1Y0PA

Flavocytochrome c3 with mesaconate bound
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fumarate reductase flavoprotein subunit
publication title Electrocatalytic Generation of Chiral Fumarate Derivatives by Flavocytochrome c3
rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 194
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1y0pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1y0pA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1y0pA03
2B9YA 2WPFA 3AD8B 4H2RA 4JQ9A 1Y0PA 2V5ZA 4K22A 4K2XA 1MOKA 3O0HA 2YLZA 1H84A 1PS9A 5HHFA 3ZYXA 1XANA 1DOBA 2GQWA 3DK8A 3UKLA 3BI2A 1FEAA 3IF9A 3UOYA 3DMEA 4B64A 4OPUA 4C5OA 2WDRA 4JDRA 4U8MA 4IVOB 4J2WA 4OPGA 2BS2A 2I0ZA 3ICTA 1DJQA 3GMCA 2AAQA 2V61A 2RF7A 1EL5A 2YLXA 3F29A 2YG4A 3VR9A 1H82A 1PBBA 3B3RA 3UKFA 2YR4A 1GETA 2V3BA 5GSNA 3AE7A 2ZO5A 2WQYA 1FECA 1GRBA 3BNUA 3C96A 1IUTA 3C4NA 3CGDA 4H4WA 3SFEA 2Q0LA 4IV9A 4B67A 1CJCA 4NTDA 4U2SA 4H4TA 2RGHA 2BS4A 1E1NA 2NPXA 3KD9A 4O5UA 5IQ1A 2VZ2A 4GCMA 2C7GA 5KOWA 3ATRA 2B9XA 3CN8A 1Q1RA 2HQMA 5J7XA 3D8XA 5LV9A 2C3CA 3UKAA 3UOVA 3P4PA 4UDQA 5BRTA 4BK2A 2XDOA 3AB1A 3AE4A 5U25A 4NEVA 4GF7A 1FS7A 3F8RA 3K7QX 1CBOA 2EQ9A 2XVHA 2OA1A 1M1RA 1H81A 4BK3A 1H7XA 2WDQA 2XVIA 2IIDA 5CKUA 4YSYA 4Z2TA 4K8DA 1QLBA 3S61A 1Y56B 1IUVA 4B63A 2YG7A 3UKPA 4C3YA 3GRTA 4YSZA 3UTFA 4Z25A 1GPEA 4UDRA 4GRTA 1M64A 3QVRA 3RHAA 4HA6A 3SCEA 4H7UA 4K5SA 4CNJA 1JEHA 3AE9A 2APGA 4B69A 1TDNA 3URHA 3R9UA 1O94A 4D03A 2ZBWA 4NTEA 2XCGA 4OPLA 1FT5A 3BI5A 1YKJA 2J7AA 1PHHA 5HYMA 2XFUA 2YVJA 1QJDA 4H4XA 4USRA 4ECHA 3AD7B 3VRBA 1PN0A 2R4JA 1GU6A 1M6IA 4P9SA 2RGJA 3LJPA 2B7SA 2WHDA 3KLJA 4EIPA 4ZN0A 1GRHA 2X50A 1B8SA 2GRTA 2XLTA 1YQ4A 4U2LA 1TRBA 4UDPA 1GTHA 1PJ7A 2XVFA 1TDOA 1REOA 2C73A 2YQUA 2B7RA 4WX1A 2QA2A 5GRTA 4CCQA 1CJ2A 3AEAA 1IUSA 3DJGX 4TM1A 3UOZA 3P4SA 1BGNA 3UBRA 1PBDA 2XFNA 4H4SA 3DJJA 4Y4MA 4AOSA 2OLOA 2GMJA 4LU6A 3C4AA 3M13A 2TPRA 3UOXA 2ACZA 1M1PA 4U8LA 3VQRA 4WJYA 3AEBA 3AEFA 5BULA 1OJ9A 3CIRA 2Q7VA 1KSUA 1VDCA 2H88A 2IVEA 3I6DA 4DNAA 2C72A 4CNKA 4B1BA 3UCLA 4XWRA 4BURA 1OJTA 4EQWA 3AYJA 2VVMA 3P1WA 5DBJA 1GXFA 3CGEA 3NG7X 4LIIA 4TM4A 2OT4A 1FT6A 1E6EA 4RSLA 4CY8A 4L3ZA 4EM3A 4FX9A 1KDGA 3V3OA 4D04A 4CY6A 2R45A 1ZK7A 3NK1X 1VG0A 1BVBA 1M1QA 2X3NA 2OLNA 3EF6A 4EMIA 4X9MA 1NHPA 2WPCA 2GV8A 3AE6A 3DJDA 1FL2A 3LZWA 1L0VA 4Q5BA 3GYJA 3FPZA 4JN9A 2ZZBA 2C67A 4X9NA 1SP3A 3K30A 2V6OA 3AE2A 1ZX9A 1ZY8A 5CQFA 1BGJA 4H2NA 1PXCA 4A65A 5M10A 4MJWA 3AE5A 1E1KA 4C74A 3FO3A 1JNIA 2WDVA 2A8XA 4U8KA 5U63A 3EANA 3I3LA 3KKJA 3NLCA 4EIQA 1FOHA 5C3JA 2X99A 3GYIA 4FK1A 1S2YA 2WS3A 4YKGA 3NK2X 4M52A 3NRNA 4GDEA 1GTEA 1N4WA 1GEUA 1RSGA 1ZDLA 3LXDA 3P9UA 1H6VA 5C2TA 2XVJA 4TM0A 1GNDA 4A6NB 1RYIA 1V59A 2VOUA 2EQ8A 3F8DA 3GYXA 4DGKA 3CNDA 2GQFA 1PXBA 1F6MA 3BNMA 3PVCA 2BK5A 1PBFA 2H89A 3SM8A 2BYBA 2BXSA 4A9WA 2E81A 3LOVA 5JCKA 4Q0TA 1PJ6A 2TMDA 3JSKA 1DXLA 2YG5A 4ZCDA 1VQWA 2VVLG 4Z26A 4JY3A 4J36A 4C77A 1PDHA 5KVIA 3L1RA 2XFOA 5EBKA 1B37A 1TYPA 2RDZA 2V60A 4GDPA 1JNRA 5L46A 3SFDA 1LV0A 1H86A 3AE8A 1JRZA 5IPYA 3AECA 3BNJA 1ZMDA 4TLZA 4Q5CA 1NPXA 4BJZA 5BVAA 2GAGB 4I58A 4OPIA 3ICSA 4YTMA 3II4A 2Z5XA 2C65A 1EL8A 3IHMA 3ITJA 4Z2UA 2WOIA 2Q6UA 1ZOVA 2WEUA 4JNQA 4GR1A 3LADA 3IWAA 5U1OA 3RP8A 3KA7A 4BV6A 4H4PA 1KSSA 3SQPA 4AP1A 3NK0X 4YT0A 1F8RA 1JU2A 4L3XA 3E1TA 1NHSA 2JB3A 2GR3A 2VRLA 2VVLA 3CNSA 1QO8A 3GWFA 3OC4A 1D5TA 3REDA 3ALMA 3QFBA 3AE1A 4KX6A 3RKHA 2B9WA 1RP0A 3NYCA 4YXDA 1IUUA 3CPHG 4RG4A 3UTHA 4B65A 4Q17A 1EL7A 2JB2A 4REKA 1CC2A 3H8LA 3L8KA 3UTEA 3HZLA 1XHCA 4CBQA 2E1MA 5ER0A 1CC6A 1DNCA 1L9DA 2BA9A 1D4DA 3P4QA 5FS8A 3H8IA 4U8OA 4L3YA 2C64A 2YWLA 3CGBA 4RG3A 4Z24A 1NHQA 4AT2A 3NT6A 3ATQA 1GOSA 2EQ6A 3QSMA 1NHRA 2W0HA 1L9EA 1DOCA 2J3NA 2YLWA 3H4KA 3UP4A 3WE0A 4FDCB 1F3PA 4U8NA 1HYUA 1JRYA 1CF3A 1IUXA 3NH3X 4TM3A 4AP3A 1ZOYA 2JB1A 4AOXA 4J34A 3OZ2A 1OJCA 4ICYA 2C3DA 1XDIA 1YY5A 2BACA 1FEBA 5J60A 3DK9A 3SXQA 2C70A 2YVFA 3ADAB 3DK4A 1BF3A 2PHHA 1K4QA 4ZCCA 1FS9A 1CC4A 4X4JA 1NEKA 5M0ZA 3F8PA 1TDEA 2LFCA 2R0PA 2AR8A 2WOWA 2FJAA 3AYLA 4EQSA 5FS7A 1K0JA 2XLRA 1EBDA 1S3BA 1H83A 1Z6LA 3NYEA 4NEWA 1OAHA 3D1IA 1N1PA 3G5RA 2XVEA 4EQRA 2E80A 3ABVA 3G5SA 4LA1A 4Z44A 2F5ZA 1P2HA 1GT8A 4H4QA 2YLSA 4ADWA 1E1MA 3CGCA 2A87A 3QJ4A 1GRGA 1GRTA 4FK1C 2XLPA 4CCRA 2R4EA 1ZP0A 1JOAA 2BC1A 2WPEA 1GSNA 1KFYA 3EPTA 4KPRA 4I59A 5JCNA 2CFYA 3QVPA 3OWMA 2VR0A 1F8WA 2GR0A 1NDAA 3CPJG 3K7TA 1F8SA 1Q1WA 1GALA 2BK4A 2C66A 3NTAA 4NZHA 2GEWA 1FCDA 1SEZA 5FMHA 3SGLA 4A7AA 1PBEA 4TLXA 1IUWA 4H2QA 1TDKA 3NTDA 3NYFA 3UKQA 2DKIA 1K0LA 4H4ZA 4H50A 4IVMB 1LTXR 2YG6A 4J56A 1L9CA 2FJDA 3EAOA 3FBSA 3NNEA 2BABA 4APNA 3Q6JA 2XLSA 3K7MX 1CJ3A 1GRAA 2RABA 4YSHA 1KNPA 3BHKA 3RNMA 4OPDA 1DOEA 3FIMB 3CNJA 5TR3A 4EQXA 2EQ7A 5KOXA 5JCLA 3NN6X 3UP5A 2WU5A 4H4RA 1OJDA 1JNZA 1GESA 2GB0A 1N4VA 3COXA 3ISHA 1KNRA 1KF6A 1D4EA 2FJBA 2X8HA 3QSEA 1K0IA 2YLTA 3GDNA 4Z2RA 1CHUA 4NTCA 1B4VA 1GV4A 2XLUA 1MO9A 4U8IA 3AXBA 1S2QA 1H7WA 1MXTA 2WETA 2K3VA 4J33A 4XXGA 3NHOX 1X31B 2Z5YA 3LZXA 2V3AA 2WP5A 1ONFA 4OPTA 1D7LA 4EM4A 3GSIA 3LGQA 2BXRA 2C75A 3IC9A 1AOGA 2DKHA 2QCUA 3VRDB 3CPIG 3V76A 3MMOA 2GVCA 2BCGG 2PYXA 2YG3A 3GRSA 2QA1A 2FJEA 2Y6QA 3GD4A 3QSSA 4J57A 2YLRA 5JCIA 2XYOA 2YAUA 1NG3A 3AWIA 1XPQA 4EMWA 1GREA 2YM2A 3S5WA 4U2TA 2WBAA 4Y4NA 4A99A 4JNAA 4B68A 3UKKA 4YSXA 2ZZCA 5KVHA 2YVGA 2JBVA 3UKHA 3CTYA 3PS9A 3GM6A 3RP6A 1OJAA 5JCMA 2X8CA 3B6DA 1FS8A 3NKSA 4PAAA 1NG4A 4J31A 4OVIA 5EOWA 2RGOA 2VQBA 4O5QA 4XWZA 1BWCA 2CVJA 2CULA 4WCTA 5KWFA 1VRQB 1ELIA 1IJHA 2WOVA 3FMWA 3M0OA 3S7WA 2JAEA 3AEGA 4UP3A 5FS6A 2GR2A 3QFAA 4Y4LA 5KRQA 3ALLA 4L38A 2GR1A 1PBCA 5EB4A 1D7YA 3DGZA 4U8JA 2R0GA 4A6NA 1LQTA 3M12A 1CJ4A 1EL9A 1N4UA 2WP9A 4USQA 5KXJA 3ALJA 4A79A 4H4UA 4Q1OA 4OCGA 2XFQA 2YR6A 1QDBA 3UU9A 4H2PA 4EMJA 2Q0KA 2AQJA 2E5VA 1B5QA 4H4YA 1LJ1A 2A89A 3BHFA 3TTBA 1VG9A 2GAHB 4YTPA 1E39A 2R46A 3NN0X 1BKWA 3P4RA 4BJYA 3UTGA 4PABA 5IQ4A 2WU2A 3L1TA 2NVKX 2YR5A 3LG1A 2XFPA 3ICRA 4CRTA 4DSHA 1JRXA 3NGCX 2CDUA 4YKFA 4N9XA 1YQZA 1E7PA 1P2EA 5EB5A 4K7ZA 4C3XA 3AEDA 1W4XA 3DA1A 4K5RA 1DJNA 4IA5A 4AT0A 1Y56A 2JKCA 2GF3A 4GUVA 4B66A 1GRFA 2GMHA 3KVEA 4DSGA 2C76A 2Y6RA 4A5LA 2YM1A 2WP6A 2IVDA 2BK3A 1LVLA 3AYIA 3GDPA 1Q9IA 2O9ZA 1PXAA 3ZDNA 3V3NA 1TYTA 3AE3A 3KPFA 3AD9B 1CL0A 4HB9A 3DJEA 2FBWA 4H4VA 5HXIA 1S3EA 1NAAA 2R0CA 3CNPA 4BK1A 2BS3A 2VRMA 3CNTA 3BNFA 3RP7A 3T37A 1LQUA 2ZZ0A 3IHGA 3Q9TA 2GH5A 2QAEA 1ZMCA 1O95A 2UZZA 3AEEA 3FG2P 3BI4A 3KU9A 1BZLA 4YWOA 4JY2A 1UKVG 1ZKQA 2BCPA 2OALA 3GMBA 5FS9A 4Q4UA 4IA6A 4OPCA 5HY5A 3BNGA 2WESA 1O5WA 1E1LA 1PJ5A 1D4CA 2VQ7A 2B76A 1TDFA 1GERA 3BNHA 1DODA 2ARDA 3PO7A 1NENA 3D1CA 4E0VA 3LB8A 1COYA 3DH9A 3G5QA 2BC0A 5BUKA 1YQ3A 3NIXA 4U8PA 2R9ZA 2E4GA 3TORA 4Z43A 3VRAA 2X8GA 3GD3A 3GWDA 3VR8A 4YTNA 2OAMA 3DGHA 2JK6A 1LPFA
chains in the Genus database with same CATH superfamily
2B9YA 2WPFA 3AD8B 4H2RA 4JQ9A 1Y0PA 3T2KA 2V5ZA 4K22A 4K2XA 1MOKA 3O0HA 2YLZA 1H84A 1PS9A 5HHFA 3ZYXA 1XANA 1DOBA 2GQWA 3DK8A 3UKLA 3BI2A 1FEAA 3IF9A 3UOYA 3DMEA 4B64A 2BRAA 4OPUA 4C5OA 2WDRA 4JDRA 4U8MA 4IVOB 4J2WA 4OPGA 2BS2A 2I0ZA 3ICTA 1DJQA 3GMCA 2AAQA 2V61A 2RF7A 1EL5A 2YLXA 3F29A 2YG4A 3VR9A 1H82A 1PBBA 3B3RA 3UKFA 2YR4A 1GETA 2V3BA 5GSNA 3AE7A 2ZO5A 2WQYA 1FECA 1GRBA 3BNUA 3C96A 1IUTA 3C4NA 3CGDA 4H4WA 3SFEA 2Q0LA 4IV9A 4B67A 1CJCA 4NTDA 4U2SA 3SZWA 4H4TA 2RGHA 2BS4A 1E1NA 2NPXA 3KD9A 4O5UA 5IQ1A 2VZ2A 4GCMA 2C7GA 5KOWA 3ATRA 2B9XA 3CN8A 1Q1RA 2HQMA 5J7XA 3D8XA 5LV9A 2C3CA 3UKAA 3UOVA 3P4PA 4UDQA 5BRTA 4BK2A 2XDOA 3AB1A 3AE4A 5U25A 4NEVA 4GF7A 1FS7A 3F8RA 3K7QX 1CBOA 2EQ9A 2XVHA 2OA1A 1M1RA 1H81A 4BK3A 1H7XA 2WDQA 2XVIA 2IIDA 5CKUA 4YSYA 4Z2TA 4K8DA 1QLBA 3S61A 1Y56B 1IUVA 4B63A 2YG7A 3UKPA 4C3YA 3GRTA 4YSZA 3UTFA 4Z25A 1GPEA 4UDRA 4GRTA 1M64A 3QVRA 3RHAA 4HA6A 3SCEA 4H7UA 4K5SA 4CNJA 1JEHA 3AE9A 2APGA 4B69A 1TDNA 3URHA 3R9UA 1O94A 4D03A 2ZBWA 4NTEA 2XCGA 4OPLA 1FT5A 3BI5A 1YKJA 2J7AA 1PHHA 5HYMA 2XFUA 2YVJA 1QJDA 4H4XA 4USRA 4ECHA 3AD7B 3VRBA 1PN0A 2R4JA 1GU6A 1M6IA 4P9SA 2RGJA 3LJPA 2B7SA 2WHDA 3KLJA 4EIPA 4ZN0A 1GRHA 2X50A 5KMRA 1B8SA 2GRTA 2XLTA 1YQ4A 4U2LA 1TRBA 4UDPA 1GTHA 5KNLA 1PJ7A 2XVFA 1TDOA 1REOA 2C73A 2YQUA 2B7RA 4WX1A 2QA2A 5GRTA 4CCQA 1CJ2A 3AEAA 1IUSA 3DJGX 4TM1A 3UOZA 3P4SA 1BGNA 3UBRA 1PBDA 2XFNA 4H4SA 3DJJA 4Y4MA 4AOSA 2OLOA 2GMJA 4LU6A 3C4AA 3M13A 2TPRA 3UOXA 2ACZA 1M1PA 4U8LA 3VQRA 4WJYA 3AEBA 3AEFA 5BULA 1OJ9A 3CIRA 2Q7VA 1KSUA 1VDCA 2H88A 2IVEA 3I6DA 4DNAA 2C72A 4CNKA 4B1BA 3UCLA 4XWRA 4BURA 1OJTA 4EQWA 3AYJA 2VVMA 3P1WA 5DBJA 1GXFA 3CGEA 3NG7X 4LIIA 4TM4A 2OT4A 1FT6A 1E6EA 4RSLA 4CY8A 4L3ZA 4EM3A 4FX9A 1KDGA 3V3OA 4D04A 4CY6A 2R45A 1ZK7A 3NK1X 1VG0A 1BVBA 1M1QA 2X3NA 2OLNA 3EF6A 4EMIA 4X9MA 1NHPA 2BRYA 2WPCA 2GV8A 3AE6A 3DJDA 1FL2A 3LZWA 1L0VA 4Q5BA 3GYJA 3FPZA 4JN9A 2ZZBA 2C67A 2CZSA 1SP3A 3K30A 4X9NA 2V6OA 3AE2A 3SX6A 1ZX9A 1ZY8A 5CQFA 1BGJA 4H2NA 1PXCA 4A65A 5M10A 4MJWA 3AE5A 1E1KA 4C74A 3FO3A 1JNIA 2WDVA 2A8XA 4U8KA 5U63A 3EANA 3I3LA 3KKJA 3NLCA 4EIQA 1FOHA 5C3JA 5KMPA 2X99A 4GAVA 3GYIA 4FK1A 1S2YA 2WS3A 4YKGA 3NK2X 4M52A 3NRNA 4GDEA 2C4CA 1GTEA 1N4WA 1GEUA 1RSGA 1ZDLA 3LXDA 3P9UA 1H6VA 5C2TA 2XVJA 4TM0A 1GNDA 4A6NB 1RYIA 1V59A 2VOUA 2EQ8A 3F8DA 3GYXA 4DGKA 3CNDA 2GQFA 1PXBA 1F6MA 3BNMA 3PVCA 2BK5A 1PBFA 2H89A 3SM8A 2BYBA 2BXSA 4A9WA 2E81A 3LOVA 5JCKA 3SZFA 3SY4A 4Q0TA 1PJ6A 2TMDA 3JSKA 1DXLA 2YG5A 4ZCDA 1VQWA 2VVLG 4Z26A 4JY3A 4J36A 4C77A 1PDHA 5KVIA 3L1RA 2XFOA 5EBKA 1B37A 1TYPA 2RDZA 2V60A 4GDPA 1JNRA 5L46A 3SYIA 3SFDA 1LV0A 1H86A 3AE8A 1JRZA 5IPYA 3AECA 3BNJA 4II2A 1ZMDA 4TLZA 4Q5CA 1NPXA 4BJZA 5BVAA 2GAGB 3HYXA 4I58A 3HYWA 4OPIA 3ICSA 4G6HA 4YTMA 3II4A 2Z5XA 2C65A 1EL8A 3IHMA 3ITJA 3SZ0A 4Z2UA 2WOIA 3T0KA 2Q6UA 1ZOVA 2WEUA 4JNQA 4GR1A 3LADA 3IWAA 5U1OA 3RP8A 3KA7A 4BV6A 4H4PA 1KSSA 3SQPA 4AP1A 3NK0X 4YT0A 1F8RA 1JU2A 4L3XA 3E1TA 1NHSA 2JB3A 2GR3A 2VRLA 2VVLA 3CNSA 1QO8A 3GWFA 3OC4A 1D5TA 3REDA 3ALMA 3QFBA 3AE1A 4KX6A 3RKHA 2B9WA 4G74A 1RP0A 3NYCA 4YXDA 1IUUA 3CPHG 4RG4A 3UTHA 4B65A 4Q17A 1EL7A 2JB2A 4REKA 1CC2A 3H8LA 3L8KA 3UTEA 3HZLA 1XHCA 4CBQA 2E1MA 5ER0A 1CC6A 1DNCA 1L9DA 2BA9A 1D4DA 3P4QA 5FS8A 3H8IA 4U8OA 4L3YA 2C64A 2YWLA 3CGBA 4RG3A 4Z24A 1NHQA 4AT2A 3NT6A 3ATQA 1GOSA 2EQ6A 3QSMA 1NHRA 2W0HA 5KMQA 1L9EA 1DOCA 2J3NA 2YLWA 3H4KA 3UP4A 3WE0A 4FDCB 1F3PA 4U8NA 1HYUA 1JRYA 1CF3A 1IUXA 3NH3X 4TM3A 4AP3A 1ZOYA 2JB1A 4AOXA 4J34A 3OZ2A 1OJCA 4ICYA 2C3DA 1XDIA 4G9KA 1YY5A 2BACA 1FEBA 4G73A 5J60A 3DK9A 3SXQA 2C70A 2YVFA 3ADAB 3DK4A 1BF3A 2PHHA 1K4QA 4ZCCA 1FS9A 1CC4A 4X4JA 1NEKA 5M0ZA 3F8PA 1TDEA 2LFCA 2R0PA 2AR8A 2WOWA 2FJAA 3AYLA 4EQSA 5FS7A 1K0JA 2XLRA 1EBDA 1S3BA 1H83A 1Z6LA 3NYEA 4NEWA 1OAHA 3D1IA 1N1PA 3G5RA 2XVEA 4EQRA 2E80A 3ABVA 3G5SA 4LA1A 4Z44A 2F5ZA 1P2HA 1GT8A 4H4QA 2YLSA 4ADWA 1E1MA 3CGCA 2A87A 3QJ4A 1GRGA 1GRTA 4FK1C 2XLPA 4CCRA 2R4EA 1ZP0A 1JOAA 2BC1A 2WPEA 1GSNA 1KFYA 3EPTA 4KPRA 4I59A 5JCNA 2CFYA 3QVPA 3OWMA 2VR0A 1F8WA 2GR0A 1NDAA 3CPJG 3K7TA 1F8SA 1Q1WA 1GALA 2BK4A 2C66A 3NTAA 4NZHA 2GEWA 1FCDA 1SEZA 5FMHA 3SGLA 4A7AA 1PBEA 4TLXA 3T14A 1IUWA 4H2QA 1TDKA 3NTDA 3HYVA 3NYFA 3UKQA 2DKIA 1K0LA 4H4ZA 4H50A 4IVMB 1LTXR 2YG6A 4J56A 1L9CA 2FJDA 3EAOA 3FBSA 3NNEA 2BABA 4APNA 3Q6JA 2XLSA 3K7MX 1CJ3A 1GRAA 2RABA 4YSHA 1KNPA 3BHKA 3RNMA 4OPDA 1DOEA 3FIMB 3CNJA 5TR3A 4EQXA 2EQ7A 3SZCA 5KOXA 5JCLA 3NN6X 3UP5A 2WU5A 4H4RA 1OJDA 1JNZA 1GESA 2GB0A 1N4VA 3COXA 3ISHA 1KNRA 1KF6A 1D4EA 2FJBA 2X8HA 3QSEA 1K0IA 2YLTA 3GDNA 4Z2RA 1CHUA 4NTCA 1B4VA 1GV4A 2XLUA 1MO9A 4U8IA 3AXBA 1S2QA 1H7WA 1MXTA 2WETA 4GAPA 2K3VA 4J33A 4XXGA 3NHOX 1X31B 2Z5YA 3LZXA 2V3AA 2WP5A 1ONFA 4OPTA 1D7LA 4NNJA 4EM4A 3GSIA 3LGQA 2BXRA 2C75A 3IC9A 1AOGA 2DKHA 3SXIA 2QCUA 3VRDB 3CPIG 3V76A 3MMOA 2GVCA 2BCGG 2PYXA 2YG3A 3GRSA 2QA1A 2FJEA 2Y6QA 3GD4A 3QSSA 4J57A 2YLRA 5JCIA 2XYOA 2YAUA 1NG3A 3AWIA 1XPQA 4EMWA 1GREA 2YM2A 3KPKA 4U2TA 3S5WA 2WBAA 4Y4NA 4A99A 3T2ZA 4JNAA 4B68A 3UKKA 4YSXA 2ZZCA 5KVHA 2YVGA 2JBVA 3UKHA 3CTYA 3PS9A 3GM6A 3RP6A 1OJAA 5JCMA 2X8CA 3B6DA 1FS8A 3NKSA 4PAAA 1NG4A 4J31A 4OVIA 5EOWA 2RGOA 2VQBA 4O5QA 4XWZA 1BWCA 2CVJA 2CULA 4WCTA 4G6GA 5KWFA 1VRQB 1ELIA 1IJHA 2WOVA 3FMWA 3M0OA 3S7WA 2JAEA 3AEGA 4UP3A 5FS6A 2GR2A 3QFAA 4Y4LA 5KRQA 3ALLA 4L38A 2GR1A 1PBCA 5EB4A 1D7YA 3DGZA 4U8JA 2R0GA 4A6NA 1LQTA 3M12A 1CJ4A 1EL9A 1N4UA 2WP9A 4USQA 5KXJA 3ALJA 4A79A 4H4UA 4Q1OA 4OCGA 2XFQA 2YR6A 1QDBA 3UU9A 4H2PA 4EMJA 2Q0KA 2AQJA 5KMSA 4NWZA 2E5VA 1B5QA 4H4YA 1LJ1A 2A89A 3BHFA 3TTBA 1VG9A 2GAHB 4YTPA 1E39A 2R46A 3NN0X 1BKWA 3P4RA 4BJYA 3UTGA 4PABA 5IQ4A 2WU2A 3L1TA 2NVKX 2YR5A 3LG1A 2XFPA 3ICRA 4CRTA 4DSHA 1JRXA 3NGCX 2CDUA 4YKFA 4N9XA 1YQZA 1E7PA 1P2EA 5EB5A 4K7ZA 4C3XA 3AEDA 1W4XA 3DA1A 4K5RA 1DJNA 4IA5A 4AT0A 1Y56A 2JKCA 2GF3A 3CMMA 4GUVA 1GRFA 4B66A 2GMHA 3KVEA 4DSGA 2C76A 2Y6RA 4A5LA 2YM1A 2WP6A 2IVDA 2BK3A 1LVLA 3AYIA 4II3A 3GDPA 1Q9IA 2O9ZA 1PXAA 3ZDNA 3V3NA 1TYTA 3AE3A 3KPFA 3AD9B 1CL0A 4HB9A 3DJEA 2FBWA 4H4VA 5HXIA 1S3EA 1NAAA 2R0CA 3CNPA 4BK1A 2BS3A 2VRMA 3T2YA 3CNTA 3BNFA 3RP7A 3T37A 1LQUA 2ZZ0A 3IHGA 3Q9TA 2GH5A 2QAEA 1ZMCA 1O95A 2UZZA 3AEEA 3FG2P 3BI4A 3KU9A 1BZLA 4YWOA 4JY2A 1UKVG 1ZKQA 2BCPA 2OALA 3GMBA 5FS9A 4Q4UA 4IA6A 4OPCA 5HY5A 3BNGA 2WESA 1O5WA 1E1LA 1PJ5A 1D4CA 2VQ7A 2B76A 1TDFA 1GERA 3BNHA 1DODA 2ARDA 3PO7A 1NENA 3D1CA 4E0VA 3LB8A 1COYA 3DH9A 3G5QA 2BC0A 5BUKA 1YQ3A 3NIXA 4U8PA 2R9ZA 2E4GA 3TORA 4Z43A 3VRAA 2X8GA 3GD3A 3GWDA 3VR8A 4YTNA 2OAMA 3T31A 3DGHA 2JK6A 1LPFA
chains in the Genus database with same CATH topology
2B9YA 2WPFA 3AD8B 4H2RA 4JQ9A 1Y0PA 3T2KA 2V5ZA 4K22A 4K2XA 1MOKA 3O0HA 2YLZA 1H84A 1PS9A 5HHFA 3ZYXA 1XANA 1DOBA 2GQWA 3DK8A 3UKLA 3BI2A 1FEAA 3IF9A 3UOYA 3DMEA 4B64A 2BRAA 4OPUA 4C5OA 2WDRA 4JDRA 4U8MA 4IVOB 4J2WA 4OPGA 2BS2A 2I0ZA 3ICTA 1DJQA 3GMCA 2AAQA 2V61A 2RF7A 1EL5A 2YLXA 3F29A 2YG4A 3VR9A 1H82A 1PBBA 3B3RA 3UKFA 2YR4A 1GETA 2V3BA 5GSNA 3AE7A 2ZO5A 2WQYA 1FECA 1GRBA 3BNUA 3C96A 1IUTA 3C4NA 3CGDA 4H4WA 3SFEA 2Q0LA 4IV9A 4B67A 1CJCA 4NTDA 4U2SA 3SZWA 4H4TA 2RGHA 2BS4A 1E1NA 2NPXA 3KD9A 4O5UA 5IQ1A 2VZ2A 4GCMA 2C7GA 5KOWA 3ATRA 2B9XA 3CN8A 1Q1RA 2HQMA 5J7XA 3D8XA 5LV9A 2C3CA 3UKAA 3UOVA 3P4PA 4UDQA 5BRTA 4BK2A 2XDOA 3AB1A 3AE4A 5U25A 4NEVA 4GF7A 1FS7A 3F8RA 3K7QX 1CBOA 2EQ9A 2XVHA 2OA1A 1M1RA 1H81A 4BK3A 1H7XA 2WDQA 2XVIA 2IIDA 5CKUA 4YSYA 4Z2TA 4K8DA 1QLBA 3S61A 1Y56B 1IUVA 4B63A 2YG7A 3UKPA 4C3YA 3GRTA 4YSZA 3UTFA 4Z25A 1GPEA 4UDRA 4GRTA 1M64A 3QVRA 3RHAA 4HA6A 3SCEA 4H7UA 4K5SA 4CNJA 1JEHA 3AE9A 2APGA 4B69A 1TDNA 3URHA 3R9UA 1O94A 4D03A 2ZBWA 4NTEA 2XCGA 4OPLA 1FT5A 3BI5A 1YKJA 2J7AA 1PHHA 5HYMA 2XFUA 2YVJA 1QJDA 4H4XA 4USRA 4ECHA 3AD7B 3VRBA 1PN0A 2R4JA 1GU6A 1M6IA 4P9SA 2RGJA 3LJPA 2B7SA 2WHDA 3KLJA 4EIPA 4ZN0A 1GRHA 2X50A 5KMRA 1B8SA 2GRTA 2XLTA 1YQ4A 4U2LA 1TRBA 4UDPA 1GTHA 5KNLA 1PJ7A 2XVFA 1TDOA 1REOA 2C73A 2YQUA 2B7RA 4WX1A 2QA2A 5GRTA 4CCQA 1CJ2A 3AEAA 1IUSA 3DJGX 4TM1A 3UOZA 3P4SA 1BGNA 3UBRA 1PBDA 2XFNA 4H4SA 3DJJA 4Y4MA 4AOSA 2OLOA 2GMJA 4LU6A 3C4AA 3M13A 2TPRA 3UOXA 2ACZA 1M1PA 4U8LA 3VQRA 4WJYA 3AEBA 3AEFA 5BULA 1OJ9A 3CIRA 2Q7VA 1KSUA 1VDCA 2H88A 2IVEA 3I6DA 4DNAA 2C72A 4CNKA 4B1BA 3UCLA 4XWRA 4BURA 1OJTA 4EQWA 3AYJA 2VVMA 3P1WA 5DBJA 1GXFA 3CGEA 3NG7X 4LIIA 4TM4A 2OT4A 1FT6A 1E6EA 4RSLA 4CY8A 4L3ZA 4EM3A 4FX9A 1KDGA 3V3OA 4D04A 4CY6A 2R45A 1ZK7A 3NK1X 1VG0A 1BVBA 1M1QA 2X3NA 2OLNA 3EF6A 4EMIA 4X9MA 1NHPA 2BRYA 2WPCA 2GV8A 3AE6A 3DJDA 1FL2A 3LZWA 1L0VA 4Q5BA 3GYJA 3FPZA 4JN9A 2ZZBA 2C67A 4X9NA 1SP3A 3K30A 2V6OA 3AE2A 3SX6A 1ZX9A 1ZY8A 5CQFA 1BGJA 4H2NA 1PXCA 4A65A 5M10A 4MJWA 3AE5A 1E1KA 4C74A 3FO3A 1JNIA 2WDVA 2A8XA 4U8KA 5U63A 3EANA 3I3LA 3KKJA 3NLCA 4EIQA 1FOHA 5C3JA 5KMPA 2X99A 4GAVA 3GYIA 4FK1A 1S2YA 2WS3A 4YKGA 3NK2X 4M52A 3NRNA 4GDEA 2C4CA 1GTEA 1N4WA 1GEUA 1RSGA 1ZDLA 3LXDA 3P9UA 1H6VA 5C2TA 2XVJA 4TM0A 1GNDA 4A6NB 1RYIA 1V59A 2VOUA 2EQ8A 3F8DA 3GYXA 4DGKA 3CNDA 2GQFA 1PXBA 1F6MA 3BNMA 3PVCA 2BK5A 1PBFA 2H89A 3SM8A 2BYBA 2BXSA 4A9WA 2E81A 3LOVA 5JCKA 3SZFA 3SY4A 4Q0TA 1PJ6A 2TMDA 3JSKA 1DXLA 2YG5A 4ZCDA 1VQWA 2VVLG 4Z26A 4JY3A 4J36A 4C77A 1PDHA 5KVIA 3L1RA 2XFOA 5EBKA 1B37A 1TYPA 2RDZA 2V60A 4GDPA 1JNRA 5L46A 3SYIA 3SFDA 1LV0A 1H86A 3AE8A 1JRZA 5IPYA 3AECA 3BNJA 4II2A 1ZMDA 4TLZA 4Q5CA 1NPXA 4BJZA 5BVAA 2GAGB 3HYXA 4I58A 3HYWA 4OPIA 3ICSA 4G6HA 4YTMA 3II4A 2Z5XA 2C65A 1EL8A 3IHMA 3ITJA 3SZ0A 4Z2UA 2WOIA 3T0KA 2Q6UA 1ZOVA 2WEUA 4JNQA 4GR1A 3LADA 3IWAA 5U1OA 3RP8A 3KA7A 4BV6A 4H4PA 1KSSA 3SQPA 4AP1A 3NK0X 4YT0A 1F8RA 1JU2A 4L3XA 3E1TA 1NHSA 2JB3A 2GR3A 2VRLA 2VVLA 3CNSA 1QO8A 3GWFA 3OC4A 1D5TA 3REDA 3ALMA 3QFBA 3AE1A 4KX6A 3RKHA 2B9WA 4G74A 1RP0A 3NYCA 4YXDA 1IUUA 3CPHG 4RG4A 3UTHA 4B65A 4Q17A 1EL7A 2JB2A 4REKA 1CC2A 3H8LA 3L8KA 3UTEA 3HZLA 1XHCA 4CBQA 2E1MA 5ER0A 1CC6A 1DNCA 1L9DA 2BA9A 1D4DA 3P4QA 5FS8A 3H8IA 4U8OA 4L3YA 2C64A 2YWLA 3CGBA 4RG3A 4Z24A 1NHQA 4AT2A 3NT6A 3ATQA 1GOSA 2EQ6A 3QSMA 1NHRA 2W0HA 5KMQA 1L9EA 1DOCA 2J3NA 2YLWA 3H4KA 3UP4A 3WE0A 4FDCB 1F3PA 4U8NA 1HYUA 1JRYA 1CF3A 1IUXA 3NH3X 4TM3A 4AP3A 1ZOYA 2JB1A 4AOXA 4J34A 3OZ2A 1OJCA 4ICYA 2C3DA 1XDIA 4G9KA 1YY5A 2BACA 1FEBA 4G73A 5J60A 3DK9A 3SXQA 2C70A 2YVFA 3ADAB 3DK4A 1BF3A 2PHHA 1K4QA 4ZCCA 1FS9A 1CC4A 4X4JA 1NEKA 5M0ZA 3F8PA 1TDEA 2LFCA 2R0PA 2AR8A 2WOWA 2FJAA 3AYLA 4EQSA 5FS7A 1K0JA 2XLRA 1EBDA 1S3BA 1H83A 1Z6LA 3NYEA 4NEWA 1OAHA 3D1IA 1N1PA 3G5RA 2XVEA 4EQRA 2E80A 3ABVA 3G5SA 4LA1A 4Z44A 2F5ZA 1P2HA 1GT8A 4H4QA 2YLSA 4ADWA 1E1MA 3CGCA 2A87A 3QJ4A 1GRGA 1GRTA 4FK1C 2XLPA 4CCRA 2R4EA 1ZP0A 1JOAA 2BC1A 2WPEA 1GSNA 1KFYA 3EPTA 4KPRA 4I59A 5JCNA 2CFYA 3QVPA 3OWMA 2VR0A 1F8WA 2GR0A 1NDAA 3CPJG 3K7TA 1F8SA 1Q1WA 1GALA 2BK4A 2C66A 3NTAA 4NZHA 2GEWA 1FCDA 1SEZA 5FMHA 3SGLA 4A7AA 1PBEA 4TLXA 3T14A 1IUWA 4H2QA 1TDKA 3NTDA 3HYVA 3NYFA 3UKQA 2DKIA 1K0LA 4H4ZA 4H50A 4IVMB 1LTXR 2YG6A 4J56A 1L9CA 2FJDA 3EAOA 3FBSA 3NNEA 2BABA 4APNA 3Q6JA 2XLSA 3K7MX 1CJ3A 1GRAA 2RABA 4YSHA 1KNPA 3BHKA 3RNMA 4OPDA 1DOEA 3FIMB 3CNJA 5TR3A 4EQXA 2EQ7A 3SZCA 5KOXA 5JCLA 3NN6X 3UP5A 2WU5A 4H4RA 1OJDA 1JNZA 1GESA 2GB0A 1N4VA 3COXA 3ISHA 1KNRA 1KF6A 1D4EA 2FJBA 2X8HA 3QSEA 1K0IA 2YLTA 3GDNA 4Z2RA 1CHUA 4NTCA 1B4VA 1GV4A 2XLUA 1MO9A 4U8IA 3AXBA 1S2QA 1H7WA 1MXTA 2WETA 4GAPA 2K3VA 4J33A 4XXGA 3NHOX 1X31B 2Z5YA 3LZXA 2V3AA 2WP5A 1ONFA 4OPTA 1D7LA 4NNJA 4EM4A 3GSIA 3LGQA 2BXRA 2C75A 3IC9A 1AOGA 2DKHA 3SXIA 2QCUA 3VRDB 3CPIG 3V76A 3MMOA 2GVCA 2BCGG 2PYXA 2YG3A 3GRSA 2QA1A 2FJEA 2Y6QA 3GD4A 3QSSA 4J57A 2YLRA 5JCIA 2XYOA 2YAUA 1NG3A 3AWIA 1XPQA 4EMWA 1GREA 2YM2A 3KPKA 4U2TA 3S5WA 2WBAA 4Y4NA 4A99A 3T2ZA 4JNAA 4B68A 3UKKA 4YSXA 2ZZCA 5KVHA 2YVGA 2JBVA 3UKHA 3CTYA 3PS9A 3GM6A 3RP6A 1OJAA 5JCMA 2X8CA 3B6DA 1FS8A 3NKSA 4PAAA 1NG4A 4J31A 4OVIA 5EOWA 2RGOA 2VQBA 4O5QA 4XWZA 1BWCA 2CVJA 2CULA 4WCTA 4G6GA 5KWFA 1VRQB 1ELIA 1IJHA 2WOVA 3FMWA 3M0OA 3S7WA 2JAEA 3AEGA 4UP3A 5FS6A 2GR2A 3QFAA 4Y4LA 5KRQA 3ALLA 4L38A 2GR1A 1PBCA 5EB4A 1D7YA 3DGZA 4U8JA 2R0GA 4A6NA 1LQTA 3M12A 1CJ4A 1EL9A 1N4UA 2WP9A 4USQA 5KXJA 3ALJA 4A79A 4H4UA 4Q1OA 4OCGA 2XFQA 2YR6A 1QDBA 3UU9A 4H2PA 4EMJA 2Q0KA 2AQJA 5KMSA 4NWZA 2E5VA 1B5QA 4H4YA 1LJ1A 2A89A 3BHFA 3TTBA 1VG9A 2GAHB 4YTPA 1E39A 2R46A 3NN0X 1BKWA 3P4RA 4BJYA 3UTGA 4PABA 5IQ4A 2WU2A 3L1TA 2NVKX 2YR5A 3LG1A 2XFPA 3ICRA 4CRTA 4DSHA 1JRXA 3NGCX 2CDUA 4YKFA 4N9XA 1YQZA 1E7PA 1P2EA 5EB5A 4K7ZA 4C3XA 3AEDA 1W4XA 3DA1A 4K5RA 1DJNA 4IA5A 4AT0A 1Y56A 2JKCA 2GF3A 3CMMA 4GUVA 1GRFA 4B66A 2GMHA 3KVEA 4DSGA 2C76A 2Y6RA 4A5LA 2YM1A 2WP6A 2IVDA 2BK3A 1LVLA 3AYIA 4II3A 3GDPA 1Q9IA 2O9ZA 1PXAA 3ZDNA 3V3NA 1TYTA 3AE3A 3KPFA 3AD9B 1CL0A 4HB9A 3DJEA 2FBWA 4H4VA 5HXIA 1S3EA 1NAAA 2R0CA 3CNPA 4BK1A 2BS3A 2VRMA 3T2YA 3CNTA 3BNFA 3RP7A 3T37A 1LQUA 2ZZ0A 3IHGA 3Q9TA 2GH5A 2QAEA 1ZMCA 1O95A 2UZZA 3AEEA 3FG2P 3BI4A 3KU9A 1BZLA 4YWOA 4JY2A 1UKVG 1ZKQA 2BCPA 2OALA 3GMBA 5FS9A 4Q4UA 4IA6A 4OPCA 5HY5A 3BNGA 2WESA 1O5WA 1E1LA 1PJ5A 1D4CA 2VQ7A 2B76A 1TDFA 1GERA 3BNHA 1DODA 2ARDA 3PO7A 1NENA 3D1CA 4E0VA 3LB8A 1COYA 3DH9A 3G5QA 2BC0A 5BUKA 1YQ3A 3NIXA 4U8PA 2R9ZA 2E4GA 3TORA 4Z43A 3VRAA 2X8GA 3GD3A 3GWDA 3VR8A 4YTNA 2OAMA 3T31A 3DGHA 2JK6A 1LPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9Y A;  2WPF A;  3AD8 B;  4H2R A;  4JQ9 A;  1Y0P A;  2V5Z A;  4K22 A;  4K2X A;  1MOK A;  3O0H A;  2YLZ A;  1H84 A;  1PS9 A;  5HHF A;  3ZYX A;  1XAN A;  1DOB A;  2GQW A;  3DK8 A;  3UKL A;  3BI2 A;  1FEA A;  3IF9 A;  3UOY A;  3DME A;  4B64 A;  4OPU A;  4C5O A;  2WDR A;  4JDR A;  4U8M A;  4IVO B;  4J2W A;  4OPG A;  2BS2 A;  2I0Z A;  3ICT A;  1DJQ A;  3GMC A;  2AAQ A;  2V61 A;  2RF7 A;  1EL5 A;  2YLX A;  3F29 A;  2YG4 A;  3VR9 A;  1H82 A;  1PBB A;  3B3R A;  3UKF A;  2YR4 A;  1GET A;  2V3B A;  5GSN A;  3AE7 A;  2ZO5 A;  2WQY A;  1FEC A;  1GRB A;  3BNU A;  3C96 A;  1IUT A;  3C4N A;  3CGD A;  4H4W A;  3SFE A;  2Q0L A;  4IV9 A;  4B67 A;  1CJC A;  4NTD A;  4U2S A;  4H4T A;  2RGH A;  2BS4 A;  1E1N A;  2NPX A;  3KD9 A;  4O5U A;  5IQ1 A;  2VZ2 A;  4GCM A;  2C7G A;  5KOW A;  3ATR A;  2B9X A;  3CN8 A;  1Q1R A;  2HQM A;  5J7X A;  3D8X A;  5LV9 A;  2C3C A;  3UKA A;  3UOV A;  3P4P A;  4UDQ A;  5BRT A;  4BK2 A;  2XDO A;  3AB1 A;  3AE4 A;  5U25 A;  4NEV A;  4GF7 A;  1FS7 A;  3F8R A;  3K7Q X;  1CBO A;  2EQ9 A;  2XVH A;  2OA1 A;  1M1R A;  1H81 A;  4BK3 A;  1H7X A;  2WDQ A;  2XVI A;  2IID A;  5CKU A;  4YSY A;  4Z2T A;  4K8D A;  1QLB A;  3S61 A;  1Y56 B;  1IUV A;  4B63 A;  2YG7 A;  3UKP A;  4C3Y A;  3GRT A;  4YSZ A;  3UTF A;  4Z25 A;  1GPE A;  4UDR A;  4GRT A;  1M64 A;  3QVR A;  3RHA A;  4HA6 A;  3SCE A;  4H7U A;  4K5S A;  4CNJ A;  1JEH A;  3AE9 A;  2APG A;  4B69 A;  1TDN A;  3URH A;  3R9U A;  1O94 A;  4D03 A;  2ZBW A;  4NTE A;  2XCG A;  4OPL A;  1FT5 A;  3BI5 A;  1YKJ A;  2J7A A;  1PHH A;  5HYM A;  2XFU A;  2YVJ A;  1QJD A;  4H4X A;  4USR A;  4ECH A;  3AD7 B;  3VRB A;  1PN0 A;  2R4J A;  1GU6 A;  1M6I A;  4P9S A;  2RGJ A;  3LJP A;  2B7S A;  2WHD A;  3KLJ A;  4EIP A;  4ZN0 A;  1GRH A;  2X50 A;  1B8S A;  2GRT A;  2XLT A;  1YQ4 A;  4U2L A;  1TRB A;  4UDP A;  1GTH A;  1PJ7 A;  2XVF A;  1TDO A;  1REO A;  2C73 A;  2YQU A;  2B7R A;  4WX1 A;  2QA2 A;  5GRT A;  4CCQ A;  1CJ2 A;  3AEA A;  1IUS A;  3DJG X;  4TM1 A;  3UOZ A;  3P4S A;  1BGN A;  3UBR A;  1PBD A;  2XFN A;  4H4S A;  3DJJ A;  4Y4M A;  4AOS A;  2OLO A;  2GMJ A;  4LU6 A;  3C4A A;  3M13 A;  2TPR A;  3UOX A;  2ACZ A;  1M1P A;  4U8L A;  3VQR A;  4WJY A;  3AEB A;  3AEF A;  5BUL A;  1OJ9 A;  3CIR A;  2Q7V A;  1KSU A;  1VDC A;  2H88 A;  2IVE A;  3I6D A;  4DNA A;  2C72 A;  4CNK A;  4B1B A;  3UCL A;  4XWR A;  4BUR A;  1OJT A;  4EQW A;  3AYJ A;  2VVM A;  3P1W A;  5DBJ A;  1GXF A;  3CGE A;  3NG7 X;  4LII A;  4TM4 A;  2OT4 A;  1FT6 A;  1E6E A;  4RSL A;  4CY8 A;  4L3Z A;  4EM3 A;  4FX9 A;  1KDG A;  3V3O A;  4D04 A;  4CY6 A;  2R45 A;  1ZK7 A;  3NK1 X;  1VG0 A;  1BVB A;  1M1Q A;  2X3N A;  2OLN A;  3EF6 A;  4EMI A;  4X9M A;  1NHP A;  2WPC A;  2GV8 A;  3AE6 A;  3DJD A;  1FL2 A;  3LZW A;  1L0V A;  4Q5B A;  3GYJ A;  3FPZ A;  4JN9 A;  2ZZB A;  2C67 A;  4X9N A;  1SP3 A;  3K30 A;  2V6O A;  3AE2 A;  1ZX9 A;  1ZY8 A;  5CQF A;  1BGJ A;  4H2N A;  1PXC A;  4A65 A;  5M10 A;  4MJW A;  3AE5 A;  1E1K A;  4C74 A;  3FO3 A;  1JNI A;  2WDV A;  2A8X A;  4U8K A;  5U63 A;  3EAN A;  3I3L A;  3KKJ A;  3NLC A;  4EIQ A;  1FOH A;  5C3J A;  2X99 A;  3GYI A;  4FK1 A;  1S2Y A;  2WS3 A;  4YKG A;  3NK2 X;  4M52 A;  3NRN A;  4GDE A;  1GTE A;  1N4W A;  1GEU A;  1RSG A;  1ZDL A;  3LXD A;  3P9U A;  1H6V A;  5C2T A;  2XVJ A;  4TM0 A;  1GND A;  4A6N B;  1RYI A;  1V59 A;  2VOU A;  2EQ8 A;  3F8D A;  3GYX A;  4DGK A;  3CND A;  2GQF A;  1PXB A;  1F6M A;  3BNM A;  3PVC A;  2BK5 A;  1PBF A;  2H89 A;  3SM8 A;  2BYB A;  2BXS A;  4A9W A;  2E81 A;  3LOV A;  5JCK A;  4Q0T A;  1PJ6 A;  2TMD A;  3JSK A;  1DXL A;  2YG5 A;  4ZCD A;  1VQW A;  2VVL G;  4Z26 A;  4JY3 A;  4J36 A;  4C77 A;  1PDH A;  5KVI A;  3L1R A;  2XFO A;  5EBK A;  1B37 A;  1TYP A;  2RDZ A;  2V60 A;  4GDP A;  1JNR A;  5L46 A;  3SFD A;  1LV0 A;  1H86 A;  3AE8 A;  1JRZ A;  5IPY A;  3AEC A;  3BNJ A;  1ZMD A;  4TLZ A;  4Q5C A;  1NPX A;  4BJZ A;  5BVA A;  2GAG B;  4I58 A;  4OPI A;  3ICS A;  4YTM A;  3II4 A;  2Z5X A;  2C65 A;  1EL8 A;  3IHM A;  3ITJ A;  4Z2U A;  2WOI A;  2Q6U A;  1ZOV A;  2WEU A;  4JNQ A;  4GR1 A;  3LAD A;  3IWA A;  5U1O A;  3RP8 A;  3KA7 A;  4BV6 A;  4H4P A;  1KSS A;  3SQP A;  4AP1 A;  3NK0 X;  4YT0 A;  1F8R A;  1JU2 A;  4L3X A;  3E1T A;  1NHS A;  2JB3 A;  2GR3 A;  2VRL A;  2VVL A;  3CNS A;  1QO8 A;  3GWF A;  3OC4 A;  1D5T A;  3RED A;  3ALM A;  3QFB A;  3AE1 A;  4KX6 A;  3RKH A;  2B9W A;  1RP0 A;  3NYC A;  4YXD A;  1IUU A;  3CPH G;  4RG4 A;  3UTH A;  4B65 A;  4Q17 A;  1EL7 A;  2JB2 A;  4REK A;  1CC2 A;  3H8L A;  3L8K A;  3UTE A;  3HZL A;  1XHC A;  4CBQ A;  2E1M A;  5ER0 A;  1CC6 A;  1DNC A;  1L9D A;  2BA9 A;  1D4D A;  3P4Q A;  5FS8 A;  3H8I A;  4U8O A;  4L3Y A;  2C64 A;  2YWL A;  3CGB A;  4RG3 A;  4Z24 A;  1NHQ A;  4AT2 A;  3NT6 A;  3ATQ A;  1GOS A;  2EQ6 A;  3QSM A;  1NHR A;  2W0H A;  1L9E A;  1DOC A;  2J3N A;  2YLW A;  3H4K A;  3UP4 A;  3WE0 A;  4FDC B;  1F3P A;  4U8N A;  1HYU A;  1JRY A;  1CF3 A;  1IUX A;  3NH3 X;  4TM3 A;  4AP3 A;  1ZOY A;  2JB1 A;  4AOX A;  4J34 A;  3OZ2 A;  1OJC A;  4ICY A;  2C3D A;  1XDI A;  1YY5 A;  2BAC A;  1FEB A;  5J60 A;  3DK9 A;  3SXQ A;  2C70 A;  2YVF A;  3ADA B;  3DK4 A;  1BF3 A;  2PHH A;  1K4Q A;  4ZCC A;  1FS9 A;  1CC4 A;  4X4J A;  1NEK A;  5M0Z A;  3F8P A;  1TDE A;  2LFC A;  2R0P A;  2AR8 A;  2WOW A;  2FJA A;  3AYL A;  4EQS A;  5FS7 A;  1K0J A;  2XLR A;  1EBD A;  1S3B A;  1H83 A;  1Z6L A;  3NYE A;  4NEW A;  1OAH A;  3D1I A;  1N1P A;  3G5R A;  2XVE A;  4EQR A;  2E80 A;  3ABV A;  3G5S A;  4LA1 A;  4Z44 A;  2F5Z A;  1P2H A;  1GT8 A;  4H4Q A;  2YLS A;  4ADW A;  1E1M A;  3CGC A;  2A87 A;  3QJ4 A;  1GRG A;  1GRT A;  4FK1 C;  2XLP A;  4CCR A;  2R4E A;  1ZP0 A;  1JOA A;  2BC1 A;  2WPE A;  1GSN A;  1KFY A;  3EPT A;  4KPR A;  4I59 A;  5JCN A;  2CFY A;  3QVP A;  3OWM A;  2VR0 A;  1F8W A;  2GR0 A;  1NDA A;  3CPJ G;  3K7T A;  1F8S A;  1Q1W A;  1GAL A;  2BK4 A;  2C66 A;  3NTA A;  4NZH A;  2GEW A;  1FCD A;  1SEZ A;  5FMH A;  3SGL A;  4A7A A;  1PBE A;  4TLX A;  1IUW A;  4H2Q A;  1TDK A;  3NTD A;  3NYF A;  3UKQ A;  2DKI A;  1K0L A;  4H4Z A;  4H50 A;  4IVM B;  1LTX R;  2YG6 A;  4J56 A;  1L9C A;  2FJD A;  3EAO A;  3FBS A;  3NNE A;  2BAB A;  4APN A;  3Q6J A;  2XLS A;  3K7M X;  1CJ3 A;  1GRA A;  2RAB A;  4YSH A;  1KNP A;  3BHK A;  3RNM A;  4OPD A;  1DOE A;  3FIM B;  3CNJ A;  5TR3 A;  4EQX A;  2EQ7 A;  5KOX A;  5JCL A;  3NN6 X;  3UP5 A;  2WU5 A;  4H4R A;  1OJD A;  1JNZ A;  1GES A;  2GB0 A;  1N4V A;  3COX A;  3ISH A;  1KNR A;  1KF6 A;  1D4E A;  2FJB A;  2X8H A;  3QSE A;  1K0I A;  2YLT A;  3GDN A;  4Z2R A;  1CHU A;  4NTC A;  1B4V A;  1GV4 A;  2XLU A;  1MO9 A;  4U8I A;  3AXB A;  1S2Q A;  1H7W A;  1MXT A;  2WET A;  2K3V A;  4J33 A;  4XXG A;  3NHO X;  1X31 B;  2Z5Y A;  3LZX A;  2V3A A;  2WP5 A;  1ONF A;  4OPT A;  1D7L A;  4EM4 A;  3GSI A;  3LGQ A;  2BXR A;  2C75 A;  3IC9 A;  1AOG A;  2DKH A;  2QCU A;  3VRD B;  3CPI G;  3V76 A;  3MMO A;  2GVC A;  2BCG G;  2PYX A;  2YG3 A;  3GRS A;  2QA1 A;  2FJE A;  2Y6Q A;  3GD4 A;  3QSS A;  4J57 A;  2YLR A;  5JCI A;  2XYO A;  2YAU A;  1NG3 A;  3AWI A;  1XPQ A;  4EMW A;  1GRE A;  2YM2 A;  3S5W A;  4U2T A;  2WBA A;  4Y4N A;  4A99 A;  4JNA A;  4B68 A;  3UKK A;  4YSX A;  2ZZC A;  5KVH A;  2YVG A;  2JBV A;  3UKH A;  3CTY A;  3PS9 A;  3GM6 A;  3RP6 A;  1OJA A;  5JCM A;  2X8C A;  3B6D A;  1FS8 A;  3NKS A;  4PAA A;  1NG4 A;  4J31 A;  4OVI A;  5EOW A;  2RGO A;  2VQB A;  4O5Q A;  4XWZ A;  1BWC A;  2CVJ A;  2CUL A;  4WCT A;  5KWF A;  1VRQ B;  1ELI A;  1IJH A;  2WOV A;  3FMW A;  3M0O A;  3S7W A;  2JAE A;  3AEG A;  4UP3 A;  5FS6 A;  2GR2 A;  3QFA A;  4Y4L A;  5KRQ A;  3ALL A;  4L38 A;  2GR1 A;  1PBC A;  5EB4 A;  1D7Y A;  3DGZ A;  4U8J A;  2R0G A;  4A6N A;  1LQT A;  3M12 A;  1CJ4 A;  1EL9 A;  1N4U A;  2WP9 A;  4USQ A;  5KXJ A;  3ALJ A;  4A79 A;  4H4U A;  4Q1O A;  4OCG A;  2XFQ A;  2YR6 A;  1QDB A;  3UU9 A;  4H2P A;  4EMJ A;  2Q0K A;  2AQJ A;  2E5V A;  1B5Q A;  4H4Y A;  1LJ1 A;  2A89 A;  3BHF A;  3TTB A;  1VG9 A;  2GAH B;  4YTP A;  1E39 A;  2R46 A;  3NN0 X;  1BKW A;  3P4R A;  4BJY A;  3UTG A;  4PAB A;  5IQ4 A;  2WU2 A;  3L1T A;  2NVK X;  2YR5 A;  3LG1 A;  2XFP A;  3ICR A;  4CRT A;  4DSH A;  1JRX A;  3NGC X;  2CDU A;  4YKF A;  4N9X A;  1YQZ A;  1E7P A;  1P2E A;  5EB5 A;  4K7Z A;  4C3X A;  3AED A;  1W4X A;  3DA1 A;  4K5R A;  1DJN A;  4IA5 A;  4AT0 A;  1Y56 A;  2JKC A;  2GF3 A;  4GUV A;  4B66 A;  1GRF A;  2GMH A;  3KVE A;  4DSG A;  2C76 A;  2Y6R A;  4A5L A;  2YM1 A;  2WP6 A;  2IVD A;  2BK3 A;  1LVL A;  3AYI A;  3GDP A;  1Q9I A;  2O9Z A;  1PXA A;  3ZDN A;  3V3N A;  1TYT A;  3AE3 A;  3KPF A;  3AD9 B;  1CL0 A;  4HB9 A;  3DJE A;  2FBW A;  4H4V A;  5HXI A;  1S3E A;  1NAA A;  2R0C A;  3CNP A;  4BK1 A;  2BS3 A;  2VRM A;  3CNT A;  3BNF A;  3RP7 A;  3T37 A;  1LQU A;  2ZZ0 A;  3IHG A;  3Q9T A;  2GH5 A;  2QAE A;  1ZMC A;  1O95 A;  2UZZ A;  3AEE A;  3FG2 P;  3BI4 A;  3KU9 A;  1BZL A;  4YWO A;  4JY2 A;  1UKV G;  1ZKQ A;  2BCP A;  2OAL A;  3GMB A;  5FS9 A;  4Q4U A;  4IA6 A;  4OPC A;  5HY5 A;  3BNG A;  2WES A;  1O5W A;  1E1L A;  1PJ5 A;  1D4C A;  2VQ7 A;  2B76 A;  1TDF A;  1GER A;  3BNH A;  1DOD A;  2ARD A;  3PO7 A;  1NEN A;  3D1C A;  4E0V A;  3LB8 A;  1COY A;  3DH9 A;  3G5Q A;  2BC0 A;  5BUK A;  1YQ3 A;  3NIX A;  4U8P A;  2R9Z A;  2E4G A;  3TOR A;  4Z43 A;  3VRA A;  2X8G A;  3GD3 A;  3GWD A;  3VR8 A;  4YTN A;  2OAM A;  3DGH A;  2JK6 A;  1LPF A; 
#chains in the Genus database with same CATH topology
 2B9Y A;  2WPF A;  3AD8 B;  4H2R A;  4JQ9 A;  1Y0P A;  3T2K A;  2V5Z A;  4K22 A;  4K2X A;  1MOK A;  3O0H A;  2YLZ A;  1H84 A;  1PS9 A;  5HHF A;  3ZYX A;  1XAN A;  1DOB A;  2GQW A;  3DK8 A;  3UKL A;  3BI2 A;  1FEA A;  3IF9 A;  3UOY A;  3DME A;  4B64 A;  2BRA A;  4OPU A;  4C5O A;  2WDR A;  4JDR A;  4U8M A;  4IVO B;  4J2W A;  4OPG A;  2BS2 A;  2I0Z A;  3ICT A;  1DJQ A;  3GMC A;  2AAQ A;  2V61 A;  2RF7 A;  1EL5 A;  2YLX A;  3F29 A;  2YG4 A;  3VR9 A;  1H82 A;  1PBB A;  3B3R A;  3UKF A;  2YR4 A;  1GET A;  2V3B A;  5GSN A;  3AE7 A;  2ZO5 A;  2WQY A;  1FEC A;  1GRB A;  3BNU A;  3C96 A;  1IUT A;  3C4N A;  3CGD A;  4H4W A;  3SFE A;  2Q0L A;  4IV9 A;  4B67 A;  1CJC A;  4NTD A;  4U2S A;  3SZW A;  4H4T A;  2RGH A;  2BS4 A;  1E1N A;  2NPX A;  3KD9 A;  4O5U A;  5IQ1 A;  2VZ2 A;  4GCM A;  2C7G A;  5KOW A;  3ATR A;  2B9X A;  3CN8 A;  1Q1R A;  2HQM A;  5J7X A;  3D8X A;  5LV9 A;  2C3C A;  3UKA A;  3UOV A;  3P4P A;  4UDQ A;  5BRT A;  4BK2 A;  2XDO A;  3AB1 A;  3AE4 A;  5U25 A;  4NEV A;  4GF7 A;  1FS7 A;  3F8R A;  3K7Q X;  1CBO A;  2EQ9 A;  2XVH A;  2OA1 A;  1M1R A;  1H81 A;  4BK3 A;  1H7X A;  2WDQ A;  2XVI A;  2IID A;  5CKU A;  4YSY A;  4Z2T A;  4K8D A;  1QLB A;  3S61 A;  1Y56 B;  1IUV A;  4B63 A;  2YG7 A;  3UKP A;  4C3Y A;  3GRT A;  4YSZ A;  3UTF A;  4Z25 A;  1GPE A;  4UDR A;  4GRT A;  1M64 A;  3QVR A;  3RHA A;  4HA6 A;  3SCE A;  4H7U A;  4K5S A;  4CNJ A;  1JEH A;  3AE9 A;  2APG A;  4B69 A;  1TDN A;  3URH A;  3R9U A;  1O94 A;  4D03 A;  2ZBW A;  4NTE A;  2XCG A;  4OPL A;  1FT5 A;  3BI5 A;  1YKJ A;  2J7A A;  1PHH A;  5HYM A;  2XFU A;  2YVJ A;  1QJD A;  4H4X A;  4USR A;  4ECH A;  3AD7 B;  3VRB A;  1PN0 A;  2R4J A;  1GU6 A;  1M6I A;  4P9S A;  2RGJ A;  3LJP A;  2B7S A;  2WHD A;  3KLJ A;  4EIP A;  4ZN0 A;  1GRH A;  2X50 A;  5KMR A;  1B8S A;  2GRT A;  2XLT A;  1YQ4 A;  4U2L A;  1TRB A;  4UDP A;  1GTH A;  5KNL A;  1PJ7 A;  2XVF A;  1TDO A;  1REO A;  2C73 A;  2YQU A;  2B7R A;  4WX1 A;  2QA2 A;  5GRT A;  4CCQ A;  1CJ2 A;  3AEA A;  1IUS A;  3DJG X;  4TM1 A;  3UOZ A;  3P4S A;  1BGN A;  3UBR A;  1PBD A;  2XFN A;  4H4S A;  3DJJ A;  4Y4M A;  4AOS A;  2OLO A;  2GMJ A;  4LU6 A;  3C4A A;  3M13 A;  2TPR A;  3UOX A;  2ACZ A;  1M1P A;  4U8L A;  3VQR A;  4WJY A;  3AEB A;  3AEF A;  5BUL A;  1OJ9 A;  3CIR A;  2Q7V A;  1KSU A;  1VDC A;  2H88 A;  2IVE A;  3I6D A;  4DNA A;  2C72 A;  4CNK A;  4B1B A;  3UCL A;  4XWR A;  4BUR A;  1OJT A;  4EQW A;  3AYJ A;  2VVM A;  3P1W A;  5DBJ A;  1GXF A;  3CGE A;  3NG7 X;  4LII A;  4TM4 A;  2OT4 A;  1FT6 A;  1E6E A;  4RSL A;  4CY8 A;  4L3Z A;  4EM3 A;  4FX9 A;  1KDG A;  3V3O A;  4D04 A;  4CY6 A;  2R45 A;  1ZK7 A;  3NK1 X;  1VG0 A;  1BVB A;  1M1Q A;  2X3N A;  2OLN A;  3EF6 A;  4EMI A;  4X9M A;  1NHP A;  2BRY A;  2WPC A;  2GV8 A;  3AE6 A;  3DJD A;  1FL2 A;  3LZW A;  1L0V A;  4Q5B A;  3GYJ A;  3FPZ A;  4JN9 A;  2ZZB A;  2C67 A;  2CZS A;  1SP3 A;  3K30 A;  4X9N A;  2V6O A;  3AE2 A;  3SX6 A;  1ZX9 A;  1ZY8 A;  5CQF A;  1BGJ A;  4H2N A;  1PXC A;  4A65 A;  5M10 A;  4MJW A;  3AE5 A;  1E1K A;  4C74 A;  3FO3 A;  1JNI A;  2WDV A;  2A8X A;  4U8K A;  5U63 A;  3EAN A;  3I3L A;  3KKJ A;  3NLC A;  4EIQ A;  1FOH A;  5C3J A;  5KMP A;  2X99 A;  4GAV A;  3GYI A;  4FK1 A;  1S2Y A;  2WS3 A;  4YKG A;  3NK2 X;  4M52 A;  3NRN A;  4GDE A;  2C4C A;  1GTE A;  1N4W A;  1GEU A;  1RSG A;  1ZDL A;  3LXD A;  3P9U A;  1H6V A;  5C2T A;  2XVJ A;  4TM0 A;  1GND A;  4A6N B;  1RYI A;  1V59 A;  2VOU A;  2EQ8 A;  3F8D A;  3GYX A;  4DGK A;  3CND A;  2GQF A;  1PXB A;  1F6M A;  3BNM A;  3PVC A;  2BK5 A;  1PBF A;  2H89 A;  3SM8 A;  2BYB A;  2BXS A;  4A9W A;  2E81 A;  3LOV A;  5JCK A;  3SZF A;  3SY4 A;  4Q0T A;  1PJ6 A;  2TMD A;  3JSK A;  1DXL A;  2YG5 A;  4ZCD A;  1VQW A;  2VVL G;  4Z26 A;  4JY3 A;  4J36 A;  4C77 A;  1PDH A;  5KVI A;  3L1R A;  2XFO A;  5EBK A;  1B37 A;  1TYP A;  2RDZ A;  2V60 A;  4GDP A;  1JNR A;  5L46 A;  3SYI A;  3SFD A;  1LV0 A;  1H86 A;  3AE8 A;  1JRZ A;  5IPY A;  3AEC A;  3BNJ A;  4II2 A;  1ZMD A;  4TLZ A;  4Q5C A;  1NPX A;  4BJZ A;  5BVA A;  2GAG B;  3HYX A;  4I58 A;  3HYW A;  4OPI A;  3ICS A;  4G6H A;  4YTM A;  3II4 A;  2Z5X A;  2C65 A;  1EL8 A;  3IHM A;  3ITJ A;  3SZ0 A;  4Z2U A;  2WOI A;  3T0K A;  2Q6U A;  1ZOV A;  2WEU A;  4JNQ A;  4GR1 A;  3LAD A;  3IWA A;  5U1O A;  3RP8 A;  3KA7 A;  4BV6 A;  4H4P A;  1KSS A;  3SQP A;  4AP1 A;  3NK0 X;  4YT0 A;  1F8R A;  1JU2 A;  4L3X A;  3E1T A;  1NHS A;  2JB3 A;  2GR3 A;  2VRL A;  2VVL A;  3CNS A;  1QO8 A;  3GWF A;  3OC4 A;  1D5T A;  3RED A;  3ALM A;  3QFB A;  3AE1 A;  4KX6 A;  3RKH A;  2B9W A;  4G74 A;  1RP0 A;  3NYC A;  4YXD A;  1IUU A;  3CPH G;  4RG4 A;  3UTH A;  4B65 A;  4Q17 A;  1EL7 A;  2JB2 A;  4REK A;  1CC2 A;  3H8L A;  3L8K A;  3UTE A;  3HZL A;  1XHC A;  4CBQ A;  2E1M A;  5ER0 A;  1CC6 A;  1DNC A;  1L9D A;  2BA9 A;  1D4D A;  3P4Q A;  5FS8 A;  3H8I A;  4U8O A;  4L3Y A;  2C64 A;  2YWL A;  3CGB A;  4RG3 A;  4Z24 A;  1NHQ A;  4AT2 A;  3NT6 A;  3ATQ A;  1GOS A;  2EQ6 A;  3QSM A;  1NHR A;  2W0H A;  5KMQ A;  1L9E A;  1DOC A;  2J3N A;  2YLW A;  3H4K A;  3UP4 A;  3WE0 A;  4FDC B;  1F3P A;  4U8N A;  1HYU A;  1JRY A;  1CF3 A;  1IUX A;  3NH3 X;  4TM3 A;  4AP3 A;  1ZOY A;  2JB1 A;  4AOX A;  4J34 A;  3OZ2 A;  1OJC A;  4ICY A;  2C3D A;  1XDI A;  4G9K A;  1YY5 A;  2BAC A;  1FEB A;  4G73 A;  5J60 A;  3DK9 A;  3SXQ A;  2C70 A;  2YVF A;  3ADA B;  3DK4 A;  1BF3 A;  2PHH A;  1K4Q A;  4ZCC A;  1FS9 A;  1CC4 A;  4X4J A;  1NEK A;  5M0Z A;  3F8P A;  1TDE A;  2LFC A;  2R0P A;  2AR8 A;  2WOW A;  2FJA A;  3AYL A;  4EQS A;  5FS7 A;  1K0J A;  2XLR A;  1EBD A;  1S3B A;  1H83 A;  1Z6L A;  3NYE A;  4NEW A;  1OAH A;  3D1I A;  1N1P A;  3G5R A;  2XVE A;  4EQR A;  2E80 A;  3ABV A;  3G5S A;  4LA1 A;  4Z44 A;  2F5Z A;  1P2H A;  1GT8 A;  4H4Q A;  2YLS A;  4ADW A;  1E1M A;  3CGC A;  2A87 A;  3QJ4 A;  1GRG A;  1GRT A;  4FK1 C;  2XLP A;  4CCR A;  2R4E A;  1ZP0 A;  1JOA A;  2BC1 A;  2WPE A;  1GSN A;  1KFY A;  3EPT A;  4KPR A;  4I59 A;  5JCN A;  2CFY A;  3QVP A;  3OWM A;  2VR0 A;  1F8W A;  2GR0 A;  1NDA A;  3CPJ G;  3K7T A;  1F8S A;  1Q1W A;  1GAL A;  2BK4 A;  2C66 A;  3NTA A;  4NZH A;  2GEW A;  1FCD A;  1SEZ A;  5FMH A;  3SGL A;  4A7A A;  1PBE A;  4TLX A;  3T14 A;  1IUW A;  4H2Q A;  1TDK A;  3NTD A;  3HYV A;  3NYF A;  3UKQ A;  2DKI A;  1K0L A;  4H4Z A;  4H50 A;  4IVM B;  1LTX R;  2YG6 A;  4J56 A;  1L9C A;  2FJD A;  3EAO A;  3FBS A;  3NNE A;  2BAB A;  4APN A;  3Q6J A;  2XLS A;  3K7M X;  1CJ3 A;  1GRA A;  2RAB A;  4YSH A;  1KNP A;  3BHK A;  3RNM A;  4OPD A;  1DOE A;  3FIM B;  3CNJ A;  5TR3 A;  4EQX A;  2EQ7 A;  3SZC A;  5KOX A;  5JCL A;  3NN6 X;  3UP5 A;  2WU5 A;  4H4R A;  1OJD A;  1JNZ A;  1GES A;  2GB0 A;  1N4V A;  3COX A;  3ISH A;  1KNR A;  1KF6 A;  1D4E A;  2FJB A;  2X8H A;  3QSE A;  1K0I A;  2YLT A;  3GDN A;  4Z2R A;  1CHU A;  4NTC A;  1B4V A;  1GV4 A;  2XLU A;  1MO9 A;  4U8I A;  3AXB A;  1S2Q A;  1H7W A;  1MXT A;  2WET A;  4GAP A;  2K3V A;  4J33 A;  4XXG A;  3NHO X;  1X31 B;  2Z5Y A;  3LZX A;  2V3A A;  2WP5 A;  1ONF A;  4OPT A;  1D7L A;  4NNJ A;  4EM4 A;  3GSI A;  3LGQ A;  2BXR A;  2C75 A;  3IC9 A;  1AOG A;  2DKH A;  3SXI A;  2QCU A;  3VRD B;  3CPI G;  3V76 A;  3MMO A;  2GVC A;  2BCG G;  2PYX A;  2YG3 A;  3GRS A;  2QA1 A;  2FJE A;  2Y6Q A;  3GD4 A;  3QSS A;  4J57 A;  2YLR A;  5JCI A;  2XYO A;  2YAU A;  1NG3 A;  3AWI A;  1XPQ A;  4EMW A;  1GRE A;  2YM2 A;  3KPK A;  4U2T A;  3S5W A;  2WBA A;  4Y4N A;  4A99 A;  3T2Z A;  4JNA A;  4B68 A;  3UKK A;  4YSX A;  2ZZC A;  5KVH A;  2YVG A;  2JBV A;  3UKH A;  3CTY A;  3PS9 A;  3GM6 A;  3RP6 A;  1OJA A;  5JCM A;  2X8C A;  3B6D A;  1FS8 A;  3NKS A;  4PAA A;  1NG4 A;  4J31 A;  4OVI A;  5EOW A;  2RGO A;  2VQB A;  4O5Q A;  4XWZ A;  1BWC A;  2CVJ A;  2CUL A;  4WCT A;  4G6G A;  5KWF A;  1VRQ B;  1ELI A;  1IJH A;  2WOV A;  3FMW A;  3M0O A;  3S7W A;  2JAE A;  3AEG A;  4UP3 A;  5FS6 A;  2GR2 A;  3QFA A;  4Y4L A;  5KRQ A;  3ALL A;  4L38 A;  2GR1 A;  1PBC A;  5EB4 A;  1D7Y A;  3DGZ A;  4U8J A;  2R0G A;  4A6N A;  1LQT A;  3M12 A;  1CJ4 A;  1EL9 A;  1N4U A;  2WP9 A;  4USQ A;  5KXJ A;  3ALJ A;  4A79 A;  4H4U A;  4Q1O A;  4OCG A;  2XFQ A;  2YR6 A;  1QDB A;  3UU9 A;  4H2P A;  4EMJ A;  2Q0K A;  2AQJ A;  5KMS A;  4NWZ A;  2E5V A;  1B5Q A;  4H4Y A;  1LJ1 A;  2A89 A;  3BHF A;  3TTB A;  1VG9 A;  2GAH B;  4YTP A;  1E39 A;  2R46 A;  3NN0 X;  1BKW A;  3P4R A;  4BJY A;  3UTG A;  4PAB A;  5IQ4 A;  2WU2 A;  3L1T A;  2NVK X;  2YR5 A;  3LG1 A;  2XFP A;  3ICR A;  4CRT A;  4DSH A;  1JRX A;  3NGC X;  2CDU A;  4YKF A;  4N9X A;  1YQZ A;  1E7P A;  1P2E A;  5EB5 A;  4K7Z A;  4C3X A;  3AED A;  1W4X A;  3DA1 A;  4K5R A;  1DJN A;  4IA5 A;  4AT0 A;  1Y56 A;  2JKC A;  2GF3 A;  3CMM A;  4GUV A;  1GRF A;  4B66 A;  2GMH A;  3KVE A;  4DSG A;  2C76 A;  2Y6R A;  4A5L A;  2YM1 A;  2WP6 A;  2IVD A;  2BK3 A;  1LVL A;  3AYI A;  4II3 A;  3GDP A;  1Q9I A;  2O9Z A;  1PXA A;  3ZDN A;  3V3N A;  1TYT A;  3AE3 A;  3KPF A;  3AD9 B;  1CL0 A;  4HB9 A;  3DJE A;  2FBW A;  4H4V A;  5HXI A;  1S3E A;  1NAA A;  2R0C A;  3CNP A;  4BK1 A;  2BS3 A;  2VRM A;  3T2Y A;  3CNT A;  3BNF A;  3RP7 A;  3T37 A;  1LQU A;  2ZZ0 A;  3IHG A;  3Q9T A;  2GH5 A;  2QAE A;  1ZMC A;  1O95 A;  2UZZ A;  3AEE A;  3FG2 P;  3BI4 A;  3KU9 A;  1BZL A;  4YWO A;  4JY2 A;  1UKV G;  1ZKQ A;  2BCP A;  2OAL A;  3GMB A;  5FS9 A;  4Q4U A;  4IA6 A;  4OPC A;  5HY5 A;  3BNG A;  2WES A;  1O5W A;  1E1L A;  1PJ5 A;  1D4C A;  2VQ7 A;  2B76 A;  1TDF A;  1GER A;  3BNH A;  1DOD A;  2ARD A;  3PO7 A;  1NEN A;  3D1C A;  4E0V A;  3LB8 A;  1COY A;  3DH9 A;  3G5Q A;  2BC0 A;  5BUK A;  1YQ3 A;  3NIX A;  4U8P A;  2R9Z A;  2E4G A;  3TOR A;  4Z43 A;  3VRA A;  2X8G A;  3GD3 A;  3GWD A;  3VR8 A;  4YTN A;  2OAM A;  3T31 A;  3DGH A;  2JK6 A;  1LPF A; 
#chains in the Genus database with same CATH homology
 2B9Y A;  2WPF A;  3AD8 B;  4H2R A;  4JQ9 A;  1Y0P A;  3T2K A;  2V5Z A;  4K22 A;  4K2X A;  1MOK A;  3O0H A;  2YLZ A;  1H84 A;  1PS9 A;  5HHF A;  3ZYX A;  1XAN A;  1DOB A;  2GQW A;  3DK8 A;  3UKL A;  3BI2 A;  1FEA A;  3IF9 A;  3UOY A;  3DME A;  4B64 A;  2BRA A;  4OPU A;  4C5O A;  2WDR A;  4JDR A;  4U8M A;  4IVO B;  4J2W A;  4OPG A;  2BS2 A;  2I0Z A;  3ICT A;  1DJQ A;  3GMC A;  2AAQ A;  2V61 A;  2RF7 A;  1EL5 A;  2YLX A;  3F29 A;  2YG4 A;  3VR9 A;  1H82 A;  1PBB A;  3B3R A;  3UKF A;  2YR4 A;  1GET A;  2V3B A;  5GSN A;  3AE7 A;  2ZO5 A;  2WQY A;  1FEC A;  1GRB A;  3BNU A;  3C96 A;  1IUT A;  3C4N A;  3CGD A;  4H4W A;  3SFE A;  2Q0L A;  4IV9 A;  4B67 A;  1CJC A;  4NTD A;  4U2S A;  3SZW A;  4H4T A;  2RGH A;  2BS4 A;  1E1N A;  2NPX A;  3KD9 A;  4O5U A;  5IQ1 A;  2VZ2 A;  4GCM A;  2C7G A;  5KOW A;  3ATR A;  2B9X A;  3CN8 A;  1Q1R A;  2HQM A;  5J7X A;  3D8X A;  5LV9 A;  2C3C A;  3UKA A;  3UOV A;  3P4P A;  4UDQ A;  5BRT A;  4BK2 A;  2XDO A;  3AB1 A;  3AE4 A;  5U25 A;  4NEV A;  4GF7 A;  1FS7 A;  3F8R A;  3K7Q X;  1CBO A;  2EQ9 A;  2XVH A;  2OA1 A;  1M1R A;  1H81 A;  4BK3 A;  1H7X A;  2WDQ A;  2XVI A;  2IID A;  5CKU A;  4YSY A;  4Z2T A;  4K8D A;  1QLB A;  3S61 A;  1Y56 B;  1IUV A;  4B63 A;  2YG7 A;  3UKP A;  4C3Y A;  3GRT A;  4YSZ A;  3UTF A;  4Z25 A;  1GPE A;  4UDR A;  4GRT A;  1M64 A;  3QVR A;  3RHA A;  4HA6 A;  3SCE A;  4H7U A;  4K5S A;  4CNJ A;  1JEH A;  3AE9 A;  2APG A;  4B69 A;  1TDN A;  3URH A;  3R9U A;  1O94 A;  4D03 A;  2ZBW A;  4NTE A;  2XCG A;  4OPL A;  1FT5 A;  3BI5 A;  1YKJ A;  2J7A A;  1PHH A;  5HYM A;  2XFU A;  2YVJ A;  1QJD A;  4H4X A;  4USR A;  4ECH A;  3AD7 B;  3VRB A;  1PN0 A;  2R4J A;  1GU6 A;  1M6I A;  4P9S A;  2RGJ A;  3LJP A;  2B7S A;  2WHD A;  3KLJ A;  4EIP A;  4ZN0 A;  1GRH A;  2X50 A;  5KMR A;  1B8S A;  2GRT A;  2XLT A;  1YQ4 A;  4U2L A;  1TRB A;  4UDP A;  1GTH A;  5KNL A;  1PJ7 A;  2XVF A;  1TDO A;  1REO A;  2C73 A;  2YQU A;  2B7R A;  4WX1 A;  2QA2 A;  5GRT A;  4CCQ A;  1CJ2 A;  3AEA A;  1IUS A;  3DJG X;  4TM1 A;  3UOZ A;  3P4S A;  1BGN A;  3UBR A;  1PBD A;  2XFN A;  4H4S A;  3DJJ A;  4Y4M A;  4AOS A;  2OLO A;  2GMJ A;  4LU6 A;  3C4A A;  3M13 A;  2TPR A;  3UOX A;  2ACZ A;  1M1P A;  4U8L A;  3VQR A;  4WJY A;  3AEB A;  3AEF A;  5BUL A;  1OJ9 A;  3CIR A;  2Q7V A;  1KSU A;  1VDC A;  2H88 A;  2IVE A;  3I6D A;  4DNA A;  2C72 A;  4CNK A;  4B1B A;  3UCL A;  4XWR A;  4BUR A;  1OJT A;  4EQW A;  3AYJ A;  2VVM A;  3P1W A;  5DBJ A;  1GXF A;  3CGE A;  3NG7 X;  4LII A;  4TM4 A;  2OT4 A;  1FT6 A;  1E6E A;  4RSL A;  4CY8 A;  4L3Z A;  4EM3 A;  4FX9 A;  1KDG A;  3V3O A;  4D04 A;  4CY6 A;  2R45 A;  1ZK7 A;  3NK1 X;  1VG0 A;  1BVB A;  1M1Q A;  2X3N A;  2OLN A;  3EF6 A;  4EMI A;  4X9M A;  1NHP A;  2BRY A;  2WPC A;  2GV8 A;  3AE6 A;  3DJD A;  1FL2 A;  3LZW A;  1L0V A;  4Q5B A;  3GYJ A;  3FPZ A;  4JN9 A;  2ZZB A;  2C67 A;  4X9N A;  1SP3 A;  3K30 A;  2V6O A;  3AE2 A;  3SX6 A;  1ZX9 A;  1ZY8 A;  5CQF A;  1BGJ A;  4H2N A;  1PXC A;  4A65 A;  5M10 A;  4MJW A;  3AE5 A;  1E1K A;  4C74 A;  3FO3 A;  1JNI A;  2WDV A;  2A8X A;  4U8K A;  5U63 A;  3EAN A;  3I3L A;  3KKJ A;  3NLC A;  4EIQ A;  1FOH A;  5C3J A;  5KMP A;  2X99 A;  4GAV A;  3GYI A;  4FK1 A;  1S2Y A;  2WS3 A;  4YKG A;  3NK2 X;  4M52 A;  3NRN A;  4GDE A;  2C4C A;  1GTE A;  1N4W A;  1GEU A;  1RSG A;  1ZDL A;  3LXD A;  3P9U A;  1H6V A;  5C2T A;  2XVJ A;  4TM0 A;  1GND A;  4A6N B;  1RYI A;  1V59 A;  2VOU A;  2EQ8 A;  3F8D A;  3GYX A;  4DGK A;  3CND A;  2GQF A;  1PXB A;  1F6M A;  3BNM A;  3PVC A;  2BK5 A;  1PBF A;  2H89 A;  3SM8 A;  2BYB A;  2BXS A;  4A9W A;  2E81 A;  3LOV A;  5JCK A;  3SZF A;  3SY4 A;  4Q0T A;  1PJ6 A;  2TMD A;  3JSK A;  1DXL A;  2YG5 A;  4ZCD A;  1VQW A;  2VVL G;  4Z26 A;  4JY3 A;  4J36 A;  4C77 A;  1PDH A;  5KVI A;  3L1R A;  2XFO A;  5EBK A;  1B37 A;  1TYP A;  2RDZ A;  2V60 A;  4GDP A;  1JNR A;  5L46 A;  3SYI A;  3SFD A;  1LV0 A;  1H86 A;  3AE8 A;  1JRZ A;  5IPY A;  3AEC A;  3BNJ A;  4II2 A;  1ZMD A;  4TLZ A;  4Q5C A;  1NPX A;  4BJZ A;  5BVA A;  2GAG B;  3HYX A;  4I58 A;  3HYW A;  4OPI A;  3ICS A;  4G6H A;  4YTM A;  3II4 A;  2Z5X A;  2C65 A;  1EL8 A;  3IHM A;  3ITJ A;  3SZ0 A;  4Z2U A;  2WOI A;  3T0K A;  2Q6U A;  1ZOV A;  2WEU A;  4JNQ A;  4GR1 A;  3LAD A;  3IWA A;  5U1O A;  3RP8 A;  3KA7 A;  4BV6 A;  4H4P A;  1KSS A;  3SQP A;  4AP1 A;  3NK0 X;  4YT0 A;  1F8R A;  1JU2 A;  4L3X A;  3E1T A;  1NHS A;  2JB3 A;  2GR3 A;  2VRL A;  2VVL A;  3CNS A;  1QO8 A;  3GWF A;  3OC4 A;  1D5T A;  3RED A;  3ALM A;  3QFB A;  3AE1 A;  4KX6 A;  3RKH A;  2B9W A;  4G74 A;  1RP0 A;  3NYC A;  4YXD A;  1IUU A;  3CPH G;  4RG4 A;  3UTH A;  4B65 A;  4Q17 A;  1EL7 A;  2JB2 A;  4REK A;  1CC2 A;  3H8L A;  3L8K A;  3UTE A;  3HZL A;  1XHC A;  4CBQ A;  2E1M A;  5ER0 A;  1CC6 A;  1DNC A;  1L9D A;  2BA9 A;  1D4D A;  3P4Q A;  5FS8 A;  3H8I A;  4U8O A;  4L3Y A;  2C64 A;  2YWL A;  3CGB A;  4RG3 A;  4Z24 A;  1NHQ A;  4AT2 A;  3NT6 A;  3ATQ A;  1GOS A;  2EQ6 A;  3QSM A;  1NHR A;  2W0H A;  5KMQ A;  1L9E A;  1DOC A;  2J3N A;  2YLW A;  3H4K A;  3UP4 A;  3WE0 A;  4FDC B;  1F3P A;  4U8N A;  1HYU A;  1JRY A;  1CF3 A;  1IUX A;  3NH3 X;  4TM3 A;  4AP3 A;  1ZOY A;  2JB1 A;  4AOX A;  4J34 A;  3OZ2 A;  1OJC A;  4ICY A;  2C3D A;  1XDI A;  4G9K A;  1YY5 A;  2BAC A;  1FEB A;  4G73 A;  5J60 A;  3DK9 A;  3SXQ A;  2C70 A;  2YVF A;  3ADA B;  3DK4 A;  1BF3 A;  2PHH A;  1K4Q A;  4ZCC A;  1FS9 A;  1CC4 A;  4X4J A;  1NEK A;  5M0Z A;  3F8P A;  1TDE A;  2LFC A;  2R0P A;  2AR8 A;  2WOW A;  2FJA A;  3AYL A;  4EQS A;  5FS7 A;  1K0J A;  2XLR A;  1EBD A;  1S3B A;  1H83 A;  1Z6L A;  3NYE A;  4NEW A;  1OAH A;  3D1I A;  1N1P A;  3G5R A;  2XVE A;  4EQR A;  2E80 A;  3ABV A;  3G5S A;  4LA1 A;  4Z44 A;  2F5Z A;  1P2H A;  1GT8 A;  4H4Q A;  2YLS A;  4ADW A;  1E1M A;  3CGC A;  2A87 A;  3QJ4 A;  1GRG A;  1GRT A;  4FK1 C;  2XLP A;  4CCR A;  2R4E A;  1ZP0 A;  1JOA A;  2BC1 A;  2WPE A;  1GSN A;  1KFY A;  3EPT A;  4KPR A;  4I59 A;  5JCN A;  2CFY A;  3QVP A;  3OWM A;  2VR0 A;  1F8W A;  2GR0 A;  1NDA A;  3CPJ G;  3K7T A;  1F8S A;  1Q1W A;  1GAL A;  2BK4 A;  2C66 A;  3NTA A;  4NZH A;  2GEW A;  1FCD A;  1SEZ A;  5FMH A;  3SGL A;  4A7A A;  1PBE A;  4TLX A;  3T14 A;  1IUW A;  4H2Q A;  1TDK A;  3NTD A;  3HYV A;  3NYF A;  3UKQ A;  2DKI A;  1K0L A;  4H4Z A;  4H50 A;  4IVM B;  1LTX R;  2YG6 A;  4J56 A;  1L9C A;  2FJD A;  3EAO A;  3FBS A;  3NNE A;  2BAB A;  4APN A;  3Q6J A;  2XLS A;  3K7M X;  1CJ3 A;  1GRA A;  2RAB A;  4YSH A;  1KNP A;  3BHK A;  3RNM A;  4OPD A;  1DOE A;  3FIM B;  3CNJ A;  5TR3 A;  4EQX A;  2EQ7 A;  3SZC A;  5KOX A;  5JCL A;  3NN6 X;  3UP5 A;  2WU5 A;  4H4R A;  1OJD A;  1JNZ A;  1GES A;  2GB0 A;  1N4V A;  3COX A;  3ISH A;  1KNR A;  1KF6 A;  1D4E A;  2FJB A;  2X8H A;  3QSE A;  1K0I A;  2YLT A;  3GDN A;  4Z2R A;  1CHU A;  4NTC A;  1B4V A;  1GV4 A;  2XLU A;  1MO9 A;  4U8I A;  3AXB A;  1S2Q A;  1H7W A;  1MXT A;  2WET A;  4GAP A;  2K3V A;  4J33 A;  4XXG A;  3NHO X;  1X31 B;  2Z5Y A;  3LZX A;  2V3A A;  2WP5 A;  1ONF A;  4OPT A;  1D7L A;  4NNJ A;  4EM4 A;  3GSI A;  3LGQ A;  2BXR A;  2C75 A;  3IC9 A;  1AOG A;  2DKH A;  3SXI A;  2QCU A;  3VRD B;  3CPI G;  3V76 A;  3MMO A;  2GVC A;  2BCG G;  2PYX A;  2YG3 A;  3GRS A;  2QA1 A;  2FJE A;  2Y6Q A;  3GD4 A;  3QSS A;  4J57 A;  2YLR A;  5JCI A;  2XYO A;  2YAU A;  1NG3 A;  3AWI A;  1XPQ A;  4EMW A;  1GRE A;  2YM2 A;  3KPK A;  4U2T A;  3S5W A;  2WBA A;  4Y4N A;  4A99 A;  3T2Z A;  4JNA A;  4B68 A;  3UKK A;  4YSX A;  2ZZC A;  5KVH A;  2YVG A;  2JBV A;  3UKH A;  3CTY A;  3PS9 A;  3GM6 A;  3RP6 A;  1OJA A;  5JCM A;  2X8C A;  3B6D A;  1FS8 A;  3NKS A;  4PAA A;  1NG4 A;  4J31 A;  4OVI A;  5EOW A;  2RGO A;  2VQB A;  4O5Q A;  4XWZ A;  1BWC A;  2CVJ A;  2CUL A;  4WCT A;  4G6G A;  5KWF A;  1VRQ B;  1ELI A;  1IJH A;  2WOV A;  3FMW A;  3M0O A;  3S7W A;  2JAE A;  3AEG A;  4UP3 A;  5FS6 A;  2GR2 A;  3QFA A;  4Y4L A;  5KRQ A;  3ALL A;  4L38 A;  2GR1 A;  1PBC A;  5EB4 A;  1D7Y A;  3DGZ A;  4U8J A;  2R0G A;  4A6N A;  1LQT A;  3M12 A;  1CJ4 A;  1EL9 A;  1N4U A;  2WP9 A;  4USQ A;  5KXJ A;  3ALJ A;  4A79 A;  4H4U A;  4Q1O A;  4OCG A;  2XFQ A;  2YR6 A;  1QDB A;  3UU9 A;  4H2P A;  4EMJ A;  2Q0K A;  2AQJ A;  5KMS A;  4NWZ A;  2E5V A;  1B5Q A;  4H4Y A;  1LJ1 A;  2A89 A;  3BHF A;  3TTB A;  1VG9 A;  2GAH B;  4YTP A;  1E39 A;  2R46 A;  3NN0 X;  1BKW A;  3P4R A;  4BJY A;  3UTG A;  4PAB A;  5IQ4 A;  2WU2 A;  3L1T A;  2NVK X;  2YR5 A;  3LG1 A;  2XFP A;  3ICR A;  4CRT A;  4DSH A;  1JRX A;  3NGC X;  2CDU A;  4YKF A;  4N9X A;  1YQZ A;  1E7P A;  1P2E A;  5EB5 A;  4K7Z A;  4C3X A;  3AED A;  1W4X A;  3DA1 A;  4K5R A;  1DJN A;  4IA5 A;  4AT0 A;  1Y56 A;  2JKC A;  2GF3 A;  3CMM A;  4GUV A;  1GRF A;  4B66 A;  2GMH A;  3KVE A;  4DSG A;  2C76 A;  2Y6R A;  4A5L A;  2YM1 A;  2WP6 A;  2IVD A;  2BK3 A;  1LVL A;  3AYI A;  4II3 A;  3GDP A;  1Q9I A;  2O9Z A;  1PXA A;  3ZDN A;  3V3N A;  1TYT A;  3AE3 A;  3KPF A;  3AD9 B;  1CL0 A;  4HB9 A;  3DJE A;  2FBW A;  4H4V A;  5HXI A;  1S3E A;  1NAA A;  2R0C A;  3CNP A;  4BK1 A;  2BS3 A;  2VRM A;  3T2Y A;  3CNT A;  3BNF A;  3RP7 A;  3T37 A;  1LQU A;  2ZZ0 A;  3IHG A;  3Q9T A;  2GH5 A;  2QAE A;  1ZMC A;  1O95 A;  2UZZ A;  3AEE A;  3FG2 P;  3BI4 A;  3KU9 A;  1BZL A;  4YWO A;  4JY2 A;  1UKV G;  1ZKQ A;  2BCP A;  2OAL A;  3GMB A;  5FS9 A;  4Q4U A;  4IA6 A;  4OPC A;  5HY5 A;  3BNG A;  2WES A;  1O5W A;  1E1L A;  1PJ5 A;  1D4C A;  2VQ7 A;  2B76 A;  1TDF A;  1GER A;  3BNH A;  1DOD A;  2ARD A;  3PO7 A;  1NEN A;  3D1C A;  4E0V A;  3LB8 A;  1COY A;  3DH9 A;  3G5Q A;  2BC0 A;  5BUK A;  1YQ3 A;  3NIX A;  4U8P A;  2R9Z A;  2E4G A;  3TOR A;  4Z43 A;  3VRA A;  2X8G A;  3GD3 A;  3GWD A;  3VR8 A;  4YTN A;  2OAM A;  3T31 A;  3DGH A;  2JK6 A;  1LPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...