1 A;  2WBA A;  3GDN A;  2IVE A;  1GU6 A;  4H7U A;  4ICY A;  3AEE A;  4U8O A;  2R0C A;  3ZYX A;  1YQ4 A;  2NVK X;  2X8G A;  4GRT A;  3NNE A;  5C2T A;  2QAE A;  4AOS A;  3FO3 A;  5KOW A;  3CPH G;  1CJ4 A;  2BXR A;  2E1M A;  3O0H A;  4X9M A;  3CPJ G;  3AE9 A;  3SZF A;  1W4X A;  3FBS A;  1RYI A;  2YM2 A;  1LJ1 A;  3K7M X;  4TM1 A;  2YLT A;  3I3L A;  5LV9 A;  1UKV G;  4U2L A;  2AR8 A;  1NHQ A;  3G5R A;  3F8D A;  2V60 A;  1LPF A;  2XLP A;  2GR3 A;  2RGO A;  4C74 A;  1GRG A;  1PJ7 A;  4TM0 A;  2C66 A;  1H84 A;  2Q7V A;  1NPX A;  2BS3 A;  3C4A A;  3G5S A;  4NZH A;  4AP3 A;  2B7R A;  1GPE A;  2XFN A;  4YSH A;  3GDP A;  3GM6 A;  2DKI A;  1GRA A;  1N4U A;  2YVJ A;  1ZOY A;  2R0G A;  4NNJ A;  2YM1 A;  3QVP A;  3NH3 X;  3NGC X;  3Q6J A;  1O5W A;  3SCE A;  4GDE A;  3KKJ A;  2RDZ A;  1DOB A;  3SFD A;  1OJ9 A;  3ALJ A;  4Y4L A;  3OWM A;  3AB1 A;  4ECH A;  2C72 A;  1RP0 A;  4TM4 A;  1BVB A;  1F6M A;  4YTP A;  3RP8 A;  5M10 A;  1OJT A;  2XFQ A;  1TDE A;  3AD7 B;  3AEG A;  3C4N A;  3GWF A;  4H4S A;  5EB4 A;  4YWO A;  3CNT A;  2YVF A;  2BS4 A;  2RF7 A;  3EPT A;  4A5L A;  5DBJ A;  3T2K A;  4DNA A;  1IUT A;  4H4R A;  2FJD A;  4U2T A;  5FS6 A;  1ZMC A;  3AE6 A;  3NTD A;  5U25 A;  2X99 A;  2ZO5 A;  1CBO A;  2YR5 A;  3NN6 X;  3PVC A;  3VR8 A;  5C3J A;  1H86 A;  2V61 A;  2XDO A;  1GXF A;  5BVA A;  1O94 A;  2QA2 A;  2XFO A;  3SZC A;  4AT0 A;  4GUV A;  4K2X A;  4NEW A;  2FJE A;  3CNS A;  3UKL A;  3GD3 A;  5KWF A;  3BNU A;  2VVL A;  2GEW A;  3BI5 A;  4L3Z A;  4H4W A;  1XAN A;  1Z6L A;  1LV0 A;  1E7P A;  3UTG A;  1TRB A;  4J56 A;  3SX6 A;  2J3N A;  3D1C A;  4G6H A;  2TMD A;  3KU9 A;  2WOI A;  1VDC A;  2CUL A;  3ALL A;  3CNP A;  4H2N A;  3BNF A;  2BS2 A;  4G6G A;  3DJG X;  2YLZ A;  3ADA B;  4OPG A;  1PDH A;  1GRB A;  2V6O A;  4MJW A;  1FEB A;  2GR0 A;  4EM3 A;  4IVM B;  3T2Z A;  3RP7 A;  2WP9 A;  5BRT A;  3FG2 P;  3BHK A;  3DK4 A;  5JCM A;  1FT5 A;  2WHD A;  3NYE A;  1BWC A;  3P4Q A;  2O9Z A;  1K0L A;  1XPQ A;  2IVD A;  4Z26 A;  4JY3 A;  3QSS A;  1CC2 A;  4H2P A;  1KF6 A;  4N9X A;  5JCK A;  4Z43 A;  3AE1 A;  4OPL A;  4Q5C A;  4Q4U A;  2VOU A;  3PS9 A;  3CGC A;  2XFP A;  4H4U A;  2WDQ A;  2WPE A;  1FT6 A;  2WPC A;  3HYW A;  4U8I A;  4XWZ A;  3RKH A;  4UDP A;  3KPF A;  2BCP A;  4RG4 A;  4C3Y A;  2WET A;  3FPZ A;  3UU9 A;  3NK2 X;  4OVI A;  4UP3 A;  5KVI A;  4Z2T A;  4X4J A;  1LVL A;  4EMW A;  4H4Z A;  3ATQ A;  3RP6 A;  2WDR A;  4Q17 A;  3ITJ A;  2ZZ0 A;  4H4Q A;  1D4D A;  2WOW A;  4NEV A;  2GMH A;  4I58 A;  2A8X A;  2CDU A;  2OAM A;  2YAU A;  2GB0 A;  5EB5 A;  1PXC A;  2C7G A;  4U2S A;  2X8H A;  1VQW A;  3CPI G;  3IHM A;  1TDN A;  4YTM A;  4A6N B;  2TPR A;  4BK2 A;  3B3R A;  1BZL A;  1PHH A;  2X8C A;  4DGK A;  1PS9 A;  4Y4N A;  4X9N A;  4K8D A;  3UP4 A;  4AT2 A;  3K7Q X;  4GF7 A;  3G5Q A;  4ADW A;  2BC0 A;  1B8S A;  4G9K A;  4TM3 A;  3VRD B;  2APG A;  1S2Q A;  4D03 A;  2C3C A;  4A9W A;  4CCQ A;  4G73 A;  4OPC A;  2R0P A;  4USR A;  3EF6 A;  4BK1 A;  3VR9 A;  4JNQ A;  3T2Y A;  1X31 B;  3LZX A;  3LG1 A;  2GF3 A;  1DOC A;  4ZCD A;  1EL5 A;  4CNJ A;  1M64 A;  2VVL G;  1FS9 A;  2V5Z A;  1LTX R;  2VQB A;  4Q0T A;  1YKJ A;  2W0H A;  4OPI A;  2E80 A;  3P9U A;  3HZL A;  2UZZ A;  3H8L A;  1E1K A;  1JNZ A;  3AE4 A;  4IA6 A;  5IQ1 A;  4C77 A;  4P9S A;  3HYX A;  4A6N A;  2JKC A;  4CBQ A;  2WP5 A;  4U8J A;  2WEU A;  1NG4 A;  4OPT A;  4TLZ A;  2XVI A;  4JNA A;  5BUK A;  5JCL A;  2Y6R A;  4J36 A;  5KMP A;  1QJD A;  2YLW A;  1NHP A;  2EQ9 A;  1ZKQ A;  1PXB A;  2RGH A;  3NRN A;  1NEN A;  3EAN A;  4PAA A;  3UKP A;  2EQ7 A;  4B64 A;  1GTE A;  2EQ8 A;  1RSG A;  3AEB A;  3BI2 A;  1N4V A;  3GWD A;  3KLJ A;  2JB2 A;  3B6D A;  4Z44 A;  3UOY A;  4U8L A;  4YXD A;  2Z5Y A;  2J7A A;  2C70 A;  4CRT A;  2QA1 A;  1LQU A;  3GRS A;  1TDO A;  1D5T A;  5FS7 A;  4GR1 A;  1NHS A;  2BK4 A;  3S7W A;  3QFA A;  4OPU A;  5M0Z A;  3SYI A;  4B67 A;  4YSX A;  4GCM A;  2YG6 A;  2XVF A;  1ZMD A;  4RG3 A;  2GMJ A;  2EQ6 A;  4J57 A;  1BKW A;  2YG4 A;  2C3D A;  1ELI A;  3NTA A;  5BUL A;  1CHU A;  4L3X A;  1QO8 A;  2Q0L A;  4JDR A;  3ZDN A;  2OA1 A;  2YVG A;  4A65 A;  3Q9T A;  3KVE A;  4PAB A;  4EQW A;  1OJA A;  2OLN A;  3CMM A;  3UOX A;  3UTH A;  2GRT A;  2ZZC A;  3FIM B;  1K4Q A;  3P1W A;  3DH9 A;  2ACZ A;  3ICR A;  1DOD A;  4Q5B A;  1FS8 A;  5GRT A;  2C76 A;  2C75 A;  4ZN0 A;  3DA1 A;  4BV6 A;  4BUR A;  5L46 A;  3S5W A;  1K0I A;  3CN8 A;  4GAV A;  4YKF A;  3AEF A;  4B68 A;  1D4E A;  3DK9 A;  4A7A A;  3AWI A;  1P2E A;  1OJD A;  3NG7 X;  2C73 A;  4Z2U A;  3AE5 A;  5IPY A;  4J33 A;  1CJ2 A;  1F8R A;  1H6V A;  4IVO B;  2A87 A;  4A79 A;  2WOV A;  1JNR A;  3V3O A;  3GMB A;  4EQS A;  5JCI A;  2Y6Q A;  1BGN A;  5GSN A;  1GAL A;  2GV8 A;  2IID A;  2X3N A;  4FDC B;  3UTE A;  2WS3 A;  4USQ A;  3RED A;  4Q1O A;  3ALM A;  3T37 A;  2JB1 A;  2Q6U A;  3NK0 X;  1K0J A;  4CCR A;  1MXT A;  5KNL A;  3UOV A;  4RSL A;  1IJH A;  1L9C A;  3II4 A;  5U63 A;  4KX6 A;  1S3E A;  2VRM A;  2C65 A;  1PBD A;  1D4C A;  3M13 A;  2B9Y A;  2JB3 A;  2R9Z A;  4I59 A;  5HYM A;  1GRF A;  3UKF A;  2XVH A;  4TLX A;  1SEZ A;  2BXS A;  3NN0 X;  2E81 A;  1JU2 A;  1YQ3 A;  1F3P A;  2WPF A;  4G74 A;  3UKA A;  2A89 A;  2XCG A;  3GYJ A;  1FEA A;  4AP1 A;  1DNC A;  3DGZ A;  2OAL A;  1PJ5 A;  1ZY8 A;  3RNM A;  1CL0 A;  3URH A;  3LAD A;  1E6E A;  1GER A;  1LQT A;  2JK6 A;  2YG5 A;  4JY2 A;  1HYU A;  3T14 A;  4C3X A;  1CC6 A;  1M1Q A;  2C4C A;  3H4K A;  1H81 A;  1IUU A;  2Z5X A;  3LXD A;  3KA7 A;  5CQF A;  3CNJ A;  1DXL A;  3NYC A;  2BYB A;  2OLO A;  1CF3 A;  5HXI A;  1CJC A;  1TYT A;  1GEU A;  1E1N A;  2XLS A;  3BHF A;  3H8I A;  2BK3 A;  4KPR A;  4LU6 A;  2BC1 A;  4LII A;  1JEH A;  3F8P A;  5KXJ A;  2BRY A;  3VRA A;  2GAH B;  2WU2 A;  3BNG A;  5TR3 A;  1NEK A;  2XVE A;  4AOX A;  1COY A;  1ZX9 A;  1BGJ A;  1KNP A;  4YTN A;  3AED A;  4IA5 A;  3VRB A;  1FOH A;  4YSY A;  3AEA A;  2WU5 A;  1FCD A;  3LZW A;  3HYV A;  4J31 A;  3GMC A;  3CTY A;  1ZP0 A;  2R45 A;  1PN0 A;  5KOX A;  3L1T A;  1NG3 A;  2GQW A;  4J34 A;  5JCN A;  2FJB A;  3LB8 A;  2VZ2 A;  3SXQ A;  4B69 A;  4K7Z A;  1Y56 A;  3TOR A;  1H7X A;  4D04 A;  1PBE A;  1H82 A;  2GR2 A;  3CGD A;  4L3Y A;  1EL8 A;  1S2Y A;  4UDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...