2B7RA

Structure of e378d mutant flavocytochrome c3
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTDAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fumarate reductase flavoprotein subunit
publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 191
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7rA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7rA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7rA03
1JOAA 1GREA 3REDA 4CBQA 3HZLA 4CCRA 4JN9A 4Z43A 1QLBA 3K7MX 1PBEA 2RGJA 3H8IA 4JNQA 1YQ4A 2FJAA 1L9EA 3GMBA 3OWMA 2WDQA 4EMWA 2BCGG 4GCMA 1MO9A 1EL7A 3AYJA 3M12A 5CQFA 3CTYA 3UKFA 3C96A 3CNSA 5HY5A 4YTMA 4A7AA 3UKQA 2Q6UA 2B7SA 4EQXA 1FS8A 3UP5A 3QVRA 4LIIA 5JCLA 2WP9A 1GALA 1GTEA 3UTFA 4Z2UA 3D8XA 3VR8A 2YQUA 4TM3A 1FT6A 2JB3A 2CVJA 2WOIA 2XLTA 3S5WA 1PJ5A 3LZWA 3NNEA 2A87A 2GQWA 3CN8A 4B63A 2C65A 3VQRA 1O94A 2Y6RA 4X9NA 2OLNA 2GQFA 3K30A 4GF7A 3AYLA 1PJ7A 4EM4A 1FEBA 1BGJA 2V3AA 3D1CA 5IQ1A 2C70A 2OA1A 1QO8A 1D4DA 3LOVA 4RG4A 4X9MA 3RNMA 1Q9IA 4H4UA 4BJYA 4E0VA 3AXBA 4J34A 1YQ3A 4EMIA 3QSMA 3VR9A 1IUVA 1NG4A 1OJDA 3F8RA 2VVLA 4H4RA 5C2TA 2VVMA 1NEKA 2ZBWA 4IVMB 3UCLA 3BNFA 4KPRA 3SQPA 4H50A 2XLSA 1IUXA 4Z25A 4REKA 2YM2A 2EQ8A 4DSGA 1EBDA 2A8XA 3H4KA 4EMJA 1FS9A 1DXLA 1FOHA 1OJ9A 3GRTA 4GR1A 1PBFA 4H2QA 3G5QA 4NTDA 4BJZA 3DK8A 3FMWA 3KKJA 2ZZBA 1V59A 4DSHA 1H6VA 1H7XA 2R4EA 3QSEA 3NGCX 1N4VA 1X31B 2RDZA 1LJ1A 2WDRA 1E6EA 2YG3A 1N1PA 4U8NA 3BNUA 4M52A 4BK3A 1IUWA 2OT4A 5BVAA 2BXSA 2ZZ0A 3RHAA 3AE7A 3DH9A 3UP4A 1NHQA 3VRAA 2BC1A 2I0ZA 3QFBA 1ZX9A 2X50A 1PBBA 3P4QA 2XLRA 1OAHA 4AP1A 3BHKA 5J60A 2C3CA 3UKPA 2GEWA 3CIRA 1XPQA 2CDUA 1JRZA 1N4UA 2WEUA 1W4XA 3NK1X 1E39A 2BS3A 2E5VA 3P4RA 3AEDA 2E80A 2NVKX 2QA2A 2YLSA 2AR8A 1NPXA 4Y4MA 2R9ZA 3GWDA 2R0CA 3AYIA 3ZDNA 4Q1OA 2GAHB 4Z2TA 2B9YA 2E81A 2B7RA 2GR2A 1D4CA 2V60A 3G5SA 3NTAA 4Q17A 5FMHA 1DJNA 1JRYA 4ADWA 3S7WA 1IUUA 2NPXA 3NH3X 3QFAA 3UBRA 2DKHA 3KD9A 1MOKA 2QA1A 2CFYA 3B6DA 3DJGX 1E7PA 3IWAA 3RP6A 2VRLA 3UKKA 5EOWA 4NZHA 1IUTA 1GESA 1H86A 3E1TA 2ACZA 2HQMA 2RGHA 4B65A 4AOXA 4BV6A 3EF6A 1IUSA 4UDPA 1L9CA 2GB0A 4U8IA 4X4JA 3CNTA 4LU6A 1TDKA 1PJ6A 2YG6A 3BNMA 3NYFA 3DJDA 1CL0A 1LPFA 3L1TA 2R46A 3UKHA 2OALA 3AD9B 2C72A 4JDRA 3ABVA 3NYCA 3AE6A 1SEZA 4H4XA 3MMOA 1VG9A 1KSSA 1S3BA 2VOUA 2JBVA 4GDEA 4NTEA 3CNPA 4OCGA 1NENA 3T37A 1XDIA 4J36A 1UKVG 2FJEA 3ATQA 1KNPA 3G5RA 3V76A 4U2SA 4YKGA 4K2XA 4PAAA 1PBDA 3FBSA 2W0HA 3DJJA 3IC9A 1K4QA 1ZKQA 2X8HA 1VG0A 2JKCA 5U1OA 2XLUA 1M1PA 4OPTA 1M6IA 2C67A 3I3LA 4K5SA 1PDHA 4Z24A 2XDOA 4YSXA 1Y56B 4BURA 3F29A 3TTBA 2R45A 1LV0A 2GV8A 4Q5BA 4HB9A 5C3JA 2XFUA 3GSIA 1TYPA 1KNRA 1D7LA 4GRTA 2YVGA 2X99A 2XFQA 4H4PA 3AE5A 3V3NA 2Z5YA 2FJBA 5KRQA 1H84A 1VRQB 4J57A 4IVOB 4K5RA 3UOZA 2JB1A 4K8DA 1N4WA 2GMHA 5KWFA 1PXCA 1B4VA 4H4YA 1QJDA 3PO7A 4JQ9A 2YG4A 4APNA 1FCDA 1TDFA 4WX1A 3AE9A 3BHFA 2AAQA 2Q7VA 2BCPA 1LTXR 2WOVA 3F8PA 3QSSA 4ICYA 4Z2RA 4NEVA 2IIDA 3BNJA 2C64A 2Z5XA 4AOSA 2WPCA 2GR0A 3AE8A 3Q6JA 3GYXA 4U8JA 1RP0A 1E1NA 3UOXA 4OPGA 1ZK7A 2C3DA 4EQSA 4YSZA 1VQWA 2Q0LA 4CNJA 4A79A 4XWZA 4TLZA 2R0GA 3BI5A 1DOEA 3AD7B 3GD3A 4USQA 4A99A 3NK2X 3H8LA 2V6OA 3F8DA 3SM8A 1NHPA 3AEFA 4B66A 5BRTA 1NHSA 1JNIA 5U63A 3RP7A 2Y6QA 4H4ZA 3BI2A 1JRXA 1GEUA 1PS9A 4ZN0A 2XLPA 2XVHA 4B69A 3ICRA 3GM6A 1TYTA 2YLXA 2WU5A 1KFYA 3AECA 5HYMA 4OPCA 3UTEA 2WU2A 5U25A 5LV9A 3FPZA 4H4SA 3LGQA 2A89A 3CPHG 3NN6X 4J31A 3JSKA 3SXQA 3BNHA 5EB5A 3LXDA 1RYIA 4ZCCA 1BGNA 2WBAA 4MJWA 1COYA 3AEBA 4EIPA 3CGCA 1EL8A 2WHDA 2XVFA 4Z26A 3IF9A 1FS7A 4CNKA 2VQBA 1XHCA 1OJCA 3QJ4A 1CHUA 1IJHA 4J33A 1ZOYA 2WETA 1NAAA 3FG2P 4AT2A 3CGBA 1H81A 2Q0KA 5JCIA 4H4TA 4N9XA 2GRTA 5GRTA 3ITJA 1DODA 3LB8A 4U8PA 4U8LA 2VZ2A 2WP6A 1AOGA 4RG3A 1M64A 1DNCA 2YAUA 4AT0A 2XYOA 3NN0X 1Q1RA 4GUVA 2YVFA 2QCUA 4CY6A 4Q5CA 4FX9A 3O0HA 1DOBA 2BS4A 4YT0A 2AQJA 1K0IA 1K0JA 3GWFA 2EQ9A 1NG3A 2C66A 2YR4A 4C77A 3ALLA 1CBOA 4J2WA 1H83A 1CJCA 2OAMA 4B64A 4OPIA 3DGHA 3NKSA 2YG5A 4UDRA 1GRTA 4YTNA 4H2RA 3OC4A 4EIQA 1YQZA 2H89A 3VRBA 1BKWA 4CY8A 4YSYA 3RKHA 3UKAA 3ADAB 2GF3A 4XWRA 5IPYA 1GTHA 3P4PA 5HHFA 4H4VA 4UDQA 4CRTA 1E1MA 2E4GA 2WPEA 3GMCA 1GRGA 1BF3A 2J3NA 4H2NA 3P1WA 4UP3A 3SFEA 4NTCA 1ZOVA 1F3PA 3FIMB 2BK4A 4C74A 3C4NA 4TLXA 4GDPA 4B68A 5BUKA 5JCMA 3D1IA 2BYBA 3ZYXA 1EL5A 2XFOA 4ECHA 3BI4A 3GRSA 2ZO5A 4YXDA 4I58A 1FL2A 2ZZCA 2J7AA 2R4JA 4C3YA 1CJ3A 1NHRA 1KF6A 2QAEA 4U8KA 4Y4LA 3AE1A 1F6MA 3CGEA 5IQ4A 3UU9A 3AE2A 1P2HA 4CCQA 2EQ6A 1GRBA 1ZP0A 3DA1A 1FECA 2GVCA 3OZ2A 3R9UA 3UOVA 5FS6A 4DNAA 2WPFA 4TM1A 2RABA 4H4QA 5EBKA 1L0VA 1Y0PA 2WQYA 2XCGA 1LQTA 1PXBA 3PVCA 4O5QA 3GDPA 4L3YA 2WOWA 2WS3A 1DOCA 3IHGA 4WJYA 3AD8B 4Q0TA 4H7UA 4WCTA 4AP3A 1SP3A 5KXJA 1E1LA 4L38A 3KU9A 4L3ZA 3VRDB 2BACA 3NT6A 4RSLA 4NEWA 1DJQA 1REOA 3UTHA 3UKLA 1Y56A 1GRHA 1S3EA 4C5OA 4D03A 1OJAA 1BVBA 5JCNA 3BNGA 2FBWA 3COXA 3UTGA 1OJTA 2X8CA 4DGKA 2ARDA 3CGDA 4J56A 2GH5A 1H82A 3GDNA 3KA7A 4YWOA 3NG7X 2XFPA 5BULA 5KVHA 3V3OA 1GETA 3ATRA 1ONFA 1FEAA 2WDVA 2GR3A 1O5WA 2C76A 3DJEA 2WP5A 2GAGB 2C75A 4A9WA 2YLZA 3AE4A 3UOYA 2X3NA 1GXFA 1YY5A 4D04A 1BZLA 3ICSA 4H4WA 5HXIA 2YR5A 3AWIA 4O5UA 2VVLG 3LADA 2X8GA 4U2TA 2C73A 2YLRA 5JCKA 5M10A 4TM4A 3ALMA 1GERA 1NDAA 3DK4A 3KVEA 1CF3A 1CC2A 5FS8A 1RSGA 3LG1A 3QVPA 2C7GA 2H88A 3L8KA 3ISHA 2GR1A 4L3XA 2V5ZA 1Q1WA 3EAOA 5EB4A 1ZMCA 1F8SA 2TMDA 1M1QA 2VQ7A 3GYIA 3GYJA 3II4A 1D5TA 3K7TA 3WE0A 2XVIA 1F8RA 4FDCB 3NK0X 2FJDA 3M13A 2YG7A 1XANA 4A65A 4H2PA 4B1BA 1ZDLA 4U8OA 3CPJG 3PS9A 2JK6A 1GT8A 2E1MA 3Q9TA 1PHHA 2V61A 2YM1A 4IA6A 5M0ZA 3AEAA 3IHMA 3NRNA 2RGOA 1F8WA 3KPFA 5DBJA 3FO3A 3S61A 2B9XA 1M1RA 4YKFA 3KLJA 2PYXA 5TR3A 4EM3A 2BABA 4Q4UA 1H7WA 2WESA 3NTDA 2APGA 1D7YA 1K0LA 2YR6A 2V3BA 4OPLA 3AEEA 1S2YA 1ZY8A 4USRA 4A6NB 4YSHA 4Z44A 2XVJA 1KDGA 4OPDA 4XXGA 5L46A 2UZZA 4A5LA 1GRAA 1JNZA 1TRBA 2CULA 3NIXA 2BC0A 3M0OA 5CKUA 3SFDA 2YWLA 1JEHA 5FS9A 2OLOA 4A6NA 1JU2A 4U2LA 1P2EA 2JAEA 1KSUA 1PN0A 4HA6A 2O9ZA 3LZXA 1TDEA 4K22A 4IV9A 4JY3A 4I59A 1EL9A 2RF7A 2BK3A 2TPRA 2VRMA 3AB1A 3NHOX 4JNAA 3DMEA 3EANA 1GPEA 3C4AA 1B5QA 3LJPA 4BK2A 1BWCA 2BA9A 3URHA 3GD4A 3DGZA 1JNRA 4P9SA 3EPTA 3AEGA 3RP8A 4Y4NA 2DKIA 1ZMDA 1LQUA 4KX6A 3DK9A 3AE3A 3P4SA 4K7ZA 1CC6A 4BK1A 4OPUA 1ELIA 1FT5A 2B76A 2IVDA 4EQRA 1L9DA 3NLCA 3CNJA 5KOWA 1CJ2A 4B67A 1B8SA 4PABA 5KVIA 2VR0A 1YKJA 2LFCA 2EQ7A 1VDCA 2K3VA 3ALJA 4JY2A 4YTPA 1MXTA 4LA1A 3SCEA 1PXAA 3L1RA 2YLTA 1O95A 1TDOA 1QDBA 2GMJA 4C3XA 2PHHA 3ICTA 2BK5A 1TDNA 3CNDA 3P9UA 1E1KA 3NYEA 2R0PA 4U8MA 2YLWA 4EQWA 3CPIG 1LVLA 1GSNA 2BXRA 3B3RA 2B9WA 2IVEA 4TM0A 1GV4A 1CJ4A 1Z6LA 1PBCA 2F5ZA 2BS2A 1D4EA 1GNDA 5J7XA 1GU6A 4FK1C 5KOXA 2YVJA 1CC4A 3SGLA 2XVEA 1S2QA 3I6DA 3TORA 1B37A 5FS7A 5GSNA 4IA5A 2XFNA 5ER0A 1GRFA 4ZCDA 2JB2A 3K7QX 1HYUA 4FK1A 1GOSA 4OVIA
chains in the Genus database with same CATH superfamily
1JOAA 1GREA 3REDA 4CBQA 3HZLA 4CCRA 4JN9A 4Z43A 1QLBA 3K7MX 1PBEA 2RGJA 3H8IA 4JNQA 1YQ4A 2FJAA 1L9EA 3GMBA 3OWMA 2WDQA 4EMWA 2BCGG 4GAPA 4GCMA 1MO9A 1EL7A 3AYJA 3M12A 5CQFA 3CTYA 3UKFA 3C96A 3SZCA 3CNSA 5HY5A 4YTMA 4A7AA 3UKQA 2Q6UA 2B7SA 4EQXA 1FS8A 3UP5A 3QVRA 4LIIA 5JCLA 2WP9A 1GALA 1GTEA 3UTFA 4Z2UA 3D8XA 3VR8A 2YQUA 4TM3A 1FT6A 2JB3A 2CVJA 2WOIA 2XLTA 3S5WA 1PJ5A 3LZWA 3NNEA 2A87A 2GQWA 3CN8A 4B63A 2C65A 3VQRA 1O94A 2Y6RA 4X9NA 3SX6A 2OLNA 2GQFA 3K30A 4GF7A 3AYLA 1PJ7A 4EM4A 1FEBA 1BGJA 2V3AA 3D1CA 5IQ1A 2C70A 2OA1A 5KMSA 1QO8A 1D4DA 3LOVA 4RG4A 4X9MA 3RNMA 1Q9IA 3KPKA 4H4UA 4BJYA 4E0VA 3AXBA 4J34A 1YQ3A 4EMIA 3QSMA 3VR9A 1IUVA 1NG4A 1OJDA 3F8RA 2VVLA 4H4RA 5C2TA 2VVMA 1NEKA 2ZBWA 4IVMB 3UCLA 3BNFA 4KPRA 3SQPA 4H50A 2XLSA 1IUXA 4Z25A 4REKA 2YM2A 2EQ8A 4DSGA 1EBDA 2A8XA 3H4KA 4EMJA 1FS9A 1DXLA 1FOHA 1OJ9A 3GRTA 4GR1A 1PBFA 4H2QA 3SYIA 3G5QA 4NTDA 4BJZA 3DK8A 3FMWA 3KKJA 2ZZBA 1V59A 4DSHA 1H6VA 1H7XA 2R4EA 3QSEA 3NGCX 1N4VA 1X31B 2RDZA 1LJ1A 2WDRA 1E6EA 3T2ZA 2YG3A 1N1PA 5KMPA 4U8NA 3T0KA 3BNUA 4M52A 4BK3A 1IUWA 2OT4A 5BVAA 3SZWA 2BXSA 2ZZ0A 3RHAA 3AE7A 3DH9A 3HYXA 3UP4A 4NNJA 1NHQA 3VRAA 2BC1A 2I0ZA 3QFBA 1ZX9A 2X50A 1PBBA 3P4QA 2XLRA 1OAHA 4II3A 4AP1A 3BHKA 5J60A 2C3CA 3UKPA 2GEWA 3CIRA 1XPQA 2CDUA 1JRZA 1N4UA 2WEUA 1W4XA 3NK1X 1E39A 2BS3A 2E5VA 3P4RA 3AEDA 2E80A 2NVKX 2QA2A 2YLSA 2AR8A 1NPXA 4Y4MA 2R9ZA 3GWDA 2R0CA 3AYIA 3ZDNA 4Q1OA 2GAHB 4Z2TA 2B9YA 2E81A 2B7RA 2GR2A 1D4CA 2V60A 3G5SA 3NTAA 4Q17A 5FMHA 1DJNA 1JRYA 4ADWA 3S7WA 1IUUA 2NPXA 3HYVA 3NH3X 3QFAA 3UBRA 2DKHA 3KD9A 1MOKA 2QA1A 2CFYA 3B6DA 3DJGX 1E7PA 3IWAA 3RP6A 2VRLA 3UKKA 5EOWA 4NZHA 1IUTA 1GESA 1H86A 3E1TA 2ACZA 2HQMA 2RGHA 4B65A 4AOXA 4BV6A 3EF6A 3HYWA 1IUSA 4UDPA 1L9CA 2GB0A 4U8IA 4X4JA 3CNTA 4LU6A 1TDKA 1PJ6A 2YG6A 3BNMA 3NYFA 3DJDA 1CL0A 1LPFA 3L1TA 2R46A 3UKHA 2OALA 3AD9B 2C72A 4JDRA 5KMRA 3ABVA 3NYCA 3AE6A 1SEZA 4H4XA 3MMOA 1VG9A 1KSSA 1S3BA 2VOUA 2JBVA 4GDEA 4NTEA 3CNPA 4OCGA 4G73A 1NENA 3T37A 1XDIA 4J36A 1UKVG 2FJEA 3ATQA 1KNPA 3G5RA 3V76A 4U2SA 4YKGA 4K2XA 4PAAA 1PBDA 3FBSA 2W0HA 3DJJA 3IC9A 1K4QA 1ZKQA 2X8HA 1VG0A 2JKCA 5U1OA 2XLUA 1M1PA 4OPTA 1M6IA 2C67A 3I3LA 4K5SA 1PDHA 4Z24A 2XDOA 3SZFA 4YSXA 1Y56B 4BURA 3F29A 3TTBA 2R45A 1LV0A 2GV8A 3SZ0A 4Q5BA 4HB9A 5C3JA 2XFUA 3GSIA 1TYPA 1KNRA 1D7LA 4GRTA 2YVGA 2X99A 2XFQA 4H4PA 3AE5A 3V3NA 2Z5YA 2FJBA 5KRQA 1H84A 1VRQB 4J57A 4IVOB 4K5RA 3UOZA 2JB1A 4G9KA 4K8DA 1N4WA 2GMHA 5KWFA 1PXCA 1B4VA 4H4YA 1QJDA 3PO7A 4JQ9A 2YG4A 4APNA 1FCDA 1TDFA 4WX1A 3AE9A 3T2KA 3BHFA 2AAQA 2Q7VA 2BCPA 1LTXR 2WOVA 3F8PA 3QSSA 4ICYA 4Z2RA 4NEVA 2IIDA 3BNJA 2C64A 2Z5XA 4AOSA 2WPCA 2GR0A 3AE8A 3GYXA 3Q6JA 4U8JA 1RP0A 1E1NA 3UOXA 4OPGA 1ZK7A 2C3DA 4EQSA 4YSZA 4G74A 1VQWA 2Q0LA 4CNJA 4A79A 4XWZA 4TLZA 2R0GA 3BI5A 1DOEA 3AD7B 3GD3A 4USQA 4A99A 3NK2X 3H8LA 2V6OA 3F8DA 3SM8A 1NHPA 3AEFA 4B66A 5BRTA 1NHSA 1JNIA 5U63A 3RP7A 2Y6QA 4H4ZA 3BI2A 1JRXA 1GEUA 1PS9A 4ZN0A 2XLPA 2XVHA 4B69A 3ICRA 3GM6A 1TYTA 2YLXA 2WU5A 1KFYA 3AECA 5HYMA 4OPCA 3UTEA 2WU2A 5U25A 5LV9A 3FPZA 4H4SA 3LGQA 2A89A 3CPHG 3NN6X 4J31A 3JSKA 3SXQA 3BNHA 5EB5A 3LXDA 1RYIA 4ZCCA 1BGNA 2WBAA 4MJWA 1COYA 3AEBA 4EIPA 3CGCA 1EL8A 2WHDA 2XVFA 4Z26A 3IF9A 1FS7A 4CNKA 2VQBA 3SXIA 1XHCA 1OJCA 3QJ4A 3T14A 1CHUA 1IJHA 4J33A 1ZOYA 2BRYA 2WETA 1NAAA 3FG2P 4AT2A 3CGBA 1H81A 2Q0KA 5JCIA 4H4TA 4N9XA 2GRTA 5GRTA 3ITJA 1DODA 3LB8A 4U8PA 4U8LA 2VZ2A 2WP6A 1AOGA 4RG3A 1M64A 1DNCA 2YAUA 4AT0A 2XYOA 3NN0X 1Q1RA 4GUVA 2YVFA 2QCUA 4CY6A 4Q5CA 4FX9A 3O0HA 1DOBA 2BS4A 4YT0A 2AQJA 5KMQA 1K0IA 1K0JA 3GWFA 2EQ9A 1NG3A 2C66A 2YR4A 4C77A 3ALLA 1CBOA 4J2WA 1H83A 1CJCA 2OAMA 4B64A 4OPIA 3DGHA 3NKSA 2YG5A 4UDRA 1GRTA 4YTNA 4H2RA 3OC4A 4EIQA 1YQZA 2H89A 3VRBA 1BKWA 4CY8A 4YSYA 3RKHA 3UKAA 3ADAB 2GF3A 4XWRA 5IPYA 1GTHA 3P4PA 5HHFA 4H4VA 4UDQA 4CRTA 2CZSA 1E1MA 2E4GA 2WPEA 3GMCA 1GRGA 1BF3A 2J3NA 4H2NA 3P1WA 4UP3A 3SFEA 4NTCA 1ZOVA 1F3PA 3FIMB 2BK4A 4C74A 3C4NA 4TLXA 4GDPA 4B68A 5BUKA 5JCMA 3D1IA 2BYBA 3ZYXA 1EL5A 2XFOA 4ECHA 3BI4A 3GRSA 2ZO5A 4YXDA 4I58A 1FL2A 2ZZCA 2J7AA 2R4JA 4C3YA 1CJ3A 1NHRA 1KF6A 2QAEA 4U8KA 4Y4LA 3AE1A 1F6MA 3CGEA 5IQ4A 3UU9A 3AE2A 1P2HA 3SY4A 2EQ6A 4CCQA 1GRBA 1ZP0A 3DA1A 1FECA 2GVCA 3OZ2A 3R9UA 3UOVA 5FS6A 4DNAA 2WPFA 4TM1A 2RABA 4H4QA 5EBKA 1L0VA 1Y0PA 2WQYA 2XCGA 1LQTA 1PXBA 3PVCA 4O5QA 3GDPA 4L3YA 4GAVA 2WOWA 2WS3A 1DOCA 3IHGA 4WJYA 3AD8B 4Q0TA 4H7UA 4WCTA 4AP3A 1SP3A 5KXJA 1E1LA 4L38A 3KU9A 4L3ZA 3VRDB 2BACA 3NT6A 4RSLA 4NEWA 1DJQA 1REOA 3UTHA 3UKLA 1Y56A 1GRHA 1S3EA 4C5OA 4D03A 1OJAA 1BVBA 5JCNA 3BNGA 2FBWA 3COXA 4NWZA 3UTGA 1OJTA 2X8CA 4DGKA 2ARDA 3CGDA 4J56A 2GH5A 1H82A 3GDNA 3KA7A 4YWOA 3NG7X 2XFPA 5BULA 5KVHA 3V3OA 1GETA 3ATRA 1ONFA 1FEAA 2WDVA 2GR3A 1O5WA 2C76A 3DJEA 2WP5A 2GAGB 2C75A 4A9WA 2YLZA 3AE4A 3UOYA 2X3NA 1GXFA 1YY5A 4D04A 1BZLA 3ICSA 4H4WA 5HXIA 2YR5A 3AWIA 4O5UA 2VVLG 3LADA 2X8GA 4U2TA 2C73A 2YLRA 5JCKA 5M10A 4TM4A 3CMMA 3ALMA 1GERA 1NDAA 3DK4A 3KVEA 1CF3A 1CC2A 5FS8A 1RSGA 3LG1A 3QVPA 2C7GA 2H88A 3L8KA 3ISHA 2GR1A 4L3XA 2V5ZA 1Q1WA 3EAOA 5EB4A 1ZMCA 1F8SA 2TMDA 1M1QA 2VQ7A 3GYIA 3GYJA 3II4A 1D5TA 3K7TA 3WE0A 2XVIA 1F8RA 4FDCB 3NK0X 2FJDA 3M13A 2YG7A 1XANA 3T31A 4A65A 4H2PA 4B1BA 1ZDLA 2BRAA 3CPJG 3PS9A 4U8OA 2JK6A 1GT8A 2E1MA 3Q9TA 1PHHA 2V61A 2YM1A 4II2A 4IA6A 5M0ZA 3AEAA 3IHMA 3NRNA 2RGOA 1F8WA 3KPFA 5DBJA 3FO3A 3S61A 2B9XA 1M1RA 4YKFA 3KLJA 2PYXA 5TR3A 4EM3A 2BABA 4Q4UA 1H7WA 2WESA 3NTDA 2APGA 1D7YA 1K0LA 2YR6A 2V3BA 4OPLA 3AEEA 1S2YA 1ZY8A 4USRA 4A6NB 4YSHA 4Z44A 2XVJA 1KDGA 4OPDA 4XXGA 5L46A 2UZZA 4A5LA 1GRAA 1JNZA 1TRBA 2CULA 3NIXA 2BC0A 3M0OA 5CKUA 3SFDA 2YWLA 1JEHA 5FS9A 2OLOA 4A6NA 1JU2A 4U2LA 1P2EA 2JAEA 1KSUA 1PN0A 4HA6A 2O9ZA 3LZXA 1TDEA 4K22A 4IV9A 4JY3A 4I59A 1EL9A 2RF7A 2BK3A 2TPRA 2VRMA 3AB1A 3NHOX 4JNAA 3DMEA 3EANA 5KNLA 1GPEA 3C4AA 1B5QA 3LJPA 4BK2A 1BWCA 2BA9A 3URHA 3GD4A 3DGZA 1JNRA 4P9SA 3EPTA 3AEGA 4G6HA 3RP8A 4Y4NA 2DKIA 1ZMDA 1LQUA 4KX6A 3DK9A 3AE3A 3P4SA 4G6GA 1CC6A 4K7ZA 4OPUA 4BK1A 1ELIA 1FT5A 2B76A 2IVDA 4EQRA 1L9DA 3NLCA 3CNJA 5KOWA 1CJ2A 4B67A 1B8SA 4PABA 5KVIA 2VR0A 1YKJA 2LFCA 2EQ7A 1VDCA 2K3VA 3ALJA 4JY2A 4YTPA 1MXTA 4LA1A 3SCEA 1PXAA 3L1RA 2YLTA 1O95A 1TDOA 1QDBA 2GMJA 4C3XA 2PHHA 3ICTA 2BK5A 1TDNA 3CNDA 3P9UA 1E1KA 3NYEA 2R0PA 4U8MA 2YLWA 4EQWA 3CPIG 1LVLA 1GSNA 2BXRA 3B3RA 2B9WA 2IVEA 4TM0A 1GV4A 1CJ4A 1Z6LA 1PBCA 2F5ZA 2BS2A 1D4EA 1GNDA 2C4CA 5J7XA 1GU6A 4FK1C 5KOXA 2YVJA 3T2YA 1CC4A 3SGLA 2XVEA 1S2QA 3I6DA 3TORA 1B37A 5FS7A 5GSNA 4IA5A 2XFNA 5ER0A 1GRFA 4ZCDA 2JB2A 3K7QX 1HYUA 4FK1A 1GOSA 4OVIA
chains in the Genus database with same CATH topology
1JOAA 1GREA 3REDA 4CBQA 3HZLA 4CCRA 4JN9A 4Z43A 1QLBA 3K7MX 1PBEA 2RGJA 3H8IA 4JNQA 1YQ4A 2FJAA 1L9EA 3GMBA 3OWMA 2WDQA 4EMWA 2BCGG 4GAPA 4GCMA 1MO9A 1EL7A 3AYJA 3M12A 5CQFA 3CTYA 3UKFA 3C96A 3SZCA 3CNSA 5HY5A 4YTMA 4A7AA 3UKQA 2Q6UA 2B7SA 4EQXA 1FS8A 3UP5A 3QVRA 4LIIA 5JCLA 2WP9A 1GALA 1GTEA 3UTFA 4Z2UA 3D8XA 3VR8A 2YQUA 4TM3A 1FT6A 2JB3A 2CVJA 2WOIA 2XLTA 3S5WA 1PJ5A 3LZWA 3NNEA 2A87A 2GQWA 3CN8A 4B63A 2C65A 3VQRA 1O94A 2Y6RA 4X9NA 3SX6A 2OLNA 2GQFA 3K30A 4GF7A 3AYLA 1PJ7A 4EM4A 1FEBA 1BGJA 2V3AA 3D1CA 5IQ1A 2C70A 2OA1A 5KMSA 1QO8A 1D4DA 3LOVA 4RG4A 4X9MA 3RNMA 1Q9IA 3KPKA 4H4UA 4BJYA 4E0VA 3AXBA 4J34A 1YQ3A 4EMIA 3QSMA 3VR9A 1IUVA 1NG4A 1OJDA 3F8RA 2VVLA 4H4RA 5C2TA 2VVMA 1NEKA 2ZBWA 4IVMB 3UCLA 3BNFA 4KPRA 3SQPA 4H50A 2XLSA 1IUXA 4Z25A 4REKA 2YM2A 2EQ8A 4DSGA 1EBDA 2A8XA 3H4KA 4EMJA 1FS9A 1DXLA 1FOHA 1OJ9A 3GRTA 4GR1A 1PBFA 4H2QA 3SYIA 3G5QA 4NTDA 4BJZA 3DK8A 3FMWA 3KKJA 2ZZBA 1V59A 4DSHA 1H6VA 1H7XA 2R4EA 3QSEA 3NGCX 1N4VA 1X31B 2RDZA 1LJ1A 2WDRA 1E6EA 3T2ZA 2YG3A 1N1PA 5KMPA 4U8NA 3T0KA 3BNUA 4M52A 4BK3A 1IUWA 2OT4A 5BVAA 3SZWA 2BXSA 2ZZ0A 3RHAA 3AE7A 3DH9A 3HYXA 3UP4A 4NNJA 1NHQA 3VRAA 2BC1A 2I0ZA 3QFBA 1ZX9A 2X50A 1PBBA 3P4QA 2XLRA 1OAHA 4II3A 4AP1A 3BHKA 5J60A 2C3CA 3UKPA 2GEWA 3CIRA 1XPQA 2CDUA 1JRZA 1N4UA 2WEUA 1W4XA 3NK1X 1E39A 2BS3A 2E5VA 3P4RA 3AEDA 2E80A 2NVKX 2QA2A 2YLSA 2AR8A 1NPXA 4Y4MA 2R9ZA 3GWDA 2R0CA 3AYIA 3ZDNA 4Q1OA 2GAHB 4Z2TA 2B9YA 2E81A 2B7RA 2GR2A 1D4CA 2V60A 3G5SA 3NTAA 4Q17A 5FMHA 1DJNA 1JRYA 4ADWA 3S7WA 1IUUA 2NPXA 3HYVA 3NH3X 3QFAA 3UBRA 2DKHA 3KD9A 1MOKA 2QA1A 2CFYA 3B6DA 3DJGX 1E7PA 3IWAA 3RP6A 2VRLA 3UKKA 5EOWA 4NZHA 1IUTA 1GESA 1H86A 3E1TA 2ACZA 2HQMA 2RGHA 4B65A 4AOXA 4BV6A 3EF6A 3HYWA 1IUSA 4UDPA 1L9CA 2GB0A 4U8IA 4X4JA 3CNTA 4LU6A 1TDKA 1PJ6A 2YG6A 3BNMA 3NYFA 3DJDA 1CL0A 1LPFA 3L1TA 2R46A 3UKHA 2OALA 3AD9B 2C72A 4JDRA 5KMRA 3ABVA 3NYCA 3AE6A 1SEZA 4H4XA 3MMOA 1VG9A 1KSSA 1S3BA 2VOUA 2JBVA 4GDEA 4NTEA 3CNPA 4OCGA 4G73A 1NENA 3T37A 1XDIA 4J36A 1UKVG 2FJEA 3ATQA 1KNPA 3G5RA 3V76A 4U2SA 4YKGA 4K2XA 4PAAA 1PBDA 3FBSA 2W0HA 3DJJA 3IC9A 1K4QA 1ZKQA 2X8HA 1VG0A 2JKCA 5U1OA 2XLUA 1M1PA 4OPTA 1M6IA 2C67A 3I3LA 4K5SA 1PDHA 4Z24A 2XDOA 3SZFA 4YSXA 1Y56B 4BURA 3F29A 3TTBA 2R45A 1LV0A 2GV8A 3SZ0A 4Q5BA 4HB9A 5C3JA 2XFUA 3GSIA 1TYPA 1KNRA 1D7LA 4GRTA 2YVGA 2X99A 2XFQA 4H4PA 3AE5A 3V3NA 2Z5YA 2FJBA 5KRQA 1H84A 1VRQB 4J57A 4IVOB 4K5RA 3UOZA 2JB1A 4G9KA 4K8DA 1N4WA 2GMHA 5KWFA 1PXCA 1B4VA 4H4YA 1QJDA 3PO7A 4JQ9A 2YG4A 4APNA 1FCDA 1TDFA 4WX1A 3AE9A 3T2KA 3BHFA 2AAQA 2Q7VA 2BCPA 1LTXR 2WOVA 3F8PA 3QSSA 4ICYA 4Z2RA 4NEVA 2IIDA 3BNJA 2C64A 2Z5XA 4AOSA 2WPCA 2GR0A 3AE8A 3GYXA 3Q6JA 4U8JA 1RP0A 1E1NA 3UOXA 4OPGA 1ZK7A 2C3DA 4EQSA 4YSZA 4G74A 1VQWA 2Q0LA 4CNJA 4A79A 4XWZA 4TLZA 2R0GA 3BI5A 1DOEA 3AD7B 3GD3A 4USQA 4A99A 3NK2X 3H8LA 2V6OA 3F8DA 3SM8A 1NHPA 3AEFA 4B66A 5BRTA 1NHSA 1JNIA 5U63A 3RP7A 2Y6QA 4H4ZA 3BI2A 1JRXA 1GEUA 1PS9A 4ZN0A 2XLPA 2XVHA 4B69A 3ICRA 3GM6A 1TYTA 2YLXA 2WU5A 1KFYA 3AECA 5HYMA 4OPCA 3UTEA 2WU2A 5U25A 5LV9A 3FPZA 4H4SA 3LGQA 2A89A 3CPHG 3NN6X 4J31A 3JSKA 3SXQA 3BNHA 5EB5A 3LXDA 1RYIA 4ZCCA 1BGNA 2WBAA 4MJWA 1COYA 3AEBA 4EIPA 3CGCA 1EL8A 2WHDA 2XVFA 4Z26A 3IF9A 1FS7A 4CNKA 2VQBA 3SXIA 1XHCA 1OJCA 3QJ4A 3T14A 1CHUA 1IJHA 4J33A 1ZOYA 2BRYA 2WETA 1NAAA 3FG2P 4AT2A 3CGBA 1H81A 2Q0KA 5JCIA 4H4TA 4N9XA 2GRTA 5GRTA 3ITJA 1DODA 3LB8A 4U8PA 4U8LA 2VZ2A 2WP6A 1AOGA 4RG3A 1M64A 1DNCA 2YAUA 4AT0A 2XYOA 3NN0X 1Q1RA 4GUVA 2YVFA 2QCUA 4CY6A 4Q5CA 4FX9A 3O0HA 1DOBA 2BS4A 4YT0A 2AQJA 5KMQA 1K0IA 1K0JA 3GWFA 2EQ9A 1NG3A 2C66A 2YR4A 4C77A 3ALLA 1CBOA 4J2WA 1H83A 1CJCA 2OAMA 4B64A 4OPIA 3DGHA 3NKSA 2YG5A 4UDRA 1GRTA 4YTNA 4H2RA 3OC4A 4EIQA 1YQZA 2H89A 3VRBA 1BKWA 4CY8A 4YSYA 3RKHA 3UKAA 3ADAB 2GF3A 4XWRA 5IPYA 1GTHA 3P4PA 5HHFA 4H4VA 4UDQA 4CRTA 1E1MA 2E4GA 2WPEA 3GMCA 1GRGA 1BF3A 2J3NA 4H2NA 3P1WA 4UP3A 3SFEA 4NTCA 1ZOVA 1F3PA 3FIMB 2BK4A 4C74A 3C4NA 4TLXA 4GDPA 4B68A 5BUKA 5JCMA 3D1IA 2BYBA 3ZYXA 1EL5A 2XFOA 4ECHA 3BI4A 3GRSA 2ZO5A 4YXDA 4I58A 1FL2A 2ZZCA 2J7AA 2R4JA 4C3YA 1CJ3A 1NHRA 1KF6A 2QAEA 4U8KA 4Y4LA 3AE1A 1F6MA 3CGEA 5IQ4A 3UU9A 3AE2A 1P2HA 3SY4A 2EQ6A 4CCQA 1GRBA 1ZP0A 3DA1A 1FECA 2GVCA 3OZ2A 3R9UA 3UOVA 5FS6A 4DNAA 2WPFA 4TM1A 2RABA 4H4QA 5EBKA 1L0VA 1Y0PA 2WQYA 2XCGA 1LQTA 1PXBA 3PVCA 4O5QA 3GDPA 4L3YA 4GAVA 2WOWA 2WS3A 1DOCA 3IHGA 4WJYA 3AD8B 4Q0TA 4H7UA 4WCTA 4AP3A 1SP3A 5KXJA 1E1LA 4L38A 3KU9A 4L3ZA 3VRDB 2BACA 3NT6A 4RSLA 4NEWA 1DJQA 1REOA 3UTHA 3UKLA 1Y56A 1GRHA 1S3EA 4C5OA 4D03A 1OJAA 1BVBA 5JCNA 3BNGA 2FBWA 3COXA 4NWZA 3UTGA 1OJTA 2X8CA 4DGKA 2ARDA 3CGDA 4J56A 2GH5A 1H82A 3GDNA 3KA7A 4YWOA 3NG7X 2XFPA 5BULA 5KVHA 3V3OA 1GETA 3ATRA 1ONFA 1FEAA 2WDVA 2GR3A 1O5WA 2C76A 3DJEA 2WP5A 2GAGB 2C75A 4A9WA 2YLZA 3AE4A 3UOYA 2X3NA 1GXFA 1YY5A 4D04A 1BZLA 3ICSA 4H4WA 5HXIA 2YR5A 3AWIA 4O5UA 2VVLG 3LADA 2X8GA 4U2TA 2C73A 2YLRA 5JCKA 5M10A 4TM4A 3CMMA 3ALMA 1GERA 1NDAA 3DK4A 3KVEA 1CF3A 1CC2A 5FS8A 1RSGA 3LG1A 3QVPA 2C7GA 2H88A 3L8KA 3ISHA 2GR1A 4L3XA 2V5ZA 1Q1WA 3EAOA 5EB4A 1ZMCA 1F8SA 2TMDA 1M1QA 2VQ7A 3GYIA 3GYJA 3II4A 1D5TA 3K7TA 3WE0A 2XVIA 1F8RA 4FDCB 3NK0X 2FJDA 3M13A 2YG7A 1XANA 3T31A 4A65A 4H2PA 4B1BA 1ZDLA 2BRAA 3CPJG 3PS9A 4U8OA 2JK6A 1GT8A 2E1MA 3Q9TA 1PHHA 2V61A 2YM1A 4II2A 4IA6A 5M0ZA 3AEAA 3IHMA 3NRNA 2RGOA 1F8WA 3KPFA 5DBJA 3FO3A 3S61A 2B9XA 1M1RA 4YKFA 3KLJA 2PYXA 5TR3A 4EM3A 2BABA 4Q4UA 1H7WA 2WESA 3NTDA 2APGA 1D7YA 1K0LA 2YR6A 2V3BA 4OPLA 3AEEA 1S2YA 1ZY8A 4USRA 4A6NB 4YSHA 4Z44A 2XVJA 1KDGA 4OPDA 4XXGA 5L46A 2UZZA 4A5LA 1GRAA 1JNZA 1TRBA 2CULA 3NIXA 2BC0A 3M0OA 5CKUA 3SFDA 2YWLA 1JEHA 5FS9A 2OLOA 4A6NA 1JU2A 4U2LA 1P2EA 2JAEA 1KSUA 1PN0A 4HA6A 2O9ZA 3LZXA 1TDEA 4K22A 4IV9A 4JY3A 4I59A 1EL9A 2RF7A 2BK3A 2TPRA 2VRMA 3AB1A 3NHOX 4JNAA 3DMEA 3EANA 5KNLA 1GPEA 3C4AA 1B5QA 3LJPA 4BK2A 1BWCA 2BA9A 3URHA 3GD4A 3DGZA 1JNRA 4P9SA 3EPTA 3AEGA 4G6HA 3RP8A 4Y4NA 2DKIA 1ZMDA 1LQUA 4KX6A 3DK9A 3AE3A 3P4SA 4G6GA 1CC6A 4K7ZA 4OPUA 4BK1A 1ELIA 1FT5A 2B76A 2IVDA 4EQRA 1L9DA 3NLCA 3CNJA 5KOWA 1CJ2A 4B67A 1B8SA 4PABA 5KVIA 2VR0A 1YKJA 2LFCA 2EQ7A 1VDCA 2K3VA 3ALJA 4JY2A 4YTPA 1MXTA 4LA1A 3SCEA 1PXAA 3L1RA 2YLTA 1O95A 1TDOA 1QDBA 2GMJA 4C3XA 2PHHA 3ICTA 2BK5A 1TDNA 3CNDA 3P9UA 1E1KA 3NYEA 2R0PA 4U8MA 2YLWA 4EQWA 3CPIG 1LVLA 1GSNA 2BXRA 3B3RA 2B9WA 2IVEA 4TM0A 1GV4A 1CJ4A 1Z6LA 1PBCA 2F5ZA 2BS2A 1D4EA 1GNDA 2C4CA 5J7XA 1GU6A 4FK1C 5KOXA 2YVJA 3T2YA 1CC4A 3SGLA 2XVEA 1S2QA 3I6DA 3TORA 1B37A 5FS7A 5GSNA 4IA5A 2XFNA 5ER0A 1GRFA 4ZCDA 2JB2A 3K7QX 1HYUA 4FK1A 1GOSA 4OVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOA A;  1GRE A;  3RED A;  4CBQ A;  3HZL A;  4CCR A;  4JN9 A;  4Z43 A;  1QLB A;  3K7M X;  1PBE A;  2RGJ A;  3H8I A;  4JNQ A;  1YQ4 A;  2FJA A;  1L9E A;  3GMB A;  3OWM A;  2WDQ A;  4EMW A;  2BCG G;  4GCM A;  1MO9 A;  1EL7 A;  3AYJ A;  3M12 A;  5CQF A;  3CTY A;  3UKF A;  3C96 A;  3CNS A;  5HY5 A;  4YTM A;  4A7A A;  3UKQ A;  2Q6U A;  2B7S A;  4EQX A;  1FS8 A;  3UP5 A;  3QVR A;  4LII A;  5JCL A;  2WP9 A;  1GAL A;  1GTE A;  3UTF A;  4Z2U A;  3D8X A;  3VR8 A;  2YQU A;  4TM3 A;  1FT6 A;  2JB3 A;  2CVJ A;  2WOI A;  2XLT A;  3S5W A;  1PJ5 A;  3LZW A;  3NNE A;  2A87 A;  2GQW A;  3CN8 A;  4B63 A;  2C65 A;  3VQR A;  1O94 A;  2Y6R A;  4X9N A;  2OLN A;  2GQF A;  3K30 A;  4GF7 A;  3AYL A;  1PJ7 A;  4EM4 A;  1FEB A;  1BGJ A;  2V3A A;  3D1C A;  5IQ1 A;  2C70 A;  2OA1 A;  1QO8 A;  1D4D A;  3LOV A;  4RG4 A;  4X9M A;  3RNM A;  1Q9I A;  4H4U A;  4BJY A;  4E0V A;  3AXB A;  4J34 A;  1YQ3 A;  4EMI A;  3QSM A;  3VR9 A;  1IUV A;  1NG4 A;  1OJD A;  3F8R A;  2VVL A;  4H4R A;  5C2T A;  2VVM A;  1NEK A;  2ZBW A;  4IVM B;  3UCL A;  3BNF A;  4KPR A;  3SQP A;  4H50 A;  2XLS A;  1IUX A;  4Z25 A;  4REK A;  2YM2 A;  2EQ8 A;  4DSG A;  1EBD A;  2A8X A;  3H4K A;  4EMJ A;  1FS9 A;  1DXL A;  1FOH A;  1OJ9 A;  3GRT A;  4GR1 A;  1PBF A;  4H2Q A;  3G5Q A;  4NTD A;  4BJZ A;  3DK8 A;  3FMW A;  3KKJ A;  2ZZB A;  1V59 A;  4DSH A;  1H6V A;  1H7X A;  2R4E A;  3QSE A;  3NGC X;  1N4V A;  1X31 B;  2RDZ A;  1LJ1 A;  2WDR A;  1E6E A;  2YG3 A;  1N1P A;  4U8N A;  3BNU A;  4M52 A;  4BK3 A;  1IUW A;  2OT4 A;  5BVA A;  2BXS A;  2ZZ0 A;  3RHA A;  3AE7 A;  3DH9 A;  3UP4 A;  1NHQ A;  3VRA A;  2BC1 A;  2I0Z A;  3QFB A;  1ZX9 A;  2X50 A;  1PBB A;  3P4Q A;  2XLR A;  1OAH A;  4AP1 A;  3BHK A;  5J60 A;  2C3C A;  3UKP A;  2GEW A;  3CIR A;  1XPQ A;  2CDU A;  1JRZ A;  1N4U A;  2WEU A;  1W4X A;  3NK1 X;  1E39 A;  2BS3 A;  2E5V A;  3P4R A;  3AED A;  2E80 A;  2NVK X;  2QA2 A;  2YLS A;  2AR8 A;  1NPX A;  4Y4M A;  2R9Z A;  3GWD A;  2R0C A;  3AYI A;  3ZDN A;  4Q1O A;  2GAH B;  4Z2T A;  2B9Y A;  2E81 A;  2B7R A;  2GR2 A;  1D4C A;  2V60 A;  3G5S A;  3NTA A;  4Q17 A;  5FMH A;  1DJN A;  1JRY A;  4ADW A;  3S7W A;  1IUU A;  2NPX A;  3NH3 X;  3QFA A;  3UBR A;  2DKH A;  3KD9 A;  1MOK A;  2QA1 A;  2CFY A;  3B6D A;  3DJG X;  1E7P A;  3IWA A;  3RP6 A;  2VRL A;  3UKK A;  5EOW A;  4NZH A;  1IUT A;  1GES A;  1H86 A;  3E1T A;  2ACZ A;  2HQM A;  2RGH A;  4B65 A;  4AOX A;  4BV6 A;  3EF6 A;  1IUS A;  4UDP A;  1L9C A;  2GB0 A;  4U8I A;  4X4J A;  3CNT A;  4LU6 A;  1TDK A;  1PJ6 A;  2YG6 A;  3BNM A;  3NYF A;  3DJD A;  1CL0 A;  1LPF A;  3L1T A;  2R46 A;  3UKH A;  2OAL A;  3AD9 B;  2C72 A;  4JDR A;  3ABV A;  3NYC A;  3AE6 A;  1SEZ A;  4H4X A;  3MMO A;  1VG9 A;  1KSS A;  1S3B A;  2VOU A;  2JBV A;  4GDE A;  4NTE A;  3CNP A;  4OCG A;  1NEN A;  3T37 A;  1XDI A;  4J36 A;  1UKV G;  2FJE A;  3ATQ A;  1KNP A;  3G5R A;  3V76 A;  4U2S A;  4YKG A;  4K2X A;  4PAA A;  1PBD A;  3FBS A;  2W0H A;  3DJJ A;  3IC9 A;  1K4Q A;  1ZKQ A;  2X8H A;  1VG0 A;  2JKC A;  5U1O A;  2XLU A;  1M1P A;  4OPT A;  1M6I A;  2C67 A;  3I3L A;  4K5S A;  1PDH A;  4Z24 A;  2XDO A;  4YSX A;  1Y56 B;  4BUR A;  3F29 A;  3TTB A;  2R45 A;  1LV0 A;  2GV8 A;  4Q5B A;  4HB9 A;  5C3J A;  2XFU A;  3GSI A;  1TYP A;  1KNR A;  1D7L A;  4GRT A;  2YVG A;  2X99 A;  2XFQ A;  4H4P A;  3AE5 A;  3V3N A;  2Z5Y A;  2FJB A;  5KRQ A;  1H84 A;  1VRQ B;  4J57 A;  4IVO B;  4K5R A;  3UOZ A;  2JB1 A;  4K8D A;  1N4W A;  2GMH A;  5KWF A;  1PXC A;  1B4V A;  4H4Y A;  1QJD A;  3PO7 A;  4JQ9 A;  2YG4 A;  4APN A;  1FCD A;  1TDF A;  4WX1 A;  3AE9 A;  3BHF A;  2AAQ A;  2Q7V A;  2BCP A;  1LTX R;  2WOV A;  3F8P A;  3QSS A;  4ICY A;  4Z2R A;  4NEV A;  2IID A;  3BNJ A;  2C64 A;  2Z5X A;  4AOS A;  2WPC A;  2GR0 A;  3AE8 A;  3Q6J A;  3GYX A;  4U8J A;  1RP0 A;  1E1N A;  3UOX A;  4OPG A;  1ZK7 A;  2C3D A;  4EQS A;  4YSZ A;  1VQW A;  2Q0L A;  4CNJ A;  4A79 A;  4XWZ A;  4TLZ A;  2R0G A;  3BI5 A;  1DOE A;  3AD7 B;  3GD3 A;  4USQ A;  4A99 A;  3NK2 X;  3H8L A;  2V6O A;  3F8D A;  3SM8 A;  1NHP A;  3AEF A;  4B66 A;  5BRT A;  1NHS A;  1JNI A;  5U63 A;  3RP7 A;  2Y6Q A;  4H4Z A;  3BI2 A;  1JRX A;  1GEU A;  1PS9 A;  4ZN0 A;  2XLP A;  2XVH A;  4B69 A;  3ICR A;  3GM6 A;  1TYT A;  2YLX A;  2WU5 A;  1KFY A;  3AEC A;  5HYM A;  4OPC A;  3UTE A;  2WU2 A;  5U25 A;  5LV9 A;  3FPZ A;  4H4S A;  3LGQ A;  2A89 A;  3CPH G;  3NN6 X;  4J31 A;  3JSK A;  3SXQ A;  3BNH A;  5EB5 A;  3LXD A;  1RYI A;  4ZCC A;  1BGN A;  2WBA A;  4MJW A;  1COY A;  3AEB A;  4EIP A;  3CGC A;  1EL8 A;  2WHD A;  2XVF A;  4Z26 A;  3IF9 A;  1FS7 A;  4CNK A;  2VQB A;  1XHC A;  1OJC A;  3QJ4 A;  1CHU A;  1IJH A;  4J33 A;  1ZOY A;  2WET A;  1NAA A;  3FG2 P;  4AT2 A;  3CGB A;  1H81 A;  2Q0K A;  5JCI A;  4H4T A;  4N9X A;  2GRT A;  5GRT A;  3ITJ A;  1DOD A;  3LB8 A;  4U8P A;  4U8L A;  2VZ2 A;  2WP6 A;  1AOG A;  4RG3 A;  1M64 A;  1DNC A;  2YAU A;  4AT0 A;  2XYO A;  3NN0 X;  1Q1R A;  4GUV A;  2YVF A;  2QCU A;  4CY6 A;  4Q5C A;  4FX9 A;  3O0H A;  1DOB A;  2BS4 A;  4YT0 A;  2AQJ A;  1K0I A;  1K0J A;  3GWF A;  2EQ9 A;  1NG3 A;  2C66 A;  2YR4 A;  4C77 A;  3ALL A;  1CBO A;  4J2W A;  1H83 A;  1CJC A;  2OAM A;  4B64 A;  4OPI A;  3DGH A;  3NKS A;  2YG5 A;  4UDR A;  1GRT A;  4YTN A;  4H2R A;  3OC4 A;  4EIQ A;  1YQZ A;  2H89 A;  3VRB A;  1BKW A;  4CY8 A;  4YSY A;  3RKH A;  3UKA A;  3ADA B;  2GF3 A;  4XWR A;  5IPY A;  1GTH A;  3P4P A;  5HHF A;  4H4V A;  4UDQ A;  4CRT A;  1E1M A;  2E4G A;  2WPE A;  3GMC A;  1GRG A;  1BF3 A;  2J3N A;  4H2N A;  3P1W A;  4UP3 A;  3SFE A;  4NTC A;  1ZOV A;  1F3P A;  3FIM B;  2BK4 A;  4C74 A;  3C4N A;  4TLX A;  4GDP A;  4B68 A;  5BUK A;  5JCM A;  3D1I A;  2BYB A;  3ZYX A;  1EL5 A;  2XFO A;  4ECH A;  3BI4 A;  3GRS A;  2ZO5 A;  4YXD A;  4I58 A;  1FL2 A;  2ZZC A;  2J7A A;  2R4J A;  4C3Y A;  1CJ3 A;  1NHR A;  1KF6 A;  2QAE A;  4U8K A;  4Y4L A;  3AE1 A;  1F6M A;  3CGE A;  5IQ4 A;  3UU9 A;  3AE2 A;  1P2H A;  4CCQ A;  2EQ6 A;  1GRB A;  1ZP0 A;  3DA1 A;  1FEC A;  2GVC A;  3OZ2 A;  3R9U A;  3UOV A;  5FS6 A;  4DNA A;  2WPF A;  4TM1 A;  2RAB A;  4H4Q A;  5EBK A;  1L0V A;  1Y0P A;  2WQY A;  2XCG A;  1LQT A;  1PXB A;  3PVC A;  4O5Q A;  3GDP A;  4L3Y A;  2WOW A;  2WS3 A;  1DOC A;  3IHG A;  4WJY A;  3AD8 B;  4Q0T A;  4H7U A;  4WCT A;  4AP3 A;  1SP3 A;  5KXJ A;  1E1L A;  4L38 A;  3KU9 A;  4L3Z A;  3VRD B;  2BAC A;  3NT6 A;  4RSL A;  4NEW A;  1DJQ A;  1REO A;  3UTH A;  3UKL A;  1Y56 A;  1GRH A;  1S3E A;  4C5O A;  4D03 A;  1OJA A;  1BVB A;  5JCN A;  3BNG A;  2FBW A;  3COX A;  3UTG A;  1OJT A;  2X8C A;  4DGK A;  2ARD A;  3CGD A;  4J56 A;  2GH5 A;  1H82 A;  3GDN A;  3KA7 A;  4YWO A;  3NG7 X;  2XFP A;  5BUL A;  5KVH A;  3V3O A;  1GET A;  3ATR A;  1ONF A;  1FEA A;  2WDV A;  2GR3 A;  1O5W A;  2C76 A;  3DJE A;  2WP5 A;  2GAG B;  2C75 A;  4A9W A;  2YLZ A;  3AE4 A;  3UOY A;  2X3N A;  1GXF A;  1YY5 A;  4D04 A;  1BZL A;  3ICS A;  4H4W A;  5HXI A;  2YR5 A;  3AWI A;  4O5U A;  2VVL G;  3LAD A;  2X8G A;  4U2T A;  2C73 A;  2YLR A;  5JCK A;  5M10 A;  4TM4 A;  3ALM A;  1GER A;  1NDA A;  3DK4 A;  3KVE A;  1CF3 A;  1CC2 A;  5FS8 A;  1RSG A;  3LG1 A;  3QVP A;  2C7G A;  2H88 A;  3L8K A;  3ISH A;  2GR1 A;  4L3X A;  2V5Z A;  1Q1W A;  3EAO A;  5EB4 A;  1ZMC A;  1F8S A;  2TMD A;  1M1Q A;  2VQ7 A;  3GYI A;  3GYJ A;  3II4 A;  1D5T A;  3K7T A;  3WE0 A;  2XVI A;  1F8R A;  4FDC B;  3NK0 X;  2FJD A;  3M13 A;  2YG7 A;  1XAN A;  4A65 A;  4H2P A;  4B1B A;  1ZDL A;  4U8O A;  3CPJ G;  3PS9 A;  2JK6 A;  1GT8 A;  2E1M A;  3Q9T A;  1PHH A;  2V61 A;  2YM1 A;  4IA6 A;  5M0Z A;  3AEA A;  3IHM A;  3NRN A;  2RGO A;  1F8W A;  3KPF A;  5DBJ A;  3FO3 A;  3S61 A;  2B9X A;  1M1R A;  4YKF A;  3KLJ A;  2PYX A;  5TR3 A;  4EM3 A;  2BAB A;  4Q4U A;  1H7W A;  2WES A;  3NTD A;  2APG A;  1D7Y A;  1K0L A;  2YR6 A;  2V3B A;  4OPL A;  3AEE A;  1S2Y A;  1ZY8 A;  4USR A;  4A6N B;  4YSH A;  4Z44 A;  2XVJ A;  1KDG A;  4OPD A;  4XXG A;  5L46 A;  2UZZ A;  4A5L A;  1GRA A;  1JNZ A;  1TRB A;  2CUL A;  3NIX A;  2BC0 A;  3M0O A;  5CKU A;  3SFD A;  2YWL A;  1JEH A;  5FS9 A;  2OLO A;  4A6N A;  1JU2 A;  4U2L A;  1P2E A;  2JAE A;  1KSU A;  1PN0 A;  4HA6 A;  2O9Z A;  3LZX A;  1TDE A;  4K22 A;  4IV9 A;  4JY3 A;  4I59 A;  1EL9 A;  2RF7 A;  2BK3 A;  2TPR A;  2VRM A;  3AB1 A;  3NHO X;  4JNA A;  3DME A;  3EAN A;  1GPE A;  3C4A A;  1B5Q A;  3LJP A;  4BK2 A;  1BWC A;  2BA9 A;  3URH A;  3GD4 A;  3DGZ A;  1JNR A;  4P9S A;  3EPT A;  3AEG A;  3RP8 A;  4Y4N A;  2DKI A;  1ZMD A;  1LQU A;  4KX6 A;  3DK9 A;  3AE3 A;  3P4S A;  4K7Z A;  1CC6 A;  4BK1 A;  4OPU A;  1ELI A;  1FT5 A;  2B76 A;  2IVD A;  4EQR A;  1L9D A;  3NLC A;  3CNJ A;  5KOW A;  1CJ2 A;  4B67 A;  1B8S A;  4PAB A;  5KVI A;  2VR0 A;  1YKJ A;  2LFC A;  2EQ7 A;  1VDC A;  2K3V A;  3ALJ A;  4JY2 A;  4YTP A;  1MXT A;  4LA1 A;  3SCE A;  1PXA A;  3L1R A;  2YLT A;  1O95 A;  1TDO A;  1QDB A;  2GMJ A;  4C3X A;  2PHH A;  3ICT A;  2BK5 A;  1TDN A;  3CND A;  3P9U A;  1E1K A;  3NYE A;  2R0P A;  4U8M A;  2YLW A;  4EQW A;  3CPI G;  1LVL A;  1GSN A;  2BXR A;  3B3R A;  2B9W A;  2IVE A;  4TM0 A;  1GV4 A;  1CJ4 A;  1Z6L A;  1PBC A;  2F5Z A;  2BS2 A;  1D4E A;  1GND A;  5J7X A;  1GU6 A;  4FK1 C;  5KOX A;  2YVJ A;  1CC4 A;  3SGL A;  2XVE A;  1S2Q A;  3I6D A;  3TOR A;  1B37 A;  5FS7 A;  5GSN A;  4IA5 A;  2XFN A;  5ER0 A;  1GRF A;  4ZCD A;  2JB2 A;  3K7Q X;  1HYU A;  4FK1 A;  1GOS A;  4OVI A; 
#chains in the Genus database with same CATH topology
 1JOA A;  1GRE A;  3RED A;  4CBQ A;  3HZL A;  4CCR A;  4JN9 A;  4Z43 A;  1QLB A;  3K7M X;  1PBE A;  2RGJ A;  3H8I A;  4JNQ A;  1YQ4 A;  2FJA A;  1L9E A;  3GMB A;  3OWM A;  2WDQ A;  4EMW A;  2BCG G;  4GAP A;  4GCM A;  1MO9 A;  1EL7 A;  3AYJ A;  3M12 A;  5CQF A;  3CTY A;  3UKF A;  3C96 A;  3SZC A;  3CNS A;  5HY5 A;  4YTM A;  4A7A A;  3UKQ A;  2Q6U A;  2B7S A;  4EQX A;  1FS8 A;  3UP5 A;  3QVR A;  4LII A;  5JCL A;  2WP9 A;  1GAL A;  1GTE A;  3UTF A;  4Z2U A;  3D8X A;  3VR8 A;  2YQU A;  4TM3 A;  1FT6 A;  2JB3 A;  2CVJ A;  2WOI A;  2XLT A;  3S5W A;  1PJ5 A;  3LZW A;  3NNE A;  2A87 A;  2GQW A;  3CN8 A;  4B63 A;  2C65 A;  3VQR A;  1O94 A;  2Y6R A;  4X9N A;  3SX6 A;  2OLN A;  2GQF A;  3K30 A;  4GF7 A;  3AYL A;  1PJ7 A;  4EM4 A;  1FEB A;  1BGJ A;  2V3A A;  3D1C A;  5IQ1 A;  2C70 A;  2OA1 A;  5KMS A;  1QO8 A;  1D4D A;  3LOV A;  4RG4 A;  4X9M A;  3RNM A;  1Q9I A;  3KPK A;  4H4U A;  4BJY A;  4E0V A;  3AXB A;  4J34 A;  1YQ3 A;  4EMI A;  3QSM A;  3VR9 A;  1IUV A;  1NG4 A;  1OJD A;  3F8R A;  2VVL A;  4H4R A;  5C2T A;  2VVM A;  1NEK A;  2ZBW A;  4IVM B;  3UCL A;  3BNF A;  4KPR A;  3SQP A;  4H50 A;  2XLS A;  1IUX A;  4Z25 A;  4REK A;  2YM2 A;  2EQ8 A;  4DSG A;  1EBD A;  2A8X A;  3H4K A;  4EMJ A;  1FS9 A;  1DXL A;  1FOH A;  1OJ9 A;  3GRT A;  4GR1 A;  1PBF A;  4H2Q A;  3SYI A;  3G5Q A;  4NTD A;  4BJZ A;  3DK8 A;  3FMW A;  3KKJ A;  2ZZB A;  1V59 A;  4DSH A;  1H6V A;  1H7X A;  2R4E A;  3QSE A;  3NGC X;  1N4V A;  1X31 B;  2RDZ A;  1LJ1 A;  2WDR A;  1E6E A;  3T2Z A;  2YG3 A;  1N1P A;  5KMP A;  4U8N A;  3T0K A;  3BNU A;  4M52 A;  4BK3 A;  1IUW A;  2OT4 A;  5BVA A;  3SZW A;  2BXS A;  2ZZ0 A;  3RHA A;  3AE7 A;  3DH9 A;  3HYX A;  3UP4 A;  4NNJ A;  1NHQ A;  3VRA A;  2BC1 A;  2I0Z A;  3QFB A;  1ZX9 A;  2X50 A;  1PBB A;  3P4Q A;  2XLR A;  1OAH A;  4II3 A;  4AP1 A;  3BHK A;  5J60 A;  2C3C A;  3UKP A;  2GEW A;  3CIR A;  1XPQ A;  2CDU A;  1JRZ A;  1N4U A;  2WEU A;  1W4X A;  3NK1 X;  1E39 A;  2BS3 A;  2E5V A;  3P4R A;  3AED A;  2E80 A;  2NVK X;  2QA2 A;  2YLS A;  2AR8 A;  1NPX A;  4Y4M A;  2R9Z A;  3GWD A;  2R0C A;  3AYI A;  3ZDN A;  4Q1O A;  2GAH B;  4Z2T A;  2B9Y A;  2E81 A;  2B7R A;  2GR2 A;  1D4C A;  2V60 A;  3G5S A;  3NTA A;  4Q17 A;  5FMH A;  1DJN A;  1JRY A;  4ADW A;  3S7W A;  1IUU A;  2NPX A;  3HYV A;  3NH3 X;  3QFA A;  3UBR A;  2DKH A;  3KD9 A;  1MOK A;  2QA1 A;  2CFY A;  3B6D A;  3DJG X;  1E7P A;  3IWA A;  3RP6 A;  2VRL A;  3UKK A;  5EOW A;  4NZH A;  1IUT A;  1GES A;  1H86 A;  3E1T A;  2ACZ A;  2HQM A;  2RGH A;  4B65 A;  4AOX A;  4BV6 A;  3EF6 A;  3HYW A;  1IUS A;  4UDP A;  1L9C A;  2GB0 A;  4U8I A;  4X4J A;  3CNT A;  4LU6 A;  1TDK A;  1PJ6 A;  2YG6 A;  3BNM A;  3NYF A;  3DJD A;  1CL0 A;  1LPF A;  3L1T A;  2R46 A;  3UKH A;  2OAL A;  3AD9 B;  2C72 A;  4JDR A;  5KMR A;  3ABV A;  3NYC A;  3AE6 A;  1SEZ A;  4H4X A;  3MMO A;  1VG9 A;  1KSS A;  1S3B A;  2VOU A;  2JBV A;  4GDE A;  4NTE A;  3CNP A;  4OCG A;  4G73 A;  1NEN A;  3T37 A;  1XDI A;  4J36 A;  1UKV G;  2FJE A;  3ATQ A;  1KNP A;  3G5R A;  3V76 A;  4U2S A;  4YKG A;  4K2X A;  4PAA A;  1PBD A;  3FBS A;  2W0H A;  3DJJ A;  3IC9 A;  1K4Q A;  1ZKQ A;  2X8H A;  1VG0 A;  2JKC A;  5U1O A;  2XLU A;  1M1P A;  4OPT A;  1M6I A;  2C67 A;  3I3L A;  4K5S A;  1PDH A;  4Z24 A;  2XDO A;  3SZF A;  4YSX A;  1Y56 B;  4BUR A;  3F29 A;  3TTB A;  2R45 A;  1LV0 A;  2GV8 A;  3SZ0 A;  4Q5B A;  4HB9 A;  5C3J A;  2XFU A;  3GSI A;  1TYP A;  1KNR A;  1D7L A;  4GRT A;  2YVG A;  2X99 A;  2XFQ A;  4H4P A;  3AE5 A;  3V3N A;  2Z5Y A;  2FJB A;  5KRQ A;  1H84 A;  1VRQ B;  4J57 A;  4IVO B;  4K5R A;  3UOZ A;  2JB1 A;  4G9K A;  4K8D A;  1N4W A;  2GMH A;  5KWF A;  1PXC A;  1B4V A;  4H4Y A;  1QJD A;  3PO7 A;  4JQ9 A;  2YG4 A;  4APN A;  1FCD A;  1TDF A;  4WX1 A;  3AE9 A;  3T2K A;  3BHF A;  2AAQ A;  2Q7V A;  2BCP A;  1LTX R;  2WOV A;  3F8P A;  3QSS A;  4ICY A;  4Z2R A;  4NEV A;  2IID A;  3BNJ A;  2C64 A;  2Z5X A;  4AOS A;  2WPC A;  2GR0 A;  3AE8 A;  3GYX A;  3Q6J A;  4U8J A;  1RP0 A;  1E1N A;  3UOX A;  4OPG A;  1ZK7 A;  2C3D A;  4EQS A;  4YSZ A;  4G74 A;  1VQW A;  2Q0L A;  4CNJ A;  4A79 A;  4XWZ A;  4TLZ A;  2R0G A;  3BI5 A;  1DOE A;  3AD7 B;  3GD3 A;  4USQ A;  4A99 A;  3NK2 X;  3H8L A;  2V6O A;  3F8D A;  3SM8 A;  1NHP A;  3AEF A;  4B66 A;  5BRT A;  1NHS A;  1JNI A;  5U63 A;  3RP7 A;  2Y6Q A;  4H4Z A;  3BI2 A;  1JRX A;  1GEU A;  1PS9 A;  4ZN0 A;  2XLP A;  2XVH A;  4B69 A;  3ICR A;  3GM6 A;  1TYT A;  2YLX A;  2WU5 A;  1KFY A;  3AEC A;  5HYM A;  4OPC A;  3UTE A;  2WU2 A;  5U25 A;  5LV9 A;  3FPZ A;  4H4S A;  3LGQ A;  2A89 A;  3CPH G;  3NN6 X;  4J31 A;  3JSK A;  3SXQ A;  3BNH A;  5EB5 A;  3LXD A;  1RYI A;  4ZCC A;  1BGN A;  2WBA A;  4MJW A;  1COY A;  3AEB A;  4EIP A;  3CGC A;  1EL8 A;  2WHD A;  2XVF A;  4Z26 A;  3IF9 A;  1FS7 A;  4CNK A;  2VQB A;  3SXI A;  1XHC A;  1OJC A;  3QJ4 A;  3T14 A;  1CHU A;  1IJH A;  4J33 A;  1ZOY A;  2BRY A;  2WET A;  1NAA A;  3FG2 P;  4AT2 A;  3CGB A;  1H81 A;  2Q0K A;  5JCI A;  4H4T A;  4N9X A;  2GRT A;  5GRT A;  3ITJ A;  1DOD A;  3LB8 A;  4U8P A;  4U8L A;  2VZ2 A;  2WP6 A;  1AOG A;  4RG3 A;  1M64 A;  1DNC A;  2YAU A;  4AT0 A;  2XYO A;  3NN0 X;  1Q1R A;  4GUV A;  2YVF A;  2QCU A;  4CY6 A;  4Q5C A;  4FX9 A;  3O0H A;  1DOB A;  2BS4 A;  4YT0 A;  2AQJ A;  5KMQ A;  1K0I A;  1K0J A;  3GWF A;  2EQ9 A;  1NG3 A;  2C66 A;  2YR4 A;  4C77 A;  3ALL A;  1CBO A;  4J2W A;  1H83 A;  1CJC A;  2OAM A;  4B64 A;  4OPI A;  3DGH A;  3NKS A;  2YG5 A;  4UDR A;  1GRT A;  4YTN A;  4H2R A;  3OC4 A;  4EIQ A;  1YQZ A;  2H89 A;  3VRB A;  1BKW A;  4CY8 A;  4YSY A;  3RKH A;  3UKA A;  3ADA B;  2GF3 A;  4XWR A;  5IPY A;  1GTH A;  3P4P A;  5HHF A;  4H4V A;  4UDQ A;  4CRT A;  2CZS A;  1E1M A;  2E4G A;  2WPE A;  3GMC A;  1GRG A;  1BF3 A;  2J3N A;  4H2N A;  3P1W A;  4UP3 A;  3SFE A;  4NTC A;  1ZOV A;  1F3P A;  3FIM B;  2BK4 A;  4C74 A;  3C4N A;  4TLX A;  4GDP A;  4B68 A;  5BUK A;  5JCM A;  3D1I A;  2BYB A;  3ZYX A;  1EL5 A;  2XFO A;  4ECH A;  3BI4 A;  3GRS A;  2ZO5 A;  4YXD A;  4I58 A;  1FL2 A;  2ZZC A;  2J7A A;  2R4J A;  4C3Y A;  1CJ3 A;  1NHR A;  1KF6 A;  2QAE A;  4U8K A;  4Y4L A;  3AE1 A;  1F6M A;  3CGE A;  5IQ4 A;  3UU9 A;  3AE2 A;  1P2H A;  3SY4 A;  2EQ6 A;  4CCQ A;  1GRB A;  1ZP0 A;  3DA1 A;  1FEC A;  2GVC A;  3OZ2 A;  3R9U A;  3UOV A;  5FS6 A;  4DNA A;  2WPF A;  4TM1 A;  2RAB A;  4H4Q A;  5EBK A;  1L0V A;  1Y0P A;  2WQY A;  2XCG A;  1LQT A;  1PXB A;  3PVC A;  4O5Q A;  3GDP A;  4L3Y A;  4GAV A;  2WOW A;  2WS3 A;  1DOC A;  3IHG A;  4WJY A;  3AD8 B;  4Q0T A;  4H7U A;  4WCT A;  4AP3 A;  1SP3 A;  5KXJ A;  1E1L A;  4L38 A;  3KU9 A;  4L3Z A;  3VRD B;  2BAC A;  3NT6 A;  4RSL A;  4NEW A;  1DJQ A;  1REO A;  3UTH A;  3UKL A;  1Y56 A;  1GRH A;  1S3E A;  4C5O A;  4D03 A;  1OJA A;  1BVB A;  5JCN A;  3BNG A;  2FBW A;  3COX A;  4NWZ A;  3UTG A;  1OJT A;  2X8C A;  4DGK A;  2ARD A;  3CGD A;  4J56 A;  2GH5 A;  1H82 A;  3GDN A;  3KA7 A;  4YWO A;  3NG7 X;  2XFP A;  5BUL A;  5KVH A;  3V3O A;  1GET A;  3ATR A;  1ONF A;  1FEA A;  2WDV A;  2GR3 A;  1O5W A;  2C76 A;  3DJE A;  2WP5 A;  2GAG B;  2C75 A;  4A9W A;  2YLZ A;  3AE4 A;  3UOY A;  2X3N A;  1GXF A;  1YY5 A;  4D04 A;  1BZL A;  3ICS A;  4H4W A;  5HXI A;  2YR5 A;  3AWI A;  4O5U A;  2VVL G;  3LAD A;  2X8G A;  4U2T A;  2C73 A;  2YLR A;  5JCK A;  5M10 A;  4TM4 A;  3CMM A;  3ALM A;  1GER A;  1NDA A;  3DK4 A;  3KVE A;  1CF3 A;  1CC2 A;  5FS8 A;  1RSG A;  3LG1 A;  3QVP A;  2C7G A;  2H88 A;  3L8K A;  3ISH A;  2GR1 A;  4L3X A;  2V5Z A;  1Q1W A;  3EAO A;  5EB4 A;  1ZMC A;  1F8S A;  2TMD A;  1M1Q A;  2VQ7 A;  3GYI A;  3GYJ A;  3II4 A;  1D5T A;  3K7T A;  3WE0 A;  2XVI A;  1F8R A;  4FDC B;  3NK0 X;  2FJD A;  3M13 A;  2YG7 A;  1XAN A;  3T31 A;  4A65 A;  4H2P A;  4B1B A;  1ZDL A;  2BRA A;  3CPJ G;  3PS9 A;  4U8O A;  2JK6 A;  1GT8 A;  2E1M A;  3Q9T A;  1PHH A;  2V61 A;  2YM1 A;  4II2 A;  4IA6 A;  5M0Z A;  3AEA A;  3IHM A;  3NRN A;  2RGO A;  1F8W A;  3KPF A;  5DBJ A;  3FO3 A;  3S61 A;  2B9X A;  1M1R A;  4YKF A;  3KLJ A;  2PYX A;  5TR3 A;  4EM3 A;  2BAB A;  4Q4U A;  1H7W A;  2WES A;  3NTD A;  2APG A;  1D7Y A;  1K0L A;  2YR6 A;  2V3B A;  4OPL A;  3AEE A;  1S2Y A;  1ZY8 A;  4USR A;  4A6N B;  4YSH A;  4Z44 A;  2XVJ A;  1KDG A;  4OPD A;  4XXG A;  5L46 A;  2UZZ A;  4A5L A;  1GRA A;  1JNZ A;  1TRB A;  2CUL A;  3NIX A;  2BC0 A;  3M0O A;  5CKU A;  3SFD A;  2YWL A;  1JEH A;  5FS9 A;  2OLO A;  4A6N A;  1JU2 A;  4U2L A;  1P2E A;  2JAE A;  1KSU A;  1PN0 A;  4HA6 A;  2O9Z A;  3LZX A;  1TDE A;  4K22 A;  4IV9 A;  4JY3 A;  4I59 A;  1EL9 A;  2RF7 A;  2BK3 A;  2TPR A;  2VRM A;  3AB1 A;  3NHO X;  4JNA A;  3DME A;  3EAN A;  5KNL A;  1GPE A;  3C4A A;  1B5Q A;  3LJP A;  4BK2 A;  1BWC A;  2BA9 A;  3URH A;  3GD4 A;  3DGZ A;  1JNR A;  4P9S A;  3EPT A;  3AEG A;  4G6H A;  3RP8 A;  4Y4N A;  2DKI A;  1ZMD A;  1LQU A;  4KX6 A;  3DK9 A;  3AE3 A;  3P4S A;  4G6G A;  1CC6 A;  4K7Z A;  4OPU A;  4BK1 A;  1ELI A;  1FT5 A;  2B76 A;  2IVD A;  4EQR A;  1L9D A;  3NLC A;  3CNJ A;  5KOW A;  1CJ2 A;  4B67 A;  1B8S A;  4PAB A;  5KVI A;  2VR0 A;  1YKJ A;  2LFC A;  2EQ7 A;  1VDC A;  2K3V A;  3ALJ A;  4JY2 A;  4YTP A;  1MXT A;  4LA1 A;  3SCE A;  1PXA A;  3L1R A;  2YLT A;  1O95 A;  1TDO A;  1QDB A;  2GMJ A;  4C3X A;  2PHH A;  3ICT A;  2BK5 A;  1TDN A;  3CND A;  3P9U A;  1E1K A;  3NYE A;  2R0P A;  4U8M A;  2YLW A;  4EQW A;  3CPI G;  1LVL A;  1GSN A;  2BXR A;  3B3R A;  2B9W A;  2IVE A;  4TM0 A;  1GV4 A;  1CJ4 A;  1Z6L A;  1PBC A;  2F5Z A;  2BS2 A;  1D4E A;  1GND A;  2C4C A;  5J7X A;  1GU6 A;  4FK1 C;  5KOX A;  2YVJ A;  3T2Y A;  1CC4 A;  3SGL A;  2XVE A;  1S2Q A;  3I6D A;  3TOR A;  1B37 A;  5FS7 A;  5GSN A;  4IA5 A;  2XFN A;  5ER0 A;  1GRF A;  4ZCD A;  2JB2 A;  3K7Q X;  1HYU A;  4FK1 A;  1GOS A;  4OVI A; 
#chains in the Genus database with same CATH homology
 1JOA A;  1GRE A;  3RED A;  4CBQ A;  3HZL A;  4CCR A;  4JN9 A;  4Z43 A;  1QLB A;  3K7M X;  1PBE A;  2RGJ A;  3H8I A;  4JNQ A;  1YQ4 A;  2FJA A;  1L9E A;  3GMB A;  3OWM A;  2WDQ A;  4EMW A;  2BCG G;  4GAP A;  4GCM A;  1MO9 A;  1EL7 A;  3AYJ A;  3M12 A;  5CQF A;  3CTY A;  3UKF A;  3C96 A;  3SZC A;  3CNS A;  5HY5 A;  4YTM A;  4A7A A;  3UKQ A;  2Q6U A;  2B7S A;  4EQX A;  1FS8 A;  3UP5 A;  3QVR A;  4LII A;  5JCL A;  2WP9 A;  1GAL A;  1GTE A;  3UTF A;  4Z2U A;  3D8X A;  3VR8 A;  2YQU A;  4TM3 A;  1FT6 A;  2JB3 A;  2CVJ A;  2WOI A;  2XLT A;  3S5W A;  1PJ5 A;  3LZW A;  3NNE A;  2A87 A;  2GQW A;  3CN8 A;  4B63 A;  2C65 A;  3VQR A;  1O94 A;  2Y6R A;  4X9N A;  3SX6 A;  2OLN A;  2GQF A;  3K30 A;  4GF7 A;  3AYL A;  1PJ7 A;  4EM4 A;  1FEB A;  1BGJ A;  2V3A A;  3D1C A;  5IQ1 A;  2C70 A;  2OA1 A;  5KMS A;  1QO8 A;  1D4D A;  3LOV A;  4RG4 A;  4X9M A;  3RNM A;  1Q9I A;  3KPK A;  4H4U A;  4BJY A;  4E0V A;  3AXB A;  4J34 A;  1YQ3 A;  4EMI A;  3QSM A;  3VR9 A;  1IUV A;  1NG4 A;  1OJD A;  3F8R A;  2VVL A;  4H4R A;  5C2T A;  2VVM A;  1NEK A;  2ZBW A;  4IVM B;  3UCL A;  3BNF A;  4KPR A;  3SQP A;  4H50 A;  2XLS A;  1IUX A;  4Z25 A;  4REK A;  2YM2 A;  2EQ8 A;  4DSG A;  1EBD A;  2A8X A;  3H4K A;  4EMJ A;  1FS9 A;  1DXL A;  1FOH A;  1OJ9 A;  3GRT A;  4GR1 A;  1PBF A;  4H2Q A;  3SYI A;  3G5Q A;  4NTD A;  4BJZ A;  3DK8 A;  3FMW A;  3KKJ A;  2ZZB A;  1V59 A;  4DSH A;  1H6V A;  1H7X A;  2R4E A;  3QSE A;  3NGC X;  1N4V A;  1X31 B;  2RDZ A;  1LJ1 A;  2WDR A;  1E6E A;  3T2Z A;  2YG3 A;  1N1P A;  5KMP A;  4U8N A;  3T0K A;  3BNU A;  4M52 A;  4BK3 A;  1IUW A;  2OT4 A;  5BVA A;  3SZW A;  2BXS A;  2ZZ0 A;  3RHA A;  3AE7 A;  3DH9 A;  3HYX A;  3UP4 A;  4NNJ A;  1NHQ A;  3VRA A;  2BC1 A;  2I0Z A;  3QFB A;  1ZX9 A;  2X50 A;  1PBB A;  3P4Q A;  2XLR A;  1OAH A;  4II3 A;  4AP1 A;  3BHK A;  5J60 A;  2C3C A;  3UKP A;  2GEW A;  3CIR A;  1XPQ A;  2CDU A;  1JRZ A;  1N4U A;  2WEU A;  1W4X A;  3NK1 X;  1E39 A;  2BS3 A;  2E5V A;  3P4R A;  3AED A;  2E80 A;  2NVK X;  2QA2 A;  2YLS A;  2AR8 A;  1NPX A;  4Y4M A;  2R9Z A;  3GWD A;  2R0C A;  3AYI A;  3ZDN A;  4Q1O A;  2GAH B;  4Z2T A;  2B9Y A;  2E81 A;  2B7R A;  2GR2 A;  1D4C A;  2V60 A;  3G5S A;  3NTA A;  4Q17 A;  5FMH A;  1DJN A;  1JRY A;  4ADW A;  3S7W A;  1IUU A;  2NPX A;  3HYV A;  3NH3 X;  3QFA A;  3UBR A;  2DKH A;  3KD9 A;  1MOK A;  2QA1 A;  2CFY A;  3B6D A;  3DJG X;  1E7P A;  3IWA A;  3RP6 A;  2VRL A;  3UKK A;  5EOW A;  4NZH A;  1IUT A;  1GES A;  1H86 A;  3E1T A;  2ACZ A;  2HQM A;  2RGH A;  4B65 A;  4AOX A;  4BV6 A;  3EF6 A;  3HYW A;  1IUS A;  4UDP A;  1L9C A;  2GB0 A;  4U8I A;  4X4J A;  3CNT A;  4LU6 A;  1TDK A;  1PJ6 A;  2YG6 A;  3BNM A;  3NYF A;  3DJD A;  1CL0 A;  1LPF A;  3L1T A;  2R46 A;  3UKH A;  2OAL A;  3AD9 B;  2C72 A;  4JDR A;  5KMR A;  3ABV A;  3NYC A;  3AE6 A;  1SEZ A;  4H4X A;  3MMO A;  1VG9 A;  1KSS A;  1S3B A;  2VOU A;  2JBV A;  4GDE A;  4NTE A;  3CNP A;  4OCG A;  4G73 A;  1NEN A;  3T37 A;  1XDI A;  4J36 A;  1UKV G;  2FJE A;  3ATQ A;  1KNP A;  3G5R A;  3V76 A;  4U2S A;  4YKG A;  4K2X A;  4PAA A;  1PBD A;  3FBS A;  2W0H A;  3DJJ A;  3IC9 A;  1K4Q A;  1ZKQ A;  2X8H A;  1VG0 A;  2JKC A;  5U1O A;  2XLU A;  1M1P A;  4OPT A;  1M6I A;  2C67 A;  3I3L A;  4K5S A;  1PDH A;  4Z24 A;  2XDO A;  3SZF A;  4YSX A;  1Y56 B;  4BUR A;  3F29 A;  3TTB A;  2R45 A;  1LV0 A;  2GV8 A;  3SZ0 A;  4Q5B A;  4HB9 A;  5C3J A;  2XFU A;  3GSI A;  1TYP A;  1KNR A;  1D7L A;  4GRT A;  2YVG A;  2X99 A;  2XFQ A;  4H4P A;  3AE5 A;  3V3N A;  2Z5Y A;  2FJB A;  5KRQ A;  1H84 A;  1VRQ B;  4J57 A;  4IVO B;  4K5R A;  3UOZ A;  2JB1 A;  4G9K A;  4K8D A;  1N4W A;  2GMH A;  5KWF A;  1PXC A;  1B4V A;  4H4Y A;  1QJD A;  3PO7 A;  4JQ9 A;  2YG4 A;  4APN A;  1FCD A;  1TDF A;  4WX1 A;  3AE9 A;  3T2K A;  3BHF A;  2AAQ A;  2Q7V A;  2BCP A;  1LTX R;  2WOV A;  3F8P A;  3QSS A;  4ICY A;  4Z2R A;  4NEV A;  2IID A;  3BNJ A;  2C64 A;  2Z5X A;  4AOS A;  2WPC A;  2GR0 A;  3AE8 A;  3GYX A;  3Q6J A;  4U8J A;  1RP0 A;  1E1N A;  3UOX A;  4OPG A;  1ZK7 A;  2C3D A;  4EQS A;  4YSZ A;  4G74 A;  1VQW A;  2Q0L A;  4CNJ A;  4A79 A;  4XWZ A;  4TLZ A;  2R0G A;  3BI5 A;  1DOE A;  3AD7 B;  3GD3 A;  4USQ A;  4A99 A;  3NK2 X;  3H8L A;  2V6O A;  3F8D A;  3SM8 A;  1NHP A;  3AEF A;  4B66 A;  5BRT A;  1NHS A;  1JNI A;  5U63 A;  3RP7 A;  2Y6Q A;  4H4Z A;  3BI2 A;  1JRX A;  1GEU A;  1PS9 A;  4ZN0 A;  2XLP A;  2XVH A;  4B69 A;  3ICR A;  3GM6 A;  1TYT A;  2YLX A;  2WU5 A;  1KFY A;  3AEC A;  5HYM A;  4OPC A;  3UTE A;  2WU2 A;  5U25 A;  5LV9 A;  3FPZ A;  4H4S A;  3LGQ A;  2A89 A;  3CPH G;  3NN6 X;  4J31 A;  3JSK A;  3SXQ A;  3BNH A;  5EB5 A;  3LXD A;  1RYI A;  4ZCC A;  1BGN A;  2WBA A;  4MJW A;  1COY A;  3AEB A;  4EIP A;  3CGC A;  1EL8 A;  2WHD A;  2XVF A;  4Z26 A;  3IF9 A;  1FS7 A;  4CNK A;  2VQB A;  3SXI A;  1XHC A;  1OJC A;  3QJ4 A;  3T14 A;  1CHU A;  1IJH A;  4J33 A;  1ZOY A;  2BRY A;  2WET A;  1NAA A;  3FG2 P;  4AT2 A;  3CGB A;  1H81 A;  2Q0K A;  5JCI A;  4H4T A;  4N9X A;  2GRT A;  5GRT A;  3ITJ A;  1DOD A;  3LB8 A;  4U8P A;  4U8L A;  2VZ2 A;  2WP6 A;  1AOG A;  4RG3 A;  1M64 A;  1DNC A;  2YAU A;  4AT0 A;  2XYO A;  3NN0 X;  1Q1R A;  4GUV A;  2YVF A;  2QCU A;  4CY6 A;  4Q5C A;  4FX9 A;  3O0H A;  1DOB A;  2BS4 A;  4YT0 A;  2AQJ A;  5KMQ A;  1K0I A;  1K0J A;  3GWF A;  2EQ9 A;  1NG3 A;  2C66 A;  2YR4 A;  4C77 A;  3ALL A;  1CBO A;  4J2W A;  1H83 A;  1CJC A;  2OAM A;  4B64 A;  4OPI A;  3DGH A;  3NKS A;  2YG5 A;  4UDR A;  1GRT A;  4YTN A;  4H2R A;  3OC4 A;  4EIQ A;  1YQZ A;  2H89 A;  3VRB A;  1BKW A;  4CY8 A;  4YSY A;  3RKH A;  3UKA A;  3ADA B;  2GF3 A;  4XWR A;  5IPY A;  1GTH A;  3P4P A;  5HHF A;  4H4V A;  4UDQ A;  4CRT A;  1E1M A;  2E4G A;  2WPE A;  3GMC A;  1GRG A;  1BF3 A;  2J3N A;  4H2N A;  3P1W A;  4UP3 A;  3SFE A;  4NTC A;  1ZOV A;  1F3P A;  3FIM B;  2BK4 A;  4C74 A;  3C4N A;  4TLX A;  4GDP A;  4B68 A;  5BUK A;  5JCM A;  3D1I A;  2BYB A;  3ZYX A;  1EL5 A;  2XFO A;  4ECH A;  3BI4 A;  3GRS A;  2ZO5 A;  4YXD A;  4I58 A;  1FL2 A;  2ZZC A;  2J7A A;  2R4J A;  4C3Y A;  1CJ3 A;  1NHR A;  1KF6 A;  2QAE A;  4U8K A;  4Y4L A;  3AE1 A;  1F6M A;  3CGE A;  5IQ4 A;  3UU9 A;  3AE2 A;  1P2H A;  3SY4 A;  2EQ6 A;  4CCQ A;  1GRB A;  1ZP0 A;  3DA1 A;  1FEC A;  2GVC A;  3OZ2 A;  3R9U A;  3UOV A;  5FS6 A;  4DNA A;  2WPF A;  4TM1 A;  2RAB A;  4H4Q A;  5EBK A;  1L0V A;  1Y0P A;  2WQY A;  2XCG A;  1LQT A;  1PXB A;  3PVC A;  4O5Q A;  3GDP A;  4L3Y A;  4GAV A;  2WOW A;  2WS3 A;  1DOC A;  3IHG A;  4WJY A;  3AD8 B;  4Q0T A;  4H7U A;  4WCT A;  4AP3 A;  1SP3 A;  5KXJ A;  1E1L A;  4L38 A;  3KU9 A;  4L3Z A;  3VRD B;  2BAC A;  3NT6 A;  4RSL A;  4NEW A;  1DJQ A;  1REO A;  3UTH A;  3UKL A;  1Y56 A;  1GRH A;  1S3E A;  4C5O A;  4D03 A;  1OJA A;  1BVB A;  5JCN A;  3BNG A;  2FBW A;  3COX A;  4NWZ A;  3UTG A;  1OJT A;  2X8C A;  4DGK A;  2ARD A;  3CGD A;  4J56 A;  2GH5 A;  1H82 A;  3GDN A;  3KA7 A;  4YWO A;  3NG7 X;  2XFP A;  5BUL A;  5KVH A;  3V3O A;  1GET A;  3ATR A;  1ONF A;  1FEA A;  2WDV A;  2GR3 A;  1O5W A;  2C76 A;  3DJE A;  2WP5 A;  2GAG B;  2C75 A;  4A9W A;  2YLZ A;  3AE4 A;  3UOY A;  2X3N A;  1GXF A;  1YY5 A;  4D04 A;  1BZL A;  3ICS A;  4H4W A;  5HXI A;  2YR5 A;  3AWI A;  4O5U A;  2VVL G;  3LAD A;  2X8G A;  4U2T A;  2C73 A;  2YLR A;  5JCK A;  5M10 A;  4TM4 A;  3CMM A;  3ALM A;  1GER A;  1NDA A;  3DK4 A;  3KVE A;  1CF3 A;  1CC2 A;  5FS8 A;  1RSG A;  3LG1 A;  3QVP A;  2C7G A;  2H88 A;  3L8K A;  3ISH A;  2GR1 A;  4L3X A;  2V5Z A;  1Q1W A;  3EAO A;  5EB4 A;  1ZMC A;  1F8S A;  2TMD A;  1M1Q A;  2VQ7 A;  3GYI A;  3GYJ A;  3II4 A;  1D5T A;  3K7T A;  3WE0 A;  2XVI A;  1F8R A;  4FDC B;  3NK0 X;  2FJD A;  3M13 A;  2YG7 A;  1XAN A;  3T31 A;  4A65 A;  4H2P A;  4B1B A;  1ZDL A;  2BRA A;  3CPJ G;  3PS9 A;  4U8O A;  2JK6 A;  1GT8 A;  2E1M A;  3Q9T A;  1PHH A;  2V61 A;  2YM1 A;  4II2 A;  4IA6 A;  5M0Z A;  3AEA A;  3IHM A;  3NRN A;  2RGO A;  1F8W A;  3KPF A;  5DBJ A;  3FO3 A;  3S61 A;  2B9X A;  1M1R A;  4YKF A;  3KLJ A;  2PYX A;  5TR3 A;  4EM3 A;  2BAB A;  4Q4U A;  1H7W A;  2WES A;  3NTD A;  2APG A;  1D7Y A;  1K0L A;  2YR6 A;  2V3B A;  4OPL A;  3AEE A;  1S2Y A;  1ZY8 A;  4USR A;  4A6N B;  4YSH A;  4Z44 A;  2XVJ A;  1KDG A;  4OPD A;  4XXG A;  5L46 A;  2UZZ A;  4A5L A;  1GRA A;  1JNZ A;  1TRB A;  2CUL A;  3NIX A;  2BC0 A;  3M0O A;  5CKU A;  3SFD A;  2YWL A;  1JEH A;  5FS9 A;  2OLO A;  4A6N A;  1JU2 A;  4U2L A;  1P2E A;  2JAE A;  1KSU A;  1PN0 A;  4HA6 A;  2O9Z A;  3LZX A;  1TDE A;  4K22 A;  4IV9 A;  4JY3 A;  4I59 A;  1EL9 A;  2RF7 A;  2BK3 A;  2TPR A;  2VRM A;  3AB1 A;  3NHO X;  4JNA A;  3DME A;  3EAN A;  5KNL A;  1GPE A;  3C4A A;  1B5Q A;  3LJP A;  4BK2 A;  1BWC A;  2BA9 A;  3URH A;  3GD4 A;  3DGZ A;  1JNR A;  4P9S A;  3EPT A;  3AEG A;  4G6H A;  3RP8 A;  4Y4N A;  2DKI A;  1ZMD A;  1LQU A;  4KX6 A;  3DK9 A;  3AE3 A;  3P4S A;  4G6G A;  1CC6 A;  4K7Z A;  4OPU A;  4BK1 A;  1ELI A;  1FT5 A;  2B76 A;  2IVD A;  4EQR A;  1L9D A;  3NLC A;  3CNJ A;  5KOW A;  1CJ2 A;  4B67 A;  1B8S A;  4PAB A;  5KVI A;  2VR0 A;  1YKJ A;  2LFC A;  2EQ7 A;  1VDC A;  2K3V A;  3ALJ A;  4JY2 A;  4YTP A;  1MXT A;  4LA1 A;  3SCE A;  1PXA A;  3L1R A;  2YLT A;  1O95 A;  1TDO A;  1QDB A;  2GMJ A;  4C3X A;  2PHH A;  3ICT A;  2BK5 A;  1TDN A;  3CND A;  3P9U A;  1E1K A;  3NYE A;  2R0P A;  4U8M A;  2YLW A;  4EQW A;  3CPI G;  1LVL A;  1GSN A;  2BXR A;  3B3R A;  2B9W A;  2IVE A;  4TM0 A;  1GV4 A;  1CJ4 A;  1Z6L A;  1PBC A;  2F5Z A;  2BS2 A;  1D4E A;  1GND A;  2C4C A;  5J7X A;  1GU6 A;  4FK1 C;  5KOX A;  2YVJ A;  3T2Y A;  1CC4 A;  3SGL A;  2XVE A;  1S2Q A;  3I6D A;  3TOR A;  1B37 A;  5FS7 A;  5GSN A;  4IA5 A;  2XFN A;  5ER0 A;  1GRF A;  4ZCD A;  2JB2 A;  3K7Q X;  1HYU A;  4FK1 A;  1GOS A;  4OVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...