1Y0PA

Flavocytochrome c3 with mesaconate bound
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fumarate reductase flavoprotein subunit
publication title Electrocatalytic Generation of Chiral Fumarate Derivatives by Flavocytochrome c3
rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 194
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1y0pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1y0pA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1y0pA03
4I59A 4J56A 3QSMA 5KVIA 2RABA 4TLXA 2Z5YA 3DGZA 4CCRA 1FS9A 1LV0A 1LVLA 3H8IA 4GF7A 2GVCA 4REKA 2FJAA 3FPZA 1CL0A 2BC1A 2VRMA 3CNTA 4EQRA 3T37A 2WPEA 1VG0A 3BHKA 3UOYA 4H4PA 4NTDA 1M1RA 4Q4UA 1F3PA 4H4TA 1F8RA 3AE3A 1SP3A 2VVLA 1PJ6A 4AT2A 2X50A 4BJZA 4CBQA 5FMHA 4K2XA 3IHMA 4J34A 2PHHA 2YVJA 2QA1A 3PO7A 3UKQA 1GRAA 3KLJA 2WETA 1TDKA 3M12A 3AE9A 3DK4A 1GETA 2H88A 2EQ6A 3H4KA 3NYCA 2CDUA 2YLTA 4Q0TA 1DXLA 1NDAA 2J3NA 1IUUA 2BXRA 2VVLG 2X8CA 3DJEA 3ICRA 4EIQA 3DK9A 2YG3A 3K7QX 4A5LA 3F8PA 1E1MA 4C3YA 4KPRA 5GSNA 2BK3A 1CJ4A 2TPRA 2YAUA 3DH9A 3WE0A 2YG5A 2R4EA 4HA6A 3L1TA 1CC6A 3TORA 1ONFA 3UBRA 3BNMA 3G5QA 1N1PA 3GD3A 2XVHA 1M6IA 1GPEA 2X8HA 1ZOYA 3BI5A 3AYLA 1CF3A 2OAMA 4U8MA 5FS8A 1KSSA 4GDPA 1VQWA 3CN8A 1TDOA 1K0LA 1E7PA 1OJTA 2GAGB 3UOVA 1BVBA 2AQJA 3D8XA 4CNKA 2ACZA 1EL9A 2XVIA 3Q6JA 4YTMA 4U8IA 2NVKX 1D5TA 2C65A 4RG3A 4HB9A 4Z2TA 1QJDA 4CNJA 3LGQA 5FS6A 1D7LA 3I3LA 4CY8A 1DODA 2JK6A 4Z2RA 2V5ZA 3D1CA 2VQBA 2WP9A 4A9WA 2Q7VA 2C3CA 1E1LA 4LIIA 4X9NA 3UTGA 2J7AA 3LXDA 3LZXA 1FCDA 4X9MA 4EQXA 1BF3A 3G5SA 3GM6A 5C2TA 3AEBA 3BNUA 4EMJA 1DJQA 3ADAB 3UTEA 4IA6A 3CNPA 1IUWA 4APNA 3COXA 3AD7B 1QDBA 1L9EA 1REOA 2WOWA 2X3NA 2FJEA 2Q0KA 4GRTA 2XVEA 4JY2A 3AWIA 3BI2A 3VQRA 1D7YA 1OJ9A 1CBOA 1PBDA 1W4XA 3FBSA 2JB1A 5M10A 3FMWA 2ARDA 1TRBA 2BK5A 4ICYA 2BK4A 1NENA 1XDIA 2OA1A 1IUVA 2ZZCA 1GU6A 1GNDA 3AE8A 4RSLA 4CY6A 4D03A 4NEWA 2JKCA 3AXBA 3BHFA 3QVRA 5U25A 1ZKQA 4FDCB 3AYIA 1JOAA 2BA9A 2IVEA 3P1WA 1H81A 3CPJG 3QFAA 3S7WA 1PS9A 2YM1A 1RSGA 2EQ9A 4OPTA 1NAAA 3URHA 4ZCDA 2DKIA 2WHDA 2FJDA 4Y4NA 3NG7X 1Y0PA 3IWAA 5JCKA 3GWFA 3AE5A 4Z44A 4GCMA 1E1KA 3F29A 1GV4A 4XWRA 2QCUA 4GR1A 3CGCA 2ZO5A 3NHOX 4Z2UA 5JCNA 3K30A 3EANA 2JB3A 5BUKA 3NRNA 2R4JA 1JNRA 2WDVA 3OWMA 1TYPA 3AE4A 3LZWA 2EQ8A 3O0HA 1N4WA 1OJDA 3ICTA 2GF3A 2YLXA 3CNSA 3C4NA 3GDPA 5DBJA 3SCEA 1Y56A 3VRAA 4Q1OA 3V3OA 1BZLA 5FS9A 3RP6A 1ZMDA 2BC0A 1UKVG 2EQ7A 3P4QA 3S5WA 3HZLA 4H4WA 4OPIA 4Y4LA 3RP7A 1MOKA 4BK2A 1PBFA 2Q6UA 2B7RA 4BK1A 3BI4A 3NK0X 1XANA 3SM8A 5ER0A 1PXBA 1PJ7A 2YQUA 1SEZA 1GREA 2YR6A 3RP8A 4YXDA 3S61A 3ALJA 1DOEA 1Q1RA 2WOIA 3B6DA 1MO9A 4OPGA 2WEUA 2X8GA 4H4ZA 2O9ZA 2XFOA 4YKGA 2V3AA 4JY3A 3QSEA 2TMDA 1GEUA 4LU6A 1K0JA 3GD4A 4EIPA 4Z25A 1ZOVA 2WOVA 3NNEA 1D4CA 2BABA 5IPYA 1FT5A 1CC4A 4UP3A 3LJPA 4YKFA 1NG3A 4XXGA 3KKJA 1H86A 3ATRA 3NGCX 1Q1WA 3AE1A 4EM4A 1KFYA 1GRBA 2GMHA 1O94A 1TDNA 4AP1A 1IUXA 4YT0A 1AOGA 2C66A 2YLRA 4J33A 3ATQA 4KX6A 4GUVA 1EL5A 1KDGA 3REDA 2XLSA 2A8XA 4TM4A 2ZZBA 4Z24A 2QA2A 4OPDA 4P9SA 3CNDA 2Y6QA 1PBCA 3CPHG 2E80A 1YQ3A 3KD9A 4B66A 4TLZA 3GMBA 4B68A 1KF6A 4O5UA 2GH5A 4UDRA 4H4RA 4J57A 1S2YA 4K22A 5KOWA 1CJCA 1K4QA 1NEKA 3ABVA 1PHHA 4UDPA 5L46A 3CPIG 1CJ3A 1N4VA 2GAHB 2XFPA 2C75A 3NTAA 3QFBA 4WJYA 4H4SA 4A7AA 1OJAA 3UKKA 3L1RA 4MJWA 2WU2A 1FT6A 1BGNA 4B65A 1PN0A 1GT8A 4Q5CA 4XWZA 4BK3A 2BCGG 1RYIA 1DOBA 2XCGA 3AEDA 4OPLA 3CTYA 2K3VA 1PJ5A 3UCLA 3H8LA 3IF9A 1NHQA 4L3XA 1BGJA 2C72A 2CULA 4BURA 2GRTA 1M64A 3F8RA 3OC4A 1CC2A 1GRTA 1M1QA 2WS3A 1HYUA 4TM1A 1KNRA 3V3NA 4IVOB 1F6MA 2WBAA 3AD8B 1JNIA 5LV9A 1Y56B 2WQYA 2ZBWA 4B64A 4Q17A 4DSHA 3LADA 1MXTA 5HHFA 3QVPA 1RP0A 3GYXA 4FK1A 4U2SA 2ZZ0A 3DMEA 3BNHA 4H2RA 1GERA 5JCIA 3JSKA 4WX1A 3G5RA 2BCPA 1H6VA 1TDEA 4AOXA 1D4EA 1O5WA 1H82A 1FL2A 1LQUA 1NPXA 3GDNA 4YSXA 3UOXA 1DOCA 4I58A 2FBWA 1FECA 2LFCA 1GTHA 4U8OA 3M0OA 3AE6A 2OLNA 2XYOA 1JRXA 1YQ4A 1IJHA 3AEEA 3SFDA 1BKWA 2C7GA 2RGOA 1ZP0A 3VRDB 4YSZA 3TTBA 3ITJA 2VVMA 4D04A 1Q9IA 1ELIA 2XDOA 4A6NA 1L0VA 5EB4A 3ICSA 5JCLA 3DA1A 2WPCA 4WCTA 5BULA 2YG4A 4NEVA 1B4VA 4USRA 3DGHA 1DNCA 1P2EA 4BJYA 4A79A 3UKLA 4ADWA 4EQSA 4U8PA 2BACA 1EBDA 2YVFA 4DSGA 4BV6A 2IIDA 4IA5A 1F8SA 3AB1A 3UKPA 4AOSA 4YSHA 2V61A 3UTFA 1FS7A 3OZ2A 1ZK7A 4CCQA 4OPCA 4TM3A 3AD9B 2BS3A 4YTPA 2R0GA 3K7MX 2WDRA 3KA7A 2RGJA 2RDZA 3QJ4A 3EF6A 5EB5A 4DNAA 1CJ2A 3LOVA 1VRQB 1JU2A 2PYXA 2JB2A 3AEFA 5CKUA 4H4UA 1E6EA 3P4PA 1YQZA 2DKHA 3NTDA 2B76A 3QSSA 3V76A 3FIMB 4JN9A 2RGHA 2VZ2A 2XFQA 5M0ZA 1JEHA 2GB0A 4JNAA 1S3BA 2R0PA 1KNPA 4C77A 1JRYA 4CRTA 1NHPA 4A65A 3M13A 1JNZA 2GR3A 2W0HA 2YG6A 1PDHA 1YKJA 1M1PA 1O95A 2WESA 4U8KA 1CHUA 1E1NA 1NG4A 1GXFA 2BYBA 2FJBA 2YLWA 4K5RA 3VRBA 2XLRA 2BXSA 1VG9A 2VQ7A 2JAEA 2WU5A 3EAOA 3KVEA 4NZHA 4X4JA 5IQ4A 2B9WA 3GWDA 4C5OA 2BS2A 3SGLA 3R9UA 4H4XA 3NIXA 2B7SA 4B63A 4NTCA 2C73A 2GMJA 2YWLA 4EMIA 1FOHA 2WPFA 2WP5A 3P4RA 2R9ZA 4J2WA 4JQ9A 4ECHA 5HYMA 2CVJA 3LG1A 4B67A 4ZCCA 4E0VA 4H4VA 2R46A 3RHAA 4LA1A 3LB8A 1H7XA 3MMOA 4Z26A 1L9CA 2Q0LA 1GESA 4H50A 1LQTA 2E4GA 2GR0A 2YR5A 3II4A 3NYFA 4JNQA 2XVJA 2XLPA 3CGDA 3F8DA 2YG7A 2BS4A 5KWFA 1EL7A 3RNMA 2H89A 3B3RA 4J36A 2VRLA 4A6NB 2I0ZA 3ZYXA 3DJGX 3BNGA 3AE2A 3UOZA 2A87A 4B69A 2YM2A 3NK1X 3AEGA 2AAQA 3BNFA 1OJCA 1X31B 5EBKA 2APGA 3SXQA 2C3DA 4TM0A 2GR2A 4YSYA 3GRSA 4O5QA 4L3ZA 1H84A 1FEAA 3AECA 1IUTA 3SFEA 2XVFA 3CIRA 2VOUA 2C70A 1Z6LA 4K8DA 2GV8A 3P9UA 4H4YA 3GMCA 1PBEA 4U8LA 1GRGA 4EM3A 2A89A 3UP4A 3P4SA 4U8NA 3BNJA 2XLUA 3NN0X 1KSUA 3NYEA 1B8SA 2V6OA 1XHCA 2XFNA 4U2LA 2Z5XA 3C96A 4K5SA 1VDCA 4PABA 4FX9A 4OPUA 1ZY8A 4C3XA 4L3YA 1P2HA 3FO3A 3UKAA 1ZDLA 2YLZA 1COYA 2GQWA 4OVIA 3VR8A 4AT0A 3DJDA 1FEBA 4AP3A 1D4DA 4FK1C 2OLOA 3UP5A 4RG4A 3GYJA 1BWCA 2X99A 3ALLA 5TR3A 3NKSA 3Q9TA 2XLTA 3UTHA 5C3JA 5JCMA 1ZMCA 3CNJA 1PXCA 3GYIA 4M52A 5FS7A 3SQPA 4IV9A 1TYTA 5EOWA 5BVAA 1E39A 3DJJA 5J60A 2OT4A 2R0CA 3AEAA 4GDEA 4ZN0A 3RKHA 1QO8A 1EL8A 3PS9A 2CFYA 4U8JA 2JBVA 2YR4A 3KU9A 2C76A 1OAHA 5KRQA 3DK8A 1JRZA 3C4AA 2GR1A 3ALMA 3FG2P 3IC9A 1NHRA 4Z43A 3CGBA 3NH3X 1B37A 4L38A 4H2QA 4OCGA 4J31A 1XPQA 3KPFA 2C67A 4UDQA 3ISHA 1DJNA 5GRTA 1V59A 5U63A 1QLBA 4EMWA 3NLCA 4NTEA 2HQMA 3AYJA 3UKHA 4A99A 2V3BA 3AE7A 2Y6RA 2C64A 4K7ZA 1GSNA 5U1OA 1GOSA 1NHSA 3UKFA 4H7UA 3UU9A 1F8WA 2GEWA 1GALA 4DGKA 5KXJA 2WDQA 3E1TA 4YTNA 3GRTA 1TDFA 3VR9A 1H83A 1LTXR 2E81A 4IVMB 2IVDA 1FS8A 2E1MA 1K0IA 5BRTA 2WP6A 5HY5A 5IQ1A 1LJ1A 1B5QA 2F5ZA 2AR8A 2XFUA 3K7TA 2UZZA 4Y4MA 3D1IA 1L9DA 1LPFA 1N4UA 3GSIA 4N9XA 3NN6X 3EPTA 2YLSA 1S2QA 2GQFA 2OALA 2YVGA 4USQA 5HXIA 4Q5BA 3CGEA 5KOXA 4H4QA 4H2PA 4PAAA 4C74A 1YY5A 3IHGA 2V60A 4JDRA 1ZX9A 1PXAA 3NK2X 5CQFA 2VR0A 3ZDNA 4B1BA 1GRHA 2E5VA 2NPXA 2QAEA 2B9XA 1S3EA 5KVHA 1GRFA 4YWOA 2B9YA 2R45A 3L8KA 4H2NA 5J7XA 4EQWA 1GTEA 3I6DA 3NT6A 3PVCA 1PBBA 1IUSA 1H7WA 2RF7A 4U2TA
chains in the Genus database with same CATH superfamily
4I59A 4J56A 3QSMA 5KVIA 2RABA 4TLXA 2Z5YA 3DGZA 4CCRA 1FS9A 1LV0A 1LVLA 3H8IA 4GF7A 2GVCA 4REKA 2FJAA 3FPZA 1CL0A 2BC1A 2VRMA 3CNTA 4EQRA 3T37A 2WPEA 1VG0A 3BHKA 3UOYA 4H4PA 4NTDA 1M1RA 4Q4UA 1F3PA 4H4TA 1F8RA 3AE3A 1SP3A 2VVLA 1PJ6A 4AT2A 2X50A 4BJZA 4CBQA 5FMHA 4K2XA 3IHMA 4J34A 2PHHA 2YVJA 2QA1A 3PO7A 3UKQA 1GRAA 3KLJA 2WETA 1TDKA 3M12A 3AE9A 3DK4A 1GETA 2H88A 2EQ6A 3H4KA 3NYCA 2CDUA 2YLTA 4Q0TA 1DXLA 1NDAA 2J3NA 1IUUA 2BXRA 2VVLG 2X8CA 3DJEA 3ICRA 4EIQA 3DK9A 2YG3A 3K7QX 4A5LA 3F8PA 1E1MA 4C3YA 4KPRA 5GSNA 2BK3A 1CJ4A 2TPRA 2YAUA 3DH9A 3WE0A 2YG5A 2R4EA 4G9KA 4HA6A 3L1TA 1CC6A 3TORA 1ONFA 3UBRA 3BNMA 3G5QA 1N1PA 3GD3A 2XVHA 3T14A 1M6IA 1GPEA 2X8HA 1ZOYA 3BI5A 3AYLA 1CF3A 2CZSA 2OAMA 4U8MA 5FS8A 1KSSA 4GDPA 1VQWA 3CN8A 1TDOA 1K0LA 1E7PA 1OJTA 2GAGB 3UOVA 1BVBA 2AQJA 3D8XA 4NWZA 4CNKA 2ACZA 1EL9A 2XVIA 3Q6JA 4YTMA 4U8IA 2NVKX 1D5TA 2C65A 4RG3A 4HB9A 4Z2TA 1QJDA 4CNJA 3LGQA 5FS6A 1D7LA 3I3LA 4CY8A 1DODA 2JK6A 4Z2RA 2V5ZA 3D1CA 2VQBA 2WP9A 4A9WA 2Q7VA 2C3CA 1E1LA 4LIIA 4X9NA 3UTGA 2J7AA 3LXDA 3LZXA 1FCDA 4X9MA 4EQXA 1BF3A 3G5SA 3GM6A 5C2TA 3AEBA 3BNUA 4EMJA 3SX6A 1DJQA 3ADAB 3UTEA 4IA6A 3CNPA 1IUWA 4APNA 3COXA 3AD7B 1QDBA 1L9EA 1REOA 2WOWA 2X3NA 2FJEA 2Q0KA 4GRTA 2XVEA 4JY2A 3AWIA 3BI2A 3VQRA 1D7YA 1OJ9A 1CBOA 1PBDA 1W4XA 3FBSA 2JB1A 5M10A 3FMWA 2ARDA 1TRBA 2BK5A 4ICYA 2BK4A 1NENA 1XDIA 2OA1A 1IUVA 2ZZCA 1GU6A 1GNDA 3AE8A 3HYWA 4G6GA 4CY6A 4D03A 4NEWA 2JKCA 3AXBA 5KMQA 3BHFA 3QVRA 5U25A 1ZKQA 4FDCB 3AYIA 1JOAA 2BA9A 2IVEA 3P1WA 1H81A 3CPJG 3QFAA 3S7WA 1PS9A 2YM1A 1RSGA 2EQ9A 4OPTA 1NAAA 4GAPA 3URHA 4ZCDA 2DKIA 2WHDA 2FJDA 4Y4NA 3NG7X 1Y0PA 3IWAA 5JCKA 3GWFA 3AE5A 4Z44A 4GCMA 1E1KA 3F29A 1GV4A 4XWRA 2QCUA 4GR1A 3CGCA 2ZO5A 3NHOX 4Z2UA 5JCNA 3K30A 3EANA 2JB3A 5BUKA 3NRNA 2R4JA 1JNRA 2WDVA 3OWMA 1TYPA 3AE4A 3LZWA 2EQ8A 3O0HA 1N4WA 1OJDA 3ICTA 2GF3A 2YLXA 3CNSA 3C4NA 3GDPA 5DBJA 3SCEA 1Y56A 3VRAA 4Q1OA 3V3OA 1BZLA 5FS9A 3RP6A 1ZMDA 2BC0A 1UKVG 2EQ7A 3P4QA 3S5WA 3HZLA 4H4WA 4OPIA 4Y4LA 3SZFA 3RP7A 1MOKA 2BRAA 4BK2A 1PBFA 2Q6UA 2B7RA 4BK1A 3BI4A 3NK0X 1XANA 3SM8A 5ER0A 1PXBA 1PJ7A 2YQUA 1SEZA 1GREA 2YR6A 3RP8A 4YXDA 3S61A 3ALJA 1DOEA 1Q1RA 2WOIA 3B6DA 1MO9A 4OPGA 2WEUA 2X8GA 4NNJA 4H4ZA 2O9ZA 2XFOA 4YKGA 2V3AA 4JY3A 3QSEA 2TMDA 1GEUA 4LU6A 1K0JA 3GD4A 4EIPA 4Z25A 1ZOVA 2WOVA 3NNEA 1D4CA 2BABA 5IPYA 1FT5A 1CC4A 4UP3A 3LJPA 4YKFA 1NG3A 4XXGA 3KKJA 1H86A 3ATRA 3NGCX 1Q1WA 3AE1A 4EM4A 1KFYA 1GRBA 2GMHA 1O94A 1TDNA 4AP1A 1IUXA 4YT0A 1AOGA 2C66A 2YLRA 4J33A 3ATQA 4KX6A 4GUVA 1EL5A 1KDGA 2BRYA 3REDA 2XLSA 2A8XA 4TM4A 2ZZBA 4Z24A 3SYIA 2QA2A 4OPDA 4P9SA 3CNDA 2Y6QA 1PBCA 3CPHG 2E80A 1YQ3A 3KD9A 4B66A 4TLZA 3GMBA 4B68A 1KF6A 4O5UA 2GH5A 4UDRA 4H4RA 4J57A 1S2YA 4K22A 5KOWA 1CJCA 1K4QA 1NEKA 3ABVA 1PHHA 4UDPA 5L46A 3CPIG 1CJ3A 1N4VA 2GAHB 2XFPA 2C75A 3NTAA 3QFBA 4WJYA 4H4SA 4A7AA 1OJAA 3UKKA 3L1RA 4MJWA 2WU2A 1FT6A 1BGNA 4B65A 1PN0A 1GT8A 4Q5CA 4XWZA 4BK3A 2BCGG 1RYIA 1DOBA 3T2YA 2XCGA 3AEDA 4OPLA 3CTYA 2K3VA 3HYVA 3HYXA 1PJ5A 3UCLA 3H8LA 3IF9A 1NHQA 4L3XA 1BGJA 2C72A 2CULA 4BURA 2GRTA 1M64A 3F8RA 3OC4A 1CC2A 1GRTA 1M1QA 2WS3A 1HYUA 4TM1A 1KNRA 3V3NA 4IVOB 1F6MA 2WBAA 3AD8B 1JNIA 5LV9A 1Y56B 2WQYA 2ZBWA 4B64A 4Q17A 4DSHA 3LADA 1MXTA 5HHFA 3GYXA 1RP0A 3QVPA 4FK1A 4U2SA 3T2KA 2ZZ0A 3DMEA 3BNHA 4H2RA 1GERA 5JCIA 3JSKA 4WX1A 3G5RA 2BCPA 1H6VA 1TDEA 3SZCA 4AOXA 1D4EA 1O5WA 1H82A 1FL2A 1LQUA 1NPXA 3GDNA 3SY4A 3UOXA 1DOCA 4YSXA 4I58A 2FBWA 1FECA 2LFCA 3KPKA 1GTHA 4U8OA 3M0OA 3AE6A 2OLNA 2XYOA 1JRXA 1YQ4A 1IJHA 3AEEA 3SFDA 1BKWA 2C7GA 2RGOA 1ZP0A 3VRDB 4YSZA 3TTBA 3ITJA 2VVMA 4D04A 1Q9IA 1ELIA 2XDOA 4A6NA 1L0VA 5EB4A 3ICSA 5JCLA 3DA1A 2WPCA 4WCTA 5BULA 3T31A 2YG4A 4NEVA 1B4VA 4USRA 3DGHA 1DNCA 1P2EA 4BJYA 4A79A 3UKLA 4ADWA 4EQSA 4U8PA 5KMRA 2BACA 1EBDA 2YVFA 4DSGA 4BV6A 2IIDA 4IA5A 1F8SA 3AB1A 3UKPA 4AOSA 4YSHA 2V61A 3UTFA 1FS7A 3OZ2A 1ZK7A 4CCQA 4OPCA 4TM3A 3AD9B 2BS3A 2C4CA 5KMPA 4YTPA 5KNLA 2R0GA 3K7MX 2WDRA 3KA7A 2RGJA 2RDZA 3QJ4A 3EF6A 5EB5A 4DNAA 1CJ2A 3LOVA 1VRQB 4II3A 1JU2A 2PYXA 2JB2A 3AEFA 5CKUA 4H4UA 1E6EA 3P4PA 1YQZA 2DKHA 3NTDA 2B76A 3QSSA 4G6HA 3V76A 3FIMB 4JN9A 2RGHA 2VZ2A 2XFQA 5M0ZA 1JEHA 2GB0A 4JNAA 1S3BA 2R0PA 1KNPA 4C77A 1JRYA 4CRTA 1NHPA 4A65A 3M13A 1JNZA 2GR3A 2W0HA 2YG6A 1PDHA 1YKJA 1M1PA 1O95A 2WESA 4U8KA 1CHUA 1E1NA 1NG4A 1GXFA 2BYBA 2FJBA 2YLWA 4K5RA 3VRBA 2XLRA 2BXSA 1VG9A 2VQ7A 2JAEA 2WU5A 3EAOA 3KVEA 4NZHA 4X4JA 5IQ4A 2B9WA 3GWDA 4C5OA 2BS2A 3SGLA 3R9UA 4H4XA 3NIXA 2B7SA 4B63A 4NTCA 2C73A 2GMJA 2YWLA 4EMIA 1FOHA 2WPFA 2WP5A 3P4RA 2R9ZA 4J2WA 3SXIA 4JQ9A 4RSLA 4ECHA 5HYMA 2CVJA 3LG1A 4B67A 4ZCCA 4E0VA 4H4VA 2R46A 3RHAA 4LA1A 3LB8A 1H7XA 3MMOA 4Z26A 1L9CA 2Q0LA 1GESA 4H50A 1LQTA 2E4GA 2GR0A 2YR5A 3II4A 3NYFA 4JNQA 2XVJA 2XLPA 3CGDA 3F8DA 2YG7A 2BS4A 5KWFA 1EL7A 3RNMA 2H89A 3B3RA 4J36A 2VRLA 4A6NB 2I0ZA 3ZYXA 3DJGX 3BNGA 3AE2A 3UOZA 2A87A 4B69A 2YM2A 3NK1X 3AEGA 2AAQA 3BNFA 1OJCA 1X31B 5EBKA 2APGA 3SXQA 2C3DA 4TM0A 2GR2A 4YSYA 5KMSA 3GRSA 4O5QA 4L3ZA 1H84A 1FEAA 3AECA 1IUTA 3SFEA 2XVFA 3CIRA 2VOUA 2C70A 1Z6LA 4K8DA 2GV8A 3P9UA 4H4YA 3GMCA 1PBEA 4U8LA 1GRGA 4EM3A 2A89A 3UP4A 3P4SA 4U8NA 3BNJA 2XLUA 3NN0X 1KSUA 3NYEA 1B8SA 2V6OA 1XHCA 2XFNA 4U2LA 2Z5XA 3C96A 4K5SA 1VDCA 4PABA 4FX9A 4OPUA 1ZY8A 4C3XA 4L3YA 1P2HA 3FO3A 3UKAA 1ZDLA 2YLZA 1COYA 2GQWA 4OVIA 3VR8A 4AT0A 3DJDA 1FEBA 4AP3A 1D4DA 4FK1C 2OLOA 3UP5A 4RG4A 3GYJA 1BWCA 2X99A 3ALLA 5TR3A 3NKSA 3Q9TA 3T2ZA 2XLTA 3UTHA 5C3JA 5JCMA 1ZMCA 3CNJA 1PXCA 3GYIA 4M52A 5FS7A 3SQPA 4IV9A 1TYTA 5EOWA 5BVAA 1E39A 3DJJA 5J60A 2OT4A 2R0CA 3AEAA 4GDEA 4ZN0A 3RKHA 1QO8A 1EL8A 3PS9A 3SZ0A 3T0KA 2CFYA 4U8JA 2JBVA 2YR4A 3KU9A 2C76A 1OAHA 5KRQA 4G74A 3DK8A 1JRZA 3C4AA 2GR1A 3ALMA 3FG2P 3IC9A 1NHRA 4Z43A 3CGBA 3NH3X 1B37A 4L38A 4H2QA 4OCGA 4J31A 1XPQA 3KPFA 2C67A 4UDQA 3ISHA 1DJNA 5GRTA 1V59A 5U63A 1QLBA 4GAVA 4II2A 4EMWA 3CMMA 3NLCA 4NTEA 2HQMA 3AYJA 3UKHA 4A99A 2V3BA 3AE7A 2Y6RA 2C64A 4K7ZA 1GSNA 5U1OA 1GOSA 1NHSA 3UKFA 4H7UA 3UU9A 1F8WA 2GEWA 1GALA 4DGKA 5KXJA 2WDQA 3E1TA 4YTNA 3GRTA 1TDFA 3VR9A 1H83A 1LTXR 2E81A 4IVMB 2IVDA 1FS8A 2E1MA 1K0IA 5BRTA 2WP6A 5HY5A 5IQ1A 1LJ1A 1B5QA 2F5ZA 2AR8A 2XFUA 3K7TA 2UZZA 4Y4MA 3D1IA 1L9DA 1LPFA 1N4UA 3GSIA 4N9XA 3NN6X 4G73A 3EPTA 2YLSA 1S2QA 2GQFA 2OALA 2YVGA 4USQA 5HXIA 4Q5BA 3SZWA 3CGEA 5KOXA 4H4QA 4H2PA 4PAAA 4C74A 1YY5A 3IHGA 2V60A 4JDRA 1ZX9A 1PXAA 3NK2X 5CQFA 2VR0A 3ZDNA 4B1BA 1GRHA 2E5VA 2NPXA 2QAEA 2B9XA 1S3EA 5KVHA 1GRFA 4YWOA 2B9YA 2R45A 3L8KA 4H2NA 5J7XA 4EQWA 1GTEA 3I6DA 3NT6A 3PVCA 1PBBA 1IUSA 1H7WA 2RF7A 4U2TA
chains in the Genus database with same CATH topology
4I59A 4J56A 3QSMA 5KVIA 2RABA 4TLXA 2Z5YA 3DGZA 4CCRA 1FS9A 1LV0A 1LVLA 3H8IA 4GF7A 2GVCA 4REKA 2FJAA 3FPZA 1CL0A 2BC1A 2VRMA 3CNTA 4EQRA 3T37A 2WPEA 1VG0A 3BHKA 3UOYA 4H4PA 4NTDA 1M1RA 4Q4UA 1F3PA 4H4TA 1F8RA 3AE3A 1SP3A 2VVLA 1PJ6A 4AT2A 2X50A 4BJZA 4CBQA 5FMHA 4K2XA 3IHMA 4J34A 2PHHA 2YVJA 2QA1A 3PO7A 3UKQA 1GRAA 3KLJA 2WETA 1TDKA 3M12A 3AE9A 3DK4A 1GETA 2H88A 2EQ6A 3H4KA 3NYCA 2CDUA 2YLTA 4Q0TA 1DXLA 1NDAA 2J3NA 1IUUA 2BXRA 2VVLG 2X8CA 3DJEA 3ICRA 4EIQA 3DK9A 2YG3A 3K7QX 4A5LA 3F8PA 1E1MA 4C3YA 4KPRA 5GSNA 2BK3A 1CJ4A 2TPRA 2YAUA 3DH9A 3WE0A 2YG5A 2R4EA 4G9KA 4HA6A 3L1TA 1CC6A 3TORA 1ONFA 3UBRA 3BNMA 3G5QA 1N1PA 3GD3A 2XVHA 3T14A 1M6IA 1GPEA 2X8HA 1ZOYA 3BI5A 3AYLA 1CF3A 2OAMA 4U8MA 5FS8A 1KSSA 4GDPA 1VQWA 3CN8A 1TDOA 1K0LA 1E7PA 1OJTA 2GAGB 3UOVA 1BVBA 2AQJA 3D8XA 4NWZA 4CNKA 2ACZA 1EL9A 2XVIA 3Q6JA 4YTMA 4U8IA 2NVKX 1D5TA 2C65A 4RG3A 4HB9A 4Z2TA 1QJDA 4CNJA 3LGQA 5FS6A 1D7LA 3I3LA 4CY8A 1DODA 2JK6A 4Z2RA 2V5ZA 3D1CA 2VQBA 2WP9A 4A9WA 2Q7VA 2C3CA 1E1LA 4LIIA 4X9NA 3UTGA 2J7AA 3LXDA 3LZXA 1FCDA 4X9MA 4EQXA 1BF3A 3G5SA 3GM6A 5C2TA 3AEBA 3BNUA 4EMJA 3SX6A 1DJQA 3ADAB 3UTEA 4IA6A 3CNPA 1IUWA 4APNA 3COXA 3AD7B 1QDBA 1L9EA 1REOA 2WOWA 2X3NA 2FJEA 2Q0KA 4GRTA 2XVEA 4JY2A 3AWIA 3BI2A 3VQRA 1D7YA 1OJ9A 1CBOA 1PBDA 1W4XA 3FBSA 2JB1A 5M10A 3FMWA 2ARDA 1TRBA 2BK5A 4ICYA 2BK4A 1NENA 1XDIA 2OA1A 1IUVA 2ZZCA 1GU6A 1GNDA 3AE8A 3HYWA 4G6GA 4CY6A 4D03A 4NEWA 2JKCA 3AXBA 5KMQA 3BHFA 3QVRA 5U25A 1ZKQA 4FDCB 3AYIA 1JOAA 2BA9A 2IVEA 3P1WA 1H81A 3CPJG 3QFAA 3S7WA 1PS9A 2YM1A 1RSGA 2EQ9A 4OPTA 1NAAA 4GAPA 3URHA 4ZCDA 2DKIA 2WHDA 2FJDA 4Y4NA 3NG7X 1Y0PA 3IWAA 5JCKA 3GWFA 3AE5A 4Z44A 4GCMA 1E1KA 3F29A 1GV4A 4XWRA 2QCUA 4GR1A 3CGCA 2ZO5A 3NHOX 4Z2UA 5JCNA 3K30A 3EANA 2JB3A 5BUKA 3NRNA 2R4JA 1JNRA 2WDVA 3OWMA 1TYPA 3AE4A 3LZWA 2EQ8A 3O0HA 1N4WA 1OJDA 3ICTA 2GF3A 2YLXA 3CNSA 3C4NA 3GDPA 5DBJA 3SCEA 1Y56A 3VRAA 4Q1OA 3V3OA 1BZLA 5FS9A 3RP6A 1ZMDA 2BC0A 1UKVG 2EQ7A 3P4QA 3S5WA 3HZLA 4H4WA 4OPIA 4Y4LA 3SZFA 3RP7A 1MOKA 2BRAA 4BK2A 1PBFA 2Q6UA 2B7RA 4BK1A 3BI4A 3NK0X 1XANA 3SM8A 5ER0A 1PXBA 1PJ7A 2YQUA 1SEZA 1GREA 2YR6A 3RP8A 4YXDA 3S61A 3ALJA 1DOEA 1Q1RA 2WOIA 3B6DA 1MO9A 4OPGA 2WEUA 2X8GA 4NNJA 4H4ZA 2O9ZA 2XFOA 4YKGA 2V3AA 4JY3A 3QSEA 2TMDA 1GEUA 4LU6A 1K0JA 3GD4A 4EIPA 4Z25A 1ZOVA 2WOVA 3NNEA 1D4CA 2BABA 5IPYA 1FT5A 1CC4A 4UP3A 3LJPA 4YKFA 1NG3A 4XXGA 3KKJA 1H86A 3ATRA 3NGCX 1Q1WA 3AE1A 4EM4A 1KFYA 1GRBA 2GMHA 1O94A 1TDNA 4AP1A 1IUXA 4YT0A 1AOGA 2C66A 2YLRA 4J33A 3ATQA 4KX6A 4GUVA 1EL5A 1KDGA 2BRYA 3REDA 2XLSA 2A8XA 4TM4A 2ZZBA 4Z24A 3SYIA 2QA2A 4OPDA 4P9SA 3CNDA 2Y6QA 1PBCA 3CPHG 2E80A 1YQ3A 3KD9A 4B66A 4TLZA 3GMBA 4B68A 1KF6A 4O5UA 2GH5A 4UDRA 4H4RA 4J57A 1S2YA 4K22A 5KOWA 1CJCA 1K4QA 1NEKA 3ABVA 1PHHA 4UDPA 5L46A 3CPIG 1CJ3A 1N4VA 2GAHB 2XFPA 2C75A 3NTAA 3QFBA 4WJYA 4H4SA 4A7AA 1OJAA 3UKKA 3L1RA 4MJWA 2WU2A 1FT6A 1BGNA 4B65A 1PN0A 1GT8A 4Q5CA 4XWZA 4BK3A 2BCGG 1RYIA 1DOBA 3T2YA 2XCGA 3AEDA 4OPLA 3CTYA 2K3VA 3HYVA 3HYXA 1PJ5A 3UCLA 3H8LA 3IF9A 1NHQA 4L3XA 1BGJA 2C72A 2CULA 4BURA 2GRTA 1M64A 3F8RA 3OC4A 1CC2A 1GRTA 1M1QA 2WS3A 1HYUA 4TM1A 1KNRA 3V3NA 4IVOB 1F6MA 2WBAA 3AD8B 1JNIA 5LV9A 1Y56B 2WQYA 2ZBWA 4B64A 4Q17A 4DSHA 3LADA 1MXTA 5HHFA 3GYXA 1RP0A 3QVPA 4FK1A 4U2SA 3T2KA 2ZZ0A 3DMEA 3BNHA 4H2RA 1GERA 5JCIA 3JSKA 4WX1A 3G5RA 2BCPA 1H6VA 1TDEA 3SZCA 4AOXA 1D4EA 1O5WA 1H82A 1FL2A 1LQUA 1NPXA 3GDNA 3SY4A 3UOXA 1DOCA 4YSXA 4I58A 2FBWA 1FECA 2LFCA 3KPKA 1GTHA 4U8OA 3M0OA 3AE6A 2OLNA 2XYOA 1JRXA 1YQ4A 1IJHA 3AEEA 3SFDA 1BKWA 2C7GA 2RGOA 1ZP0A 3VRDB 4YSZA 3TTBA 3ITJA 2VVMA 4D04A 1Q9IA 1ELIA 2XDOA 4A6NA 1L0VA 5EB4A 3ICSA 5JCLA 3DA1A 2WPCA 4WCTA 5BULA 3T31A 2YG4A 4NEVA 1B4VA 4USRA 3DGHA 1DNCA 1P2EA 4BJYA 4A79A 3UKLA 4ADWA 4EQSA 4U8PA 5KMRA 2BACA 1EBDA 2YVFA 4DSGA 4BV6A 2IIDA 4IA5A 1F8SA 3AB1A 3UKPA 4AOSA 4YSHA 2V61A 3UTFA 1FS7A 3OZ2A 1ZK7A 4CCQA 4OPCA 4TM3A 3AD9B 2BS3A 2C4CA 5KMPA 4YTPA 5KNLA 2R0GA 3K7MX 2WDRA 3KA7A 2RGJA 2RDZA 3QJ4A 3EF6A 5EB5A 4DNAA 1CJ2A 3LOVA 1VRQB 4II3A 1JU2A 2PYXA 2JB2A 3AEFA 5CKUA 4H4UA 1E6EA 3P4PA 1YQZA 2DKHA 3NTDA 2B76A 3QSSA 4G6HA 3V76A 3FIMB 4JN9A 2RGHA 2VZ2A 2XFQA 5M0ZA 1JEHA 2GB0A 4JNAA 1S3BA 2R0PA 1KNPA 4C77A 1JRYA 4CRTA 1NHPA 4A65A 3M13A 1JNZA 2GR3A 2W0HA 2YG6A 1PDHA 1YKJA 1M1PA 1O95A 2WESA 4U8KA 1CHUA 1E1NA 1NG4A 1GXFA 2BYBA 2FJBA 2YLWA 4K5RA 3VRBA 2XLRA 2BXSA 1VG9A 2VQ7A 2JAEA 2WU5A 3EAOA 3KVEA 4NZHA 4X4JA 5IQ4A 2B9WA 3GWDA 4C5OA 2BS2A 3SGLA 3R9UA 4H4XA 3NIXA 2B7SA 4B63A 4NTCA 2C73A 2GMJA 2YWLA 4EMIA 1FOHA 2WPFA 2WP5A 3P4RA 2R9ZA 4J2WA 3SXIA 4JQ9A 4RSLA 4ECHA 5HYMA 2CVJA 3LG1A 4B67A 4ZCCA 4E0VA 4H4VA 2R46A 3RHAA 4LA1A 3LB8A 1H7XA 3MMOA 4Z26A 1L9CA 2Q0LA 1GESA 4H50A 1LQTA 2E4GA 2GR0A 2YR5A 3II4A 3NYFA 4JNQA 2XVJA 2XLPA 3CGDA 3F8DA 2YG7A 2BS4A 5KWFA 1EL7A 3RNMA 2H89A 3B3RA 4J36A 2VRLA 4A6NB 2I0ZA 3ZYXA 3DJGX 3BNGA 3AE2A 3UOZA 2A87A 4B69A 2YM2A 3NK1X 3AEGA 2AAQA 3BNFA 1OJCA 1X31B 5EBKA 2APGA 3SXQA 2C3DA 4TM0A 2GR2A 4YSYA 5KMSA 3GRSA 4O5QA 4L3ZA 1H84A 1FEAA 3AECA 1IUTA 3SFEA 2XVFA 3CIRA 2VOUA 2C70A 1Z6LA 4K8DA 2GV8A 3P9UA 4H4YA 3GMCA 1PBEA 4U8LA 1GRGA 4EM3A 2A89A 3UP4A 3P4SA 4U8NA 3BNJA 2XLUA 3NN0X 1KSUA 3NYEA 1B8SA 2V6OA 1XHCA 2XFNA 4U2LA 2Z5XA 3C96A 4K5SA 1VDCA 4PABA 4FX9A 4OPUA 1ZY8A 4C3XA 4L3YA 1P2HA 3FO3A 3UKAA 1ZDLA 2YLZA 1COYA 2GQWA 4OVIA 3VR8A 4AT0A 3DJDA 1FEBA 4AP3A 1D4DA 4FK1C 2OLOA 3UP5A 4RG4A 3GYJA 1BWCA 2X99A 3ALLA 5TR3A 3NKSA 3Q9TA 3T2ZA 2XLTA 3UTHA 5C3JA 5JCMA 1ZMCA 3CNJA 1PXCA 3GYIA 4M52A 5FS7A 3SQPA 4IV9A 1TYTA 5EOWA 5BVAA 1E39A 3DJJA 5J60A 2OT4A 2R0CA 3AEAA 4GDEA 4ZN0A 3RKHA 1QO8A 1EL8A 3PS9A 3SZ0A 3T0KA 2CFYA 4U8JA 2JBVA 2YR4A 3KU9A 2C76A 1OAHA 5KRQA 4G74A 3DK8A 1JRZA 3C4AA 2GR1A 3ALMA 3FG2P 3IC9A 1NHRA 4Z43A 3CGBA 3NH3X 1B37A 4L38A 4H2QA 4OCGA 4J31A 1XPQA 3KPFA 2C67A 4UDQA 3ISHA 1DJNA 5GRTA 1V59A 5U63A 1QLBA 4GAVA 4II2A 4EMWA 3CMMA 3NLCA 4NTEA 2HQMA 3AYJA 3UKHA 4A99A 2V3BA 3AE7A 2Y6RA 2C64A 4K7ZA 1GSNA 5U1OA 1GOSA 1NHSA 3UKFA 4H7UA 3UU9A 1F8WA 2GEWA 1GALA 4DGKA 5KXJA 2WDQA 3E1TA 4YTNA 3GRTA 1TDFA 3VR9A 1H83A 1LTXR 2E81A 4IVMB 2IVDA 1FS8A 2E1MA 1K0IA 5BRTA 2WP6A 5HY5A 5IQ1A 1LJ1A 1B5QA 2F5ZA 2AR8A 2XFUA 3K7TA 2UZZA 4Y4MA 3D1IA 1L9DA 1LPFA 1N4UA 3GSIA 4N9XA 3NN6X 4G73A 3EPTA 2YLSA 1S2QA 2GQFA 2OALA 2YVGA 4USQA 5HXIA 4Q5BA 3SZWA 3CGEA 5KOXA 4H4QA 4H2PA 4PAAA 4C74A 1YY5A 3IHGA 2V60A 4JDRA 1ZX9A 1PXAA 3NK2X 5CQFA 2VR0A 3ZDNA 4B1BA 1GRHA 2E5VA 2NPXA 2QAEA 2B9XA 1S3EA 5KVHA 1GRFA 4YWOA 2B9YA 2R45A 3L8KA 4H2NA 5J7XA 4EQWA 1GTEA 3I6DA 3NT6A 3PVCA 1PBBA 1IUSA 1H7WA 2RF7A 4U2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I59 A;  4J56 A;  3QSM A;  5KVI A;  2RAB A;  4TLX A;  2Z5Y A;  3DGZ A;  4CCR A;  1FS9 A;  1LV0 A;  1LVL A;  3H8I A;  4GF7 A;  2GVC A;  4REK A;  2FJA A;  3FPZ A;  1CL0 A;  2BC1 A;  2VRM A;  3CNT A;  4EQR A;  3T37 A;  2WPE A;  1VG0 A;  3BHK A;  3UOY A;  4H4P A;  4NTD A;  1M1R A;  4Q4U A;  1F3P A;  4H4T A;  1F8R A;  3AE3 A;  1SP3 A;  2VVL A;  1PJ6 A;  4AT2 A;  2X50 A;  4BJZ A;  4CBQ A;  5FMH A;  4K2X A;  3IHM A;  4J34 A;  2PHH A;  2YVJ A;  2QA1 A;  3PO7 A;  3UKQ A;  1GRA A;  3KLJ A;  2WET A;  1TDK A;  3M12 A;  3AE9 A;  3DK4 A;  1GET A;  2H88 A;  2EQ6 A;  3H4K A;  3NYC A;  2CDU A;  2YLT A;  4Q0T A;  1DXL A;  1NDA A;  2J3N A;  1IUU A;  2BXR A;  2VVL G;  2X8C A;  3DJE A;  3ICR A;  4EIQ A;  3DK9 A;  2YG3 A;  3K7Q X;  4A5L A;  3F8P A;  1E1M A;  4C3Y A;  4KPR A;  5GSN A;  2BK3 A;  1CJ4 A;  2TPR A;  2YAU A;  3DH9 A;  3WE0 A;  2YG5 A;  2R4E A;  4HA6 A;  3L1T A;  1CC6 A;  3TOR A;  1ONF A;  3UBR A;  3BNM A;  3G5Q A;  1N1P A;  3GD3 A;  2XVH A;  1M6I A;  1GPE A;  2X8H A;  1ZOY A;  3BI5 A;  3AYL A;  1CF3 A;  2OAM A;  4U8M A;  5FS8 A;  1KSS A;  4GDP A;  1VQW A;  3CN8 A;  1TDO A;  1K0L A;  1E7P A;  1OJT A;  2GAG B;  3UOV A;  1BVB A;  2AQJ A;  3D8X A;  4CNK A;  2ACZ A;  1EL9 A;  2XVI A;  3Q6J A;  4YTM A;  4U8I A;  2NVK X;  1D5T A;  2C65 A;  4RG3 A;  4HB9 A;  4Z2T A;  1QJD A;  4CNJ A;  3LGQ A;  5FS6 A;  1D7L A;  3I3L A;  4CY8 A;  1DOD A;  2JK6 A;  4Z2R A;  2V5Z A;  3D1C A;  2VQB A;  2WP9 A;  4A9W A;  2Q7V A;  2C3C A;  1E1L A;  4LII A;  4X9N A;  3UTG A;  2J7A A;  3LXD A;  3LZX A;  1FCD A;  4X9M A;  4EQX A;  1BF3 A;  3G5S A;  3GM6 A;  5C2T A;  3AEB A;  3BNU A;  4EMJ A;  1DJQ A;  3ADA B;  3UTE A;  4IA6 A;  3CNP A;  1IUW A;  4APN A;  3COX A;  3AD7 B;  1QDB A;  1L9E A;  1REO A;  2WOW A;  2X3N A;  2FJE A;  2Q0K A;  4GRT A;  2XVE A;  4JY2 A;  3AWI A;  3BI2 A;  3VQR A;  1D7Y A;  1OJ9 A;  1CBO A;  1PBD A;  1W4X A;  3FBS A;  2JB1 A;  5M10 A;  3FMW A;  2ARD A;  1TRB A;  2BK5 A;  4ICY A;  2BK4 A;  1NEN A;  1XDI A;  2OA1 A;  1IUV A;  2ZZC A;  1GU6 A;  1GND A;  3AE8 A;  4RSL A;  4CY6 A;  4D03 A;  4NEW A;  2JKC A;  3AXB A;  3BHF A;  3QVR A;  5U25 A;  1ZKQ A;  4FDC B;  3AYI A;  1JOA A;  2BA9 A;  2IVE A;  3P1W A;  1H81 A;  3CPJ G;  3QFA A;  3S7W A;  1PS9 A;  2YM1 A;  1RSG A;  2EQ9 A;  4OPT A;  1NAA A;  3URH A;  4ZCD A;  2DKI A;  2WHD A;  2FJD A;  4Y4N A;  3NG7 X;  1Y0P A;  3IWA A;  5JCK A;  3GWF A;  3AE5 A;  4Z44 A;  4GCM A;  1E1K A;  3F29 A;  1GV4 A;  4XWR A;  2QCU A;  4GR1 A;  3CGC A;  2ZO5 A;  3NHO X;  4Z2U A;  5JCN A;  3K30 A;  3EAN A;  2JB3 A;  5BUK A;  3NRN A;  2R4J A;  1JNR A;  2WDV A;  3OWM A;  1TYP A;  3AE4 A;  3LZW A;  2EQ8 A;  3O0H A;  1N4W A;  1OJD A;  3ICT A;  2GF3 A;  2YLX A;  3CNS A;  3C4N A;  3GDP A;  5DBJ A;  3SCE A;  1Y56 A;  3VRA A;  4Q1O A;  3V3O A;  1BZL A;  5FS9 A;  3RP6 A;  1ZMD A;  2BC0 A;  1UKV G;  2EQ7 A;  3P4Q A;  3S5W A;  3HZL A;  4H4W A;  4OPI A;  4Y4L A;  3RP7 A;  1MOK A;  4BK2 A;  1PBF A;  2Q6U A;  2B7R A;  4BK1 A;  3BI4 A;  3NK0 X;  1XAN A;  3SM8 A;  5ER0 A;  1PXB A;  1PJ7 A;  2YQU A;  1SEZ A;  1GRE A;  2YR6 A;  3RP8 A;  4YXD A;  3S61 A;  3ALJ A;  1DOE A;  1Q1R A;  2WOI A;  3B6D A;  1MO9 A;  4OPG A;  2WEU A;  2X8G A;  4H4Z A;  2O9Z A;  2XFO A;  4YKG A;  2V3A A;  4JY3 A;  3QSE A;  2TMD A;  1GEU A;  4LU6 A;  1K0J A;  3GD4 A;  4EIP A;  4Z25 A;  1ZOV A;  2WOV A;  3NNE A;  1D4C A;  2BAB A;  5IPY A;  1FT5 A;  1CC4 A;  4UP3 A;  3LJP A;  4YKF A;  1NG3 A;  4XXG A;  3KKJ A;  1H86 A;  3ATR A;  3NGC X;  1Q1W A;  3AE1 A;  4EM4 A;  1KFY A;  1GRB A;  2GMH A;  1O94 A;  1TDN A;  4AP1 A;  1IUX A;  4YT0 A;  1AOG A;  2C66 A;  2YLR A;  4J33 A;  3ATQ A;  4KX6 A;  4GUV A;  1EL5 A;  1KDG A;  3RED A;  2XLS A;  2A8X A;  4TM4 A;  2ZZB A;  4Z24 A;  2QA2 A;  4OPD A;  4P9S A;  3CND A;  2Y6Q A;  1PBC A;  3CPH G;  2E80 A;  1YQ3 A;  3KD9 A;  4B66 A;  4TLZ A;  3GMB A;  4B68 A;  1KF6 A;  4O5U A;  2GH5 A;  4UDR A;  4H4R A;  4J57 A;  1S2Y A;  4K22 A;  5KOW A;  1CJC A;  1K4Q A;  1NEK A;  3ABV A;  1PHH A;  4UDP A;  5L46 A;  3CPI G;  1CJ3 A;  1N4V A;  2GAH B;  2XFP A;  2C75 A;  3NTA A;  3QFB A;  4WJY A;  4H4S A;  4A7A A;  1OJA A;  3UKK A;  3L1R A;  4MJW A;  2WU2 A;  1FT6 A;  1BGN A;  4B65 A;  1PN0 A;  1GT8 A;  4Q5C A;  4XWZ A;  4BK3 A;  2BCG G;  1RYI A;  1DOB A;  2XCG A;  3AED A;  4OPL A;  3CTY A;  2K3V A;  1PJ5 A;  3UCL A;  3H8L A;  3IF9 A;  1NHQ A;  4L3X A;  1BGJ A;  2C72 A;  2CUL A;  4BUR A;  2GRT A;  1M64 A;  3F8R A;  3OC4 A;  1CC2 A;  1GRT A;  1M1Q A;  2WS3 A;  1HYU A;  4TM1 A;  1KNR A;  3V3N A;  4IVO B;  1F6M A;  2WBA A;  3AD8 B;  1JNI A;  5LV9 A;  1Y56 B;  2WQY A;  2ZBW A;  4B64 A;  4Q17 A;  4DSH A;  3LAD A;  1MXT A;  5HHF A;  3QVP A;  1RP0 A;  3GYX A;  4FK1 A;  4U2S A;  2ZZ0 A;  3DME A;  3BNH A;  4H2R A;  1GER A;  5JCI A;  3JSK A;  4WX1 A;  3G5R A;  2BCP A;  1H6V A;  1TDE A;  4AOX A;  1D4E A;  1O5W A;  1H82 A;  1FL2 A;  1LQU A;  1NPX A;  3GDN A;  4YSX A;  3UOX A;  1DOC A;  4I58 A;  2FBW A;  1FEC A;  2LFC A;  1GTH A;  4U8O A;  3M0O A;  3AE6 A;  2OLN A;  2XYO A;  1JRX A;  1YQ4 A;  1IJH A;  3AEE A;  3SFD A;  1BKW A;  2C7G A;  2RGO A;  1ZP0 A;  3VRD B;  4YSZ A;  3TTB A;  3ITJ A;  2VVM A;  4D04 A;  1Q9I A;  1ELI A;  2XDO A;  4A6N A;  1L0V A;  5EB4 A;  3ICS A;  5JCL A;  3DA1 A;  2WPC A;  4WCT A;  5BUL A;  2YG4 A;  4NEV A;  1B4V A;  4USR A;  3DGH A;  1DNC A;  1P2E A;  4BJY A;  4A79 A;  3UKL A;  4ADW A;  4EQS A;  4U8P A;  2BAC A;  1EBD A;  2YVF A;  4DSG A;  4BV6 A;  2IID A;  4IA5 A;  1F8S A;  3AB1 A;  3UKP A;  4AOS A;  4YSH A;  2V61 A;  3UTF A;  1FS7 A;  3OZ2 A;  1ZK7 A;  4CCQ A;  4OPC A;  4TM3 A;  3AD9 B;  2BS3 A;  4YTP A;  2R0G A;  3K7M X;  2WDR A;  3KA7 A;  2RGJ A;  2RDZ A;  3QJ4 A;  3EF6 A;  5EB5 A;  4DNA A;  1CJ2 A;  3LOV A;  1VRQ B;  1JU2 A;  2PYX A;  2JB2 A;  3AEF A;  5CKU A;  4H4U A;  1E6E A;  3P4P A;  1YQZ A;  2DKH A;  3NTD A;  2B76 A;  3QSS A;  3V76 A;  3FIM B;  4JN9 A;  2RGH A;  2VZ2 A;  2XFQ A;  5M0Z A;  1JEH A;  2GB0 A;  4JNA A;  1S3B A;  2R0P A;  1KNP A;  4C77 A;  1JRY A;  4CRT A;  1NHP A;  4A65 A;  3M13 A;  1JNZ A;  2GR3 A;  2W0H A;  2YG6 A;  1PDH A;  1YKJ A;  1M1P A;  1O95 A;  2WES A;  4U8K A;  1CHU A;  1E1N A;  1NG4 A;  1GXF A;  2BYB A;  2FJB A;  2YLW A;  4K5R A;  3VRB A;  2XLR A;  2BXS A;  1VG9 A;  2VQ7 A;  2JAE A;  2WU5 A;  3EAO A;  3KVE A;  4NZH A;  4X4J A;  5IQ4 A;  2B9W A;  3GWD A;  4C5O A;  2BS2 A;  3SGL A;  3R9U A;  4H4X A;  3NIX A;  2B7S A;  4B63 A;  4NTC A;  2C73 A;  2GMJ A;  2YWL A;  4EMI A;  1FOH A;  2WPF A;  2WP5 A;  3P4R A;  2R9Z A;  4J2W A;  4JQ9 A;  4ECH A;  5HYM A;  2CVJ A;  3LG1 A;  4B67 A;  4ZCC A;  4E0V A;  4H4V A;  2R46 A;  3RHA A;  4LA1 A;  3LB8 A;  1H7X A;  3MMO A;  4Z26 A;  1L9C A;  2Q0L A;  1GES A;  4H50 A;  1LQT A;  2E4G A;  2GR0 A;  2YR5 A;  3II4 A;  3NYF A;  4JNQ A;  2XVJ A;  2XLP A;  3CGD A;  3F8D A;  2YG7 A;  2BS4 A;  5KWF A;  1EL7 A;  3RNM A;  2H89 A;  3B3R A;  4J36 A;  2VRL A;  4A6N B;  2I0Z A;  3ZYX A;  3DJG X;  3BNG A;  3AE2 A;  3UOZ A;  2A87 A;  4B69 A;  2YM2 A;  3NK1 X;  3AEG A;  2AAQ A;  3BNF A;  1OJC A;  1X31 B;  5EBK A;  2APG A;  3SXQ A;  2C3D A;  4TM0 A;  2GR2 A;  4YSY A;  3GRS A;  4O5Q A;  4L3Z A;  1H84 A;  1FEA A;  3AEC A;  1IUT A;  3SFE A;  2XVF A;  3CIR A;  2VOU A;  2C70 A;  1Z6L A;  4K8D A;  2GV8 A;  3P9U A;  4H4Y A;  3GMC A;  1PBE A;  4U8L A;  1GRG A;  4EM3 A;  2A89 A;  3UP4 A;  3P4S A;  4U8N A;  3BNJ A;  2XLU A;  3NN0 X;  1KSU A;  3NYE A;  1B8S A;  2V6O A;  1XHC A;  2XFN A;  4U2L A;  2Z5X A;  3C96 A;  4K5S A;  1VDC A;  4PAB A;  4FX9 A;  4OPU A;  1ZY8 A;  4C3X A;  4L3Y A;  1P2H A;  3FO3 A;  3UKA A;  1ZDL A;  2YLZ A;  1COY A;  2GQW A;  4OVI A;  3VR8 A;  4AT0 A;  3DJD A;  1FEB A;  4AP3 A;  1D4D A;  4FK1 C;  2OLO A;  3UP5 A;  4RG4 A;  3GYJ A;  1BWC A;  2X99 A;  3ALL A;  5TR3 A;  3NKS A;  3Q9T A;  2XLT A;  3UTH A;  5C3J A;  5JCM A;  1ZMC A;  3CNJ A;  1PXC A;  3GYI A;  4M52 A;  5FS7 A;  3SQP A;  4IV9 A;  1TYT A;  5EOW A;  5BVA A;  1E39 A;  3DJJ A;  5J60 A;  2OT4 A;  2R0C A;  3AEA A;  4GDE A;  4ZN0 A;  3RKH A;  1QO8 A;  1EL8 A;  3PS9 A;  2CFY A;  4U8J A;  2JBV A;  2YR4 A;  3KU9 A;  2C76 A;  1OAH A;  5KRQ A;  3DK8 A;  1JRZ A;  3C4A A;  2GR1 A;  3ALM A;  3FG2 P;  3IC9 A;  1NHR A;  4Z43 A;  3CGB A;  3NH3 X;  1B37 A;  4L38 A;  4H2Q A;  4OCG A;  4J31 A;  1XPQ A;  3KPF A;  2C67 A;  4UDQ A;  3ISH A;  1DJN A;  5GRT A;  1V59 A;  5U63 A;  1QLB A;  4EMW A;  3NLC A;  4NTE A;  2HQM A;  3AYJ A;  3UKH A;  4A99 A;  2V3B A;  3AE7 A;  2Y6R A;  2C64 A;  4K7Z A;  1GSN A;  5U1O A;  1GOS A;  1NHS A;  3UKF A;  4H7U A;  3UU9 A;  1F8W A;  2GEW A;  1GAL A;  4DGK A;  5KXJ A;  2WDQ A;  3E1T A;  4YTN A;  3GRT A;  1TDF A;  3VR9 A;  1H83 A;  1LTX R;  2E81 A;  4IVM B;  2IVD A;  1FS8 A;  2E1M A;  1K0I A;  5BRT A;  2WP6 A;  5HY5 A;  5IQ1 A;  1LJ1 A;  1B5Q A;  2F5Z A;  2AR8 A;  2XFU A;  3K7T A;  2UZZ A;  4Y4M A;  3D1I A;  1L9D A;  1LPF A;  1N4U A;  3GSI A;  4N9X A;  3NN6 X;  3EPT A;  2YLS A;  1S2Q A;  2GQF A;  2OAL A;  2YVG A;  4USQ A;  5HXI A;  4Q5B A;  3CGE A;  5KOX A;  4H4Q A;  4H2P A;  4PAA A;  4C74 A;  1YY5 A;  3IHG A;  2V60 A;  4JDR A;  1ZX9 A;  1PXA A;  3NK2 X;  5CQF A;  2VR0 A;  3ZDN A;  4B1B A;  1GRH A;  2E5V A;  2NPX A;  2QAE A;  2B9X A;  1S3E A;  5KVH A;  1GRF A;  4YWO A;  2B9Y A;  2R45 A;  3L8K A;  4H2N A;  5J7X A;  4EQW A;  1GTE A;  3I6D A;  3NT6 A;  3PVC A;  1PBB A;  1IUS A;  1H7W A;  2RF7 A;  4U2T A; 
#chains in the Genus database with same CATH topology
 4I59 A;  4J56 A;  3QSM A;  5KVI A;  2RAB A;  4TLX A;  2Z5Y A;  3DGZ A;  4CCR A;  1FS9 A;  1LV0 A;  1LVL A;  3H8I A;  4GF7 A;  2GVC A;  4REK A;  2FJA A;  3FPZ A;  1CL0 A;  2BC1 A;  2VRM A;  3CNT A;  4EQR A;  3T37 A;  2WPE A;  1VG0 A;  3BHK A;  3UOY A;  4H4P A;  4NTD A;  1M1R A;  4Q4U A;  1F3P A;  4H4T A;  1F8R A;  3AE3 A;  1SP3 A;  2VVL A;  1PJ6 A;  4AT2 A;  2X50 A;  4BJZ A;  4CBQ A;  5FMH A;  4K2X A;  3IHM A;  4J34 A;  2PHH A;  2YVJ A;  2QA1 A;  3PO7 A;  3UKQ A;  1GRA A;  3KLJ A;  2WET A;  1TDK A;  3M12 A;  3AE9 A;  3DK4 A;  1GET A;  2H88 A;  2EQ6 A;  3H4K A;  3NYC A;  2CDU A;  2YLT A;  4Q0T A;  1DXL A;  1NDA A;  2J3N A;  1IUU A;  2BXR A;  2VVL G;  2X8C A;  3DJE A;  3ICR A;  4EIQ A;  3DK9 A;  2YG3 A;  3K7Q X;  4A5L A;  3F8P A;  1E1M A;  4C3Y A;  4KPR A;  5GSN A;  2BK3 A;  1CJ4 A;  2TPR A;  2YAU A;  3DH9 A;  3WE0 A;  2YG5 A;  2R4E A;  4G9K A;  4HA6 A;  3L1T A;  1CC6 A;  3TOR A;  1ONF A;  3UBR A;  3BNM A;  3G5Q A;  1N1P A;  3GD3 A;  2XVH A;  3T14 A;  1M6I A;  1GPE A;  2X8H A;  1ZOY A;  3BI5 A;  3AYL A;  1CF3 A;  2CZS A;  2OAM A;  4U8M A;  5FS8 A;  1KSS A;  4GDP A;  1VQW A;  3CN8 A;  1TDO A;  1K0L A;  1E7P A;  1OJT A;  2GAG B;  3UOV A;  1BVB A;  2AQJ A;  3D8X A;  4NWZ A;  4CNK A;  2ACZ A;  1EL9 A;  2XVI A;  3Q6J A;  4YTM A;  4U8I A;  2NVK X;  1D5T A;  2C65 A;  4RG3 A;  4HB9 A;  4Z2T A;  1QJD A;  4CNJ A;  3LGQ A;  5FS6 A;  1D7L A;  3I3L A;  4CY8 A;  1DOD A;  2JK6 A;  4Z2R A;  2V5Z A;  3D1C A;  2VQB A;  2WP9 A;  4A9W A;  2Q7V A;  2C3C A;  1E1L A;  4LII A;  4X9N A;  3UTG A;  2J7A A;  3LXD A;  3LZX A;  1FCD A;  4X9M A;  4EQX A;  1BF3 A;  3G5S A;  3GM6 A;  5C2T A;  3AEB A;  3BNU A;  4EMJ A;  3SX6 A;  1DJQ A;  3ADA B;  3UTE A;  4IA6 A;  3CNP A;  1IUW A;  4APN A;  3COX A;  3AD7 B;  1QDB A;  1L9E A;  1REO A;  2WOW A;  2X3N A;  2FJE A;  2Q0K A;  4GRT A;  2XVE A;  4JY2 A;  3AWI A;  3BI2 A;  3VQR A;  1D7Y A;  1OJ9 A;  1CBO A;  1PBD A;  1W4X A;  3FBS A;  2JB1 A;  5M10 A;  3FMW A;  2ARD A;  1TRB A;  2BK5 A;  4ICY A;  2BK4 A;  1NEN A;  1XDI A;  2OA1 A;  1IUV A;  2ZZC A;  1GU6 A;  1GND A;  3AE8 A;  3HYW A;  4G6G A;  4CY6 A;  4D03 A;  4NEW A;  2JKC A;  3AXB A;  5KMQ A;  3BHF A;  3QVR A;  5U25 A;  1ZKQ A;  4FDC B;  3AYI A;  1JOA A;  2BA9 A;  2IVE A;  3P1W A;  1H81 A;  3CPJ G;  3QFA A;  3S7W A;  1PS9 A;  2YM1 A;  1RSG A;  2EQ9 A;  4OPT A;  1NAA A;  4GAP A;  3URH A;  4ZCD A;  2DKI A;  2WHD A;  2FJD A;  4Y4N A;  3NG7 X;  1Y0P A;  3IWA A;  5JCK A;  3GWF A;  3AE5 A;  4Z44 A;  4GCM A;  1E1K A;  3F29 A;  1GV4 A;  4XWR A;  2QCU A;  4GR1 A;  3CGC A;  2ZO5 A;  3NHO X;  4Z2U A;  5JCN A;  3K30 A;  3EAN A;  2JB3 A;  5BUK A;  3NRN A;  2R4J A;  1JNR A;  2WDV A;  3OWM A;  1TYP A;  3AE4 A;  3LZW A;  2EQ8 A;  3O0H A;  1N4W A;  1OJD A;  3ICT A;  2GF3 A;  2YLX A;  3CNS A;  3C4N A;  3GDP A;  5DBJ A;  3SCE A;  1Y56 A;  3VRA A;  4Q1O A;  3V3O A;  1BZL A;  5FS9 A;  3RP6 A;  1ZMD A;  2BC0 A;  1UKV G;  2EQ7 A;  3P4Q A;  3S5W A;  3HZL A;  4H4W A;  4OPI A;  4Y4L A;  3SZF A;  3RP7 A;  1MOK A;  2BRA A;  4BK2 A;  1PBF A;  2Q6U A;  2B7R A;  4BK1 A;  3BI4 A;  3NK0 X;  1XAN A;  3SM8 A;  5ER0 A;  1PXB A;  1PJ7 A;  2YQU A;  1SEZ A;  1GRE A;  2YR6 A;  3RP8 A;  4YXD A;  3S61 A;  3ALJ A;  1DOE A;  1Q1R A;  2WOI A;  3B6D A;  1MO9 A;  4OPG A;  2WEU A;  2X8G A;  4NNJ A;  4H4Z A;  2O9Z A;  2XFO A;  4YKG A;  2V3A A;  4JY3 A;  3QSE A;  2TMD A;  1GEU A;  4LU6 A;  1K0J A;  3GD4 A;  4EIP A;  4Z25 A;  1ZOV A;  2WOV A;  3NNE A;  1D4C A;  2BAB A;  5IPY A;  1FT5 A;  1CC4 A;  4UP3 A;  3LJP A;  4YKF A;  1NG3 A;  4XXG A;  3KKJ A;  1H86 A;  3ATR A;  3NGC X;  1Q1W A;  3AE1 A;  4EM4 A;  1KFY A;  1GRB A;  2GMH A;  1O94 A;  1TDN A;  4AP1 A;  1IUX A;  4YT0 A;  1AOG A;  2C66 A;  2YLR A;  4J33 A;  3ATQ A;  4KX6 A;  4GUV A;  1EL5 A;  1KDG A;  2BRY A;  3RED A;  2XLS A;  2A8X A;  4TM4 A;  2ZZB A;  4Z24 A;  3SYI A;  2QA2 A;  4OPD A;  4P9S A;  3CND A;  2Y6Q A;  1PBC A;  3CPH G;  2E80 A;  1YQ3 A;  3KD9 A;  4B66 A;  4TLZ A;  3GMB A;  4B68 A;  1KF6 A;  4O5U A;  2GH5 A;  4UDR A;  4H4R A;  4J57 A;  1S2Y A;  4K22 A;  5KOW A;  1CJC A;  1K4Q A;  1NEK A;  3ABV A;  1PHH A;  4UDP A;  5L46 A;  3CPI G;  1CJ3 A;  1N4V A;  2GAH B;  2XFP A;  2C75 A;  3NTA A;  3QFB A;  4WJY A;  4H4S A;  4A7A A;  1OJA A;  3UKK A;  3L1R A;  4MJW A;  2WU2 A;  1FT6 A;  1BGN A;  4B65 A;  1PN0 A;  1GT8 A;  4Q5C A;  4XWZ A;  4BK3 A;  2BCG G;  1RYI A;  1DOB A;  3T2Y A;  2XCG A;  3AED A;  4OPL A;  3CTY A;  2K3V A;  3HYV A;  3HYX A;  1PJ5 A;  3UCL A;  3H8L A;  3IF9 A;  1NHQ A;  4L3X A;  1BGJ A;  2C72 A;  2CUL A;  4BUR A;  2GRT A;  1M64 A;  3F8R A;  3OC4 A;  1CC2 A;  1GRT A;  1M1Q A;  2WS3 A;  1HYU A;  4TM1 A;  1KNR A;  3V3N A;  4IVO B;  1F6M A;  2WBA A;  3AD8 B;  1JNI A;  5LV9 A;  1Y56 B;  2WQY A;  2ZBW A;  4B64 A;  4Q17 A;  4DSH A;  3LAD A;  1MXT A;  5HHF A;  3GYX A;  1RP0 A;  3QVP A;  4FK1 A;  4U2S A;  3T2K A;  2ZZ0 A;  3DME A;  3BNH A;  4H2R A;  1GER A;  5JCI A;  3JSK A;  4WX1 A;  3G5R A;  2BCP A;  1H6V A;  1TDE A;  3SZC A;  4AOX A;  1D4E A;  1O5W A;  1H82 A;  1FL2 A;  1LQU A;  1NPX A;  3GDN A;  3SY4 A;  3UOX A;  1DOC A;  4YSX A;  4I58 A;  2FBW A;  1FEC A;  2LFC A;  3KPK A;  1GTH A;  4U8O A;  3M0O A;  3AE6 A;  2OLN A;  2XYO A;  1JRX A;  1YQ4 A;  1IJH A;  3AEE A;  3SFD A;  1BKW A;  2C7G A;  2RGO A;  1ZP0 A;  3VRD B;  4YSZ A;  3TTB A;  3ITJ A;  2VVM A;  4D04 A;  1Q9I A;  1ELI A;  2XDO A;  4A6N A;  1L0V A;  5EB4 A;  3ICS A;  5JCL A;  3DA1 A;  2WPC A;  4WCT A;  5BUL A;  3T31 A;  2YG4 A;  4NEV A;  1B4V A;  4USR A;  3DGH A;  1DNC A;  1P2E A;  4BJY A;  4A79 A;  3UKL A;  4ADW A;  4EQS A;  4U8P A;  5KMR A;  2BAC A;  1EBD A;  2YVF A;  4DSG A;  4BV6 A;  2IID A;  4IA5 A;  1F8S A;  3AB1 A;  3UKP A;  4AOS A;  4YSH A;  2V61 A;  3UTF A;  1FS7 A;  3OZ2 A;  1ZK7 A;  4CCQ A;  4OPC A;  4TM3 A;  3AD9 B;  2BS3 A;  2C4C A;  5KMP A;  4YTP A;  5KNL A;  2R0G A;  3K7M X;  2WDR A;  3KA7 A;  2RGJ A;  2RDZ A;  3QJ4 A;  3EF6 A;  5EB5 A;  4DNA A;  1CJ2 A;  3LOV A;  1VRQ B;  4II3 A;  1JU2 A;  2PYX A;  2JB2 A;  3AEF A;  5CKU A;  4H4U A;  1E6E A;  3P4P A;  1YQZ A;  2DKH A;  3NTD A;  2B76 A;  3QSS A;  4G6H A;  3V76 A;  3FIM B;  4JN9 A;  2RGH A;  2VZ2 A;  2XFQ A;  5M0Z A;  1JEH A;  2GB0 A;  4JNA A;  1S3B A;  2R0P A;  1KNP A;  4C77 A;  1JRY A;  4CRT A;  1NHP A;  4A65 A;  3M13 A;  1JNZ A;  2GR3 A;  2W0H A;  2YG6 A;  1PDH A;  1YKJ A;  1M1P A;  1O95 A;  2WES A;  4U8K A;  1CHU A;  1E1N A;  1NG4 A;  1GXF A;  2BYB A;  2FJB A;  2YLW A;  4K5R A;  3VRB A;  2XLR A;  2BXS A;  1VG9 A;  2VQ7 A;  2JAE A;  2WU5 A;  3EAO A;  3KVE A;  4NZH A;  4X4J A;  5IQ4 A;  2B9W A;  3GWD A;  4C5O A;  2BS2 A;  3SGL A;  3R9U A;  4H4X A;  3NIX A;  2B7S A;  4B63 A;  4NTC A;  2C73 A;  2GMJ A;  2YWL A;  4EMI A;  1FOH A;  2WPF A;  2WP5 A;  3P4R A;  2R9Z A;  4J2W A;  3SXI A;  4JQ9 A;  4RSL A;  4ECH A;  5HYM A;  2CVJ A;  3LG1 A;  4B67 A;  4ZCC A;  4E0V A;  4H4V A;  2R46 A;  3RHA A;  4LA1 A;  3LB8 A;  1H7X A;  3MMO A;  4Z26 A;  1L9C A;  2Q0L A;  1GES A;  4H50 A;  1LQT A;  2E4G A;  2GR0 A;  2YR5 A;  3II4 A;  3NYF A;  4JNQ A;  2XVJ A;  2XLP A;  3CGD A;  3F8D A;  2YG7 A;  2BS4 A;  5KWF A;  1EL7 A;  3RNM A;  2H89 A;  3B3R A;  4J36 A;  2VRL A;  4A6N B;  2I0Z A;  3ZYX A;  3DJG X;  3BNG A;  3AE2 A;  3UOZ A;  2A87 A;  4B69 A;  2YM2 A;  3NK1 X;  3AEG A;  2AAQ A;  3BNF A;  1OJC A;  1X31 B;  5EBK A;  2APG A;  3SXQ A;  2C3D A;  4TM0 A;  2GR2 A;  4YSY A;  5KMS A;  3GRS A;  4O5Q A;  4L3Z A;  1H84 A;  1FEA A;  3AEC A;  1IUT A;  3SFE A;  2XVF A;  3CIR A;  2VOU A;  2C70 A;  1Z6L A;  4K8D A;  2GV8 A;  3P9U A;  4H4Y A;  3GMC A;  1PBE A;  4U8L A;  1GRG A;  4EM3 A;  2A89 A;  3UP4 A;  3P4S A;  4U8N A;  3BNJ A;  2XLU A;  3NN0 X;  1KSU A;  3NYE A;  1B8S A;  2V6O A;  1XHC A;  2XFN A;  4U2L A;  2Z5X A;  3C96 A;  4K5S A;  1VDC A;  4PAB A;  4FX9 A;  4OPU A;  1ZY8 A;  4C3X A;  4L3Y A;  1P2H A;  3FO3 A;  3UKA A;  1ZDL A;  2YLZ A;  1COY A;  2GQW A;  4OVI A;  3VR8 A;  4AT0 A;  3DJD A;  1FEB A;  4AP3 A;  1D4D A;  4FK1 C;  2OLO A;  3UP5 A;  4RG4 A;  3GYJ A;  1BWC A;  2X99 A;  3ALL A;  5TR3 A;  3NKS A;  3Q9T A;  3T2Z A;  2XLT A;  3UTH A;  5C3J A;  5JCM A;  1ZMC A;  3CNJ A;  1PXC A;  3GYI A;  4M52 A;  5FS7 A;  3SQP A;  4IV9 A;  1TYT A;  5EOW A;  5BVA A;  1E39 A;  3DJJ A;  5J60 A;  2OT4 A;  2R0C A;  3AEA A;  4GDE A;  4ZN0 A;  3RKH A;  1QO8 A;  1EL8 A;  3PS9 A;  3SZ0 A;  3T0K A;  2CFY A;  4U8J A;  2JBV A;  2YR4 A;  3KU9 A;  2C76 A;  1OAH A;  5KRQ A;  4G74 A;  3DK8 A;  1JRZ A;  3C4A A;  2GR1 A;  3ALM A;  3FG2 P;  3IC9 A;  1NHR A;  4Z43 A;  3CGB A;  3NH3 X;  1B37 A;  4L38 A;  4H2Q A;  4OCG A;  4J31 A;  1XPQ A;  3KPF A;  2C67 A;  4UDQ A;  3ISH A;  1DJN A;  5GRT A;  1V59 A;  5U63 A;  1QLB A;  4GAV A;  4II2 A;  4EMW A;  3CMM A;  3NLC A;  4NTE A;  2HQM A;  3AYJ A;  3UKH A;  4A99 A;  2V3B A;  3AE7 A;  2Y6R A;  2C64 A;  4K7Z A;  1GSN A;  5U1O A;  1GOS A;  1NHS A;  3UKF A;  4H7U A;  3UU9 A;  1F8W A;  2GEW A;  1GAL A;  4DGK A;  5KXJ A;  2WDQ A;  3E1T A;  4YTN A;  3GRT A;  1TDF A;  3VR9 A;  1H83 A;  1LTX R;  2E81 A;  4IVM B;  2IVD A;  1FS8 A;  2E1M A;  1K0I A;  5BRT A;  2WP6 A;  5HY5 A;  5IQ1 A;  1LJ1 A;  1B5Q A;  2F5Z A;  2AR8 A;  2XFU A;  3K7T A;  2UZZ A;  4Y4M A;  3D1I A;  1L9D A;  1LPF A;  1N4U A;  3GSI A;  4N9X A;  3NN6 X;  4G73 A;  3EPT A;  2YLS A;  1S2Q A;  2GQF A;  2OAL A;  2YVG A;  4USQ A;  5HXI A;  4Q5B A;  3SZW A;  3CGE A;  5KOX A;  4H4Q A;  4H2P A;  4PAA A;  4C74 A;  1YY5 A;  3IHG A;  2V60 A;  4JDR A;  1ZX9 A;  1PXA A;  3NK2 X;  5CQF A;  2VR0 A;  3ZDN A;  4B1B A;  1GRH A;  2E5V A;  2NPX A;  2QAE A;  2B9X A;  1S3E A;  5KVH A;  1GRF A;  4YWO A;  2B9Y A;  2R45 A;  3L8K A;  4H2N A;  5J7X A;  4EQW A;  1GTE A;  3I6D A;  3NT6 A;  3PVC A;  1PBB A;  1IUS A;  1H7W A;  2RF7 A;  4U2T A; 
#chains in the Genus database with same CATH homology
 4I59 A;  4J56 A;  3QSM A;  5KVI A;  2RAB A;  4TLX A;  2Z5Y A;  3DGZ A;  4CCR A;  1FS9 A;  1LV0 A;  1LVL A;  3H8I A;  4GF7 A;  2GVC A;  4REK A;  2FJA A;  3FPZ A;  1CL0 A;  2BC1 A;  2VRM A;  3CNT A;  4EQR A;  3T37 A;  2WPE A;  1VG0 A;  3BHK A;  3UOY A;  4H4P A;  4NTD A;  1M1R A;  4Q4U A;  1F3P A;  4H4T A;  1F8R A;  3AE3 A;  1SP3 A;  2VVL A;  1PJ6 A;  4AT2 A;  2X50 A;  4BJZ A;  4CBQ A;  5FMH A;  4K2X A;  3IHM A;  4J34 A;  2PHH A;  2YVJ A;  2QA1 A;  3PO7 A;  3UKQ A;  1GRA A;  3KLJ A;  2WET A;  1TDK A;  3M12 A;  3AE9 A;  3DK4 A;  1GET A;  2H88 A;  2EQ6 A;  3H4K A;  3NYC A;  2CDU A;  2YLT A;  4Q0T A;  1DXL A;  1NDA A;  2J3N A;  1IUU A;  2BXR A;  2VVL G;  2X8C A;  3DJE A;  3ICR A;  4EIQ A;  3DK9 A;  2YG3 A;  3K7Q X;  4A5L A;  3F8P A;  1E1M A;  4C3Y A;  4KPR A;  5GSN A;  2BK3 A;  1CJ4 A;  2TPR A;  2YAU A;  3DH9 A;  3WE0 A;  2YG5 A;  2R4E A;  4G9K A;  4HA6 A;  3L1T A;  1CC6 A;  3TOR A;  1ONF A;  3UBR A;  3BNM A;  3G5Q A;  1N1P A;  3GD3 A;  2XVH A;  3T14 A;  1M6I A;  1GPE A;  2X8H A;  1ZOY A;  3BI5 A;  3AYL A;  1CF3 A;  2OAM A;  4U8M A;  5FS8 A;  1KSS A;  4GDP A;  1VQW A;  3CN8 A;  1TDO A;  1K0L A;  1E7P A;  1OJT A;  2GAG B;  3UOV A;  1BVB A;  2AQJ A;  3D8X A;  4NWZ A;  4CNK A;  2ACZ A;  1EL9 A;  2XVI A;  3Q6J A;  4YTM A;  4U8I A;  2NVK X;  1D5T A;  2C65 A;  4RG3 A;  4HB9 A;  4Z2T A;  1QJD A;  4CNJ A;  3LGQ A;  5FS6 A;  1D7L A;  3I3L A;  4CY8 A;  1DOD A;  2JK6 A;  4Z2R A;  2V5Z A;  3D1C A;  2VQB A;  2WP9 A;  4A9W A;  2Q7V A;  2C3C A;  1E1L A;  4LII A;  4X9N A;  3UTG A;  2J7A A;  3LXD A;  3LZX A;  1FCD A;  4X9M A;  4EQX A;  1BF3 A;  3G5S A;  3GM6 A;  5C2T A;  3AEB A;  3BNU A;  4EMJ A;  3SX6 A;  1DJQ A;  3ADA B;  3UTE A;  4IA6 A;  3CNP A;  1IUW A;  4APN A;  3COX A;  3AD7 B;  1QDB A;  1L9E A;  1REO A;  2WOW A;  2X3N A;  2FJE A;  2Q0K A;  4GRT A;  2XVE A;  4JY2 A;  3AWI A;  3BI2 A;  3VQR A;  1D7Y A;  1OJ9 A;  1CBO A;  1PBD A;  1W4X A;  3FBS A;  2JB1 A;  5M10 A;  3FMW A;  2ARD A;  1TRB A;  2BK5 A;  4ICY A;  2BK4 A;  1NEN A;  1XDI A;  2OA1 A;  1IUV A;  2ZZC A;  1GU6 A;  1GND A;  3AE8 A;  3HYW A;  4G6G A;  4CY6 A;  4D03 A;  4NEW A;  2JKC A;  3AXB A;  5KMQ A;  3BHF A;  3QVR A;  5U25 A;  1ZKQ A;  4FDC B;  3AYI A;  1JOA A;  2BA9 A;  2IVE A;  3P1W A;  1H81 A;  3CPJ G;  3QFA A;  3S7W A;  1PS9 A;  2YM1 A;  1RSG A;  2EQ9 A;  4OPT A;  1NAA A;  4GAP A;  3URH A;  4ZCD A;  2DKI A;  2WHD A;  2FJD A;  4Y4N A;  3NG7 X;  1Y0P A;  3IWA A;  5JCK A;  3GWF A;  3AE5 A;  4Z44 A;  4GCM A;  1E1K A;  3F29 A;  1GV4 A;  4XWR A;  2QCU A;  4GR1 A;  3CGC A;  2ZO5 A;  3NHO X;  4Z2U A;  5JCN A;  3K30 A;  3EAN A;  2JB3 A;  5BUK A;  3NRN A;  2R4J A;  1JNR A;  2WDV A;  3OWM A;  1TYP A;  3AE4 A;  3LZW A;  2EQ8 A;  3O0H A;  1N4W A;  1OJD A;  3ICT A;  2GF3 A;  2YLX A;  3CNS A;  3C4N A;  3GDP A;  5DBJ A;  3SCE A;  1Y56 A;  3VRA A;  4Q1O A;  3V3O A;  1BZL A;  5FS9 A;  3RP6 A;  1ZMD A;  2BC0 A;  1UKV G;  2EQ7 A;  3P4Q A;  3S5W A;  3HZL A;  4H4W A;  4OPI A;  4Y4L A;  3SZF A;  3RP7 A;  1MOK A;  2BRA A;  4BK2 A;  1PBF A;  2Q6U A;  2B7R A;  4BK1 A;  3BI4 A;  3NK0 X;  1XAN A;  3SM8 A;  5ER0 A;  1PXB A;  1PJ7 A;  2YQU A;  1SEZ A;  1GRE A;  2YR6 A;  3RP8 A;  4YXD A;  3S61 A;  3ALJ A;  1DOE A;  1Q1R A;  2WOI A;  3B6D A;  1MO9 A;  4OPG A;  2WEU A;  2X8G A;  4NNJ A;  4H4Z A;  2O9Z A;  2XFO A;  4YKG A;  2V3A A;  4JY3 A;  3QSE A;  2TMD A;  1GEU A;  4LU6 A;  1K0J A;  3GD4 A;  4EIP A;  4Z25 A;  1ZOV A;  2WOV A;  3NNE A;  1D4C A;  2BAB A;  5IPY A;  1FT5 A;  1CC4 A;  4UP3 A;  3LJP A;  4YKF A;  1NG3 A;  4XXG A;  3KKJ A;  1H86 A;  3ATR A;  3NGC X;  1Q1W A;  3AE1 A;  4EM4 A;  1KFY A;  1GRB A;  2GMH A;  1O94 A;  1TDN A;  4AP1 A;  1IUX A;  4YT0 A;  1AOG A;  2C66 A;  2YLR A;  4J33 A;  3ATQ A;  4KX6 A;  4GUV A;  1EL5 A;  1KDG A;  2BRY A;  3RED A;  2XLS A;  2A8X A;  4TM4 A;  2ZZB A;  4Z24 A;  3SYI A;  2QA2 A;  4OPD A;  4P9S A;  3CND A;  2Y6Q A;  1PBC A;  3CPH G;  2E80 A;  1YQ3 A;  3KD9 A;  4B66 A;  4TLZ A;  3GMB A;  4B68 A;  1KF6 A;  4O5U A;  2GH5 A;  4UDR A;  4H4R A;  4J57 A;  1S2Y A;  4K22 A;  5KOW A;  1CJC A;  1K4Q A;  1NEK A;  3ABV A;  1PHH A;  4UDP A;  5L46 A;  3CPI G;  1CJ3 A;  1N4V A;  2GAH B;  2XFP A;  2C75 A;  3NTA A;  3QFB A;  4WJY A;  4H4S A;  4A7A A;  1OJA A;  3UKK A;  3L1R A;  4MJW A;  2WU2 A;  1FT6 A;  1BGN A;  4B65 A;  1PN0 A;  1GT8 A;  4Q5C A;  4XWZ A;  4BK3 A;  2BCG G;  1RYI A;  1DOB A;  3T2Y A;  2XCG A;  3AED A;  4OPL A;  3CTY A;  2K3V A;  3HYV A;  3HYX A;  1PJ5 A;  3UCL A;  3H8L A;  3IF9 A;  1NHQ A;  4L3X A;  1BGJ A;  2C72 A;  2CUL A;  4BUR A;  2GRT A;  1M64 A;  3F8R A;  3OC4 A;  1CC2 A;  1GRT A;  1M1Q A;  2WS3 A;  1HYU A;  4TM1 A;  1KNR A;  3V3N A;  4IVO B;  1F6M A;  2WBA A;  3AD8 B;  1JNI A;  5LV9 A;  1Y56 B;  2WQY A;  2ZBW A;  4B64 A;  4Q17 A;  4DSH A;  3LAD A;  1MXT A;  5HHF A;  3GYX A;  1RP0 A;  3QVP A;  4FK1 A;  4U2S A;  3T2K A;  2ZZ0 A;  3DME A;  3BNH A;  4H2R A;  1GER A;  5JCI A;  3JSK A;  4WX1 A;  3G5R A;  2BCP A;  1H6V A;  1TDE A;  3SZC A;  4AOX A;  1D4E A;  1O5W A;  1H82 A;  1FL2 A;  1LQU A;  1NPX A;  3GDN A;  3SY4 A;  3UOX A;  1DOC A;  4YSX A;  4I58 A;  2FBW A;  1FEC A;  2LFC A;  3KPK A;  1GTH A;  4U8O A;  3M0O A;  3AE6 A;  2OLN A;  2XYO A;  1JRX A;  1YQ4 A;  1IJH A;  3AEE A;  3SFD A;  1BKW A;  2C7G A;  2RGO A;  1ZP0 A;  3VRD B;  4YSZ A;  3TTB A;  3ITJ A;  2VVM A;  4D04 A;  1Q9I A;  1ELI A;  2XDO A;  4A6N A;  1L0V A;  5EB4 A;  3ICS A;  5JCL A;  3DA1 A;  2WPC A;  4WCT A;  5BUL A;  3T31 A;  2YG4 A;  4NEV A;  1B4V A;  4USR A;  3DGH A;  1DNC A;  1P2E A;  4BJY A;  4A79 A;  3UKL A;  4ADW A;  4EQS A;  4U8P A;  5KMR A;  2BAC A;  1EBD A;  2YVF A;  4DSG A;  4BV6 A;  2IID A;  4IA5 A;  1F8S A;  3AB1 A;  3UKP A;  4AOS A;  4YSH A;  2V61 A;  3UTF A;  1FS7 A;  3OZ2 A;  1ZK7 A;  4CCQ A;  4OPC A;  4TM3 A;  3AD9 B;  2BS3 A;  2C4C A;  5KMP A;  4YTP A;  5KNL A;  2R0G A;  3K7M X;  2WDR A;  3KA7 A;  2RGJ A;  2RDZ A;  3QJ4 A;  3EF6 A;  5EB5 A;  4DNA A;  1CJ2 A;  3LOV A;  1VRQ B;  4II3 A;  1JU2 A;  2PYX A;  2JB2 A;  3AEF A;  5CKU A;  4H4U A;  1E6E A;  3P4P A;  1YQZ A;  2DKH A;  3NTD A;  2B76 A;  3QSS A;  4G6H A;  3V76 A;  3FIM B;  4JN9 A;  2RGH A;  2VZ2 A;  2XFQ A;  5M0Z A;  1JEH A;  2GB0 A;  4JNA A;  1S3B A;  2R0P A;  1KNP A;  4C77 A;  1JRY A;  4CRT A;  1NHP A;  4A65 A;  3M13 A;  1JNZ A;  2GR3 A;  2W0H A;  2YG6 A;  1PDH A;  1YKJ A;  1M1P A;  1O95 A;  2WES A;  4U8K A;  1CHU A;  1E1N A;  1NG4 A;  1GXF A;  2BYB A;  2FJB A;  2YLW A;  4K5R A;  3VRB A;  2XLR A;  2BXS A;  1VG9 A;  2VQ7 A;  2JAE A;  2WU5 A;  3EAO A;  3KVE A;  4NZH A;  4X4J A;  5IQ4 A;  2B9W A;  3GWD A;  4C5O A;  2BS2 A;  3SGL A;  3R9U A;  4H4X A;  3NIX A;  2B7S A;  4B63 A;  4NTC A;  2C73 A;  2GMJ A;  2YWL A;  4EMI A;  1FOH A;  2WPF A;  2WP5 A;  3P4R A;  2R9Z A;  4J2W A;  3SXI A;  4JQ9 A;  4RSL A;  4ECH A;  5HYM A;  2CVJ A;  3LG1 A;  4B67 A;  4ZCC A;  4E0V A;  4H4V A;  2R46 A;  3RHA A;  4LA1 A;  3LB8 A;  1H7X A;  3MMO A;  4Z26 A;  1L9C A;  2Q0L A;  1GES A;  4H50 A;  1LQT A;  2E4G A;  2GR0 A;  2YR5 A;  3II4 A;  3NYF A;  4JNQ A;  2XVJ A;  2XLP A;  3CGD A;  3F8D A;  2YG7 A;  2BS4 A;  5KWF A;  1EL7 A;  3RNM A;  2H89 A;  3B3R A;  4J36 A;  2VRL A;  4A6N B;  2I0Z A;  3ZYX A;  3DJG X;  3BNG A;  3AE2 A;  3UOZ A;  2A87 A;  4B69 A;  2YM2 A;  3NK1 X;  3AEG A;  2AAQ A;  3BNF A;  1OJC A;  1X31 B;  5EBK A;  2APG A;  3SXQ A;  2C3D A;  4TM0 A;  2GR2 A;  4YSY A;  5KMS A;  3GRS A;  4O5Q A;  4L3Z A;  1H84 A;  1FEA A;  3AEC A;  1IUT A;  3SFE A;  2XVF A;  3CIR A;  2VOU A;  2C70 A;  1Z6L A;  4K8D A;  2GV8 A;  3P9U A;  4H4Y A;  3GMC A;  1PBE A;  4U8L A;  1GRG A;  4EM3 A;  2A89 A;  3UP4 A;  3P4S A;  4U8N A;  3BNJ A;  2XLU A;  3NN0 X;  1KSU A;  3NYE A;  1B8S A;  2V6O A;  1XHC A;  2XFN A;  4U2L A;  2Z5X A;  3C96 A;  4K5S A;  1VDC A;  4PAB A;  4FX9 A;  4OPU A;  1ZY8 A;  4C3X A;  4L3Y A;  1P2H A;  3FO3 A;  3UKA A;  1ZDL A;  2YLZ A;  1COY A;  2GQW A;  4OVI A;  3VR8 A;  4AT0 A;  3DJD A;  1FEB A;  4AP3 A;  1D4D A;  4FK1 C;  2OLO A;  3UP5 A;  4RG4 A;  3GYJ A;  1BWC A;  2X99 A;  3ALL A;  5TR3 A;  3NKS A;  3Q9T A;  3T2Z A;  2XLT A;  3UTH A;  5C3J A;  5JCM A;  1ZMC A;  3CNJ A;  1PXC A;  3GYI A;  4M52 A;  5FS7 A;  3SQP A;  4IV9 A;  1TYT A;  5EOW A;  5BVA A;  1E39 A;  3DJJ A;  5J60 A;  2OT4 A;  2R0C A;  3AEA A;  4GDE A;  4ZN0 A;  3RKH A;  1QO8 A;  1EL8 A;  3PS9 A;  3SZ0 A;  3T0K A;  2CFY A;  4U8J A;  2JBV A;  2YR4 A;  3KU9 A;  2C76 A;  1OAH A;  5KRQ A;  4G74 A;  3DK8 A;  1JRZ A;  3C4A A;  2GR1 A;  3ALM A;  3FG2 P;  3IC9 A;  1NHR A;  4Z43 A;  3CGB A;  3NH3 X;  1B37 A;  4L38 A;  4H2Q A;  4OCG A;  4J31 A;  1XPQ A;  3KPF A;  2C67 A;  4UDQ A;  3ISH A;  1DJN A;  5GRT A;  1V59 A;  5U63 A;  1QLB A;  4GAV A;  4II2 A;  4EMW A;  3CMM A;  3NLC A;  4NTE A;  2HQM A;  3AYJ A;  3UKH A;  4A99 A;  2V3B A;  3AE7 A;  2Y6R A;  2C64 A;  4K7Z A;  1GSN A;  5U1O A;  1GOS A;  1NHS A;  3UKF A;  4H7U A;  3UU9 A;  1F8W A;  2GEW A;  1GAL A;  4DGK A;  5KXJ A;  2WDQ A;  3E1T A;  4YTN A;  3GRT A;  1TDF A;  3VR9 A;  1H83 A;  1LTX R;  2E81 A;  4IVM B;  2IVD A;  1FS8 A;  2E1M A;  1K0I A;  5BRT A;  2WP6 A;  5HY5 A;  5IQ1 A;  1LJ1 A;  1B5Q A;  2F5Z A;  2AR8 A;  2XFU A;  3K7T A;  2UZZ A;  4Y4M A;  3D1I A;  1L9D A;  1LPF A;  1N4U A;  3GSI A;  4N9X A;  3NN6 X;  4G73 A;  3EPT A;  2YLS A;  1S2Q A;  2GQF A;  2OAL A;  2YVG A;  4USQ A;  5HXI A;  4Q5B A;  3SZW A;  3CGE A;  5KOX A;  4H4Q A;  4H2P A;  4PAA A;  4C74 A;  1YY5 A;  3IHG A;  2V60 A;  4JDR A;  1ZX9 A;  1PXA A;  3NK2 X;  5CQF A;  2VR0 A;  3ZDN A;  4B1B A;  1GRH A;  2E5V A;  2NPX A;  2QAE A;  2B9X A;  1S3E A;  5KVH A;  1GRF A;  4YWO A;  2B9Y A;  2R45 A;  3L8K A;  4H2N A;  5J7X A;  4EQW A;  1GTE A;  3I6D A;  3NT6 A;  3PVC A;  1PBB A;  1IUS A;  1H7W A;  2RF7 A;  4U2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...