1Y0PA

Flavocytochrome c3 with mesaconate bound
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title Electrocatalytic Generation of Chiral Fumarate Derivatives by Flavocytochrome c3
rcsb
source organism Shewanella frigidimarina
total genus 194
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1y0pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1y0pA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1y0pA03
4L38A 2A87A 2R0CA 3P4RA 3GWDA 2JB2A 4NEWA 1O94A 1B8SA 1ZK7A 4YXDA 5FMHA 2X3NA 3TORA 3CPHG 3QVRA 1LQUA 3VRAA 2DKHA 1BGJA 4Q0TA 1PJ5A 2AAQA 2C64A 2YG7A 5BULA 4A5LA 2XYOA 1H83A 2XFOA 2GMHA 1L9CA 3QVPA 3ICTA 1TYTA 2A89A 2XLUA 1GRGA 1TDKA 4I59A 4U8LA 2YG5A 1B5QA 2YLTA 2BA9A 2Y6RA 3EF6A 4CCRA 2BS3A 3UKFA 2VVLA 1QO8A 3CPJG 2BABA 1NHPA 2QAEA 1E1NA 2WOVA 2CFYA 2VRLA 1TRBA 4B63A 1CJ3A 2GF3A 2NVKX 4FK1A 2CDUA 4UDRA 3AE6A 1YY5A 2YG3A 2ZZBA 4CY6A 4DGKA 1BF3A 3TTBA 2IVDA 2WDQA 4Z25A 5JCLA 4FK1C 4OPDA 1FS9A 4H4WA 4YKGA 1YQ4A 1PXBA 4GUVA 1M1RA 4YTMA 5BVAA 2OAMA 3JSKA 3D8XA 2R9ZA 2FJEA 3F8RA 3NN0X 2TPRA 1UKVG 4PABA 2YG6A 3K7QX 1Q1RA 1FEBA 4K22A 3BNUA 4A6NB 3AE2A 1E39A 2E81A 1B37A 2J3NA 3LB8A 2XVIA 1LPFA 1H86A 2H88A 3UOVA 2CVJA 4OPCA 4GR1A 4X9MA 3OWMA 1CBOA 1BZLA 1JRXA 1FEAA 1ZMDA 5JCMA 1IUSA 2GQFA 1DJQA 1TDNA 3LZXA 4UP3A 3AE8A 1PJ6A 2R46A 2YR4A 4H2RA 2YLZA 3C4NA 5EOWA 3SCEA 4JY2A 1ZP0A 4YSXA 5KXJA 4JNAA 3VR9A 1E6EA 1NPXA 2APGA 3UP4A 2YLWA 1V59A 2XLPA 3NK1X 4OPGA 4USRA 3II4A 4GDPA 3BNMA 4UDQA 3DJGX 4JQ9A 1FCDA 1REOA 4LA1A 3AECA 1GU6A 3CNSA 4NTDA 1ZY8A 2R0GA 2YR5A 4YKFA 5TR3A 1IJHA 3NIXA 5BRTA 4B65A 2YLSA 4ZN0A 1TYPA 4C3YA 2WP6A 1PDHA 1PHHA 3HZLA 1F6MA 3QSMA 4Q17A 4AOSA 4EIPA 1FT6A 5HXIA 4O5UA 1GRHA 4YTNA 5IQ4A 4U8PA 4REKA 1SP3A 1GERA 2R4JA 1ZX9A 2GR1A 4I58A 1BWCA 1L9DA 1KNRA 1YQZA 1L9EA 1S3EA 2F5ZA 2VRMA 3F8DA 1E1LA 2XVFA 2YLRA 3K7TA 4M52A 1NG3A 2ZZ0A 3B6DA 5M10A 4Q4UA 5CKUA 1H82A 1GRTA 1BKWA 2C3CA 3AYLA 4IV9A 3RNMA 3SM8A 2ZO5A 2EQ6A 1D4DA 1Q1WA 3AE9A 1LV0A 1TDEA 2C67A 4IVMB 2X50A 4C77A 2GR0A 2JB3A 1GRBA 5JCIA 4EQRA 4A9WA 3ADAB 4H4VA 1VRQB 5U63A 3FIMB 1GPEA 2YM2A 2XFQA 3AEFA 3C96A 3UTGA 4E0VA 3NLCA 2B9WA 2YQUA 4GF7A 3RP7A 2BXSA 1S3BA 4OVIA 1EL9A 2WPEA 3AEGA 1XPQA 3Q6JA 4TM1A 2RGJA 1GEUA 5EBKA 5U1OA 4BK1A 4D03A 4BJYA 2PHHA 3NT6A 5IPYA 3IF9A 3E1TA 3LG1A 4OPLA 3G5QA 3P9UA 3DMEA 1ZKQA 2WESA 4Y4MA 2B7RA 1GOSA 3GD3A 4H4PA 1GTEA 3CNDA 3Q9TA 3QSEA 1CL0A 2V61A 3KU9A 2BCGG 4AOXA 3K30A 1DNCA 2X8HA 3VRBA 1JEHA 2RGOA 4FX9A 2B76A 4H4QA 4NTCA 1LQTA 3DH9A 3DK8A 3NHOX 4Y4LA 1HYUA 1CHUA 1IUUA 1GSNA 1N4VA 2WETA 4ZCCA 3UTEA 1GALA 2WP5A 2ARDA 2C75A 3FG2P 4L3XA 1N4UA 2GMJA 2XFPA 3AEBA 3BHKA 4WX1A 2R4EA 5FS6A 3FO3A 3AYJA 2BC1A 5KOWA 3F29A 2PYXA 3OC4A 4IVOB 1PXAA 3NNEA 3DA1A 1N1PA 3QJ4A 5FS9A 5FS8A 1QLBA 3AE1A 3KKJA 3SXQA 1KDGA 4Q1OA 5J60A 3RP8A 2EQ7A 5BUKA 2GR3A 4ECHA 3S61A 4APNA 4NEVA 2C3DA 1LJ1A 3VQRA 2BACA 3UKKA 3FPZA 5ER0A 4LU6A 1OJCA 2Z5XA 3ATQA 2OA1A 4UDPA 1GXFA 4EIQA 1JNZA 3ISHA 1LTXR 3AB1A 2EQ9A 4BK3A 4AP1A 1FS7A 5KRQA 5KVHA 5HY5A 3CGDA 3M0OA 2FJBA 3GYIA 1ZMCA 1DOBA 4BK2A 2WHDA 3UKHA 4Z43A 3V3OA 4CY8A 1PXCA 2BK3A 3AD8B 3F8PA 4H2NA 5KVIA 1RP0A 1KSUA 1PS9A 3GRSA 3H4KA 4CNJA 5KOXA 2JAEA 2VVMA 1D7LA 1CJ2A 5EB5A 4P9SA 4J57A 1M1PA 2H89A 3AEAA 3KPFA 3SFDA 2I0ZA 4RSLA 1EL5A 1OJ9A 3LADA 4EM4A 4CRTA 4U8JA 3M12A 3BI2A 4XWZA 4K7ZA 1PBEA 2E5VA 4H4UA 4BV6A 3REDA 3AEEA 2YVGA 4B67A 4Z26A 4AT2A 2JBVA 1H7XA 3SFEA 1OJDA 1GRFA 4GRTA 1EL7A 1JRYA 3GWFA 1FS8A 1NEKA 2C7GA 2AR8A 1JNIA 3D1IA 3PVCA 4A7AA 3G5RA 3S5WA 3GYXA 1CF3A 1E1KA 1CC6A 2XVEA 1E1MA 2W0HA 3CGEA 3SQPA 1DXLA 1Y0PA 3UBRA 2XLTA 3AEDA 2X8CA 4OCGA 2GEWA 3DK4A 3DK9A 3GDNA 2WBAA 3KLJA 5L46A 3P4SA 1GRAA 1MOKA 1ELIA 1IUXA 3BNFA 2C66A 2X99A 5HHFA 5M0ZA 2UZZA 1DJNA 4WJYA 4EMWA 3WE0A 3OZ2A 2BK4A 5C2TA 1H84A 2RABA 2BC0A 4C74A 2Z5YA 4JY3A 2C65A 1JOAA 3EANA 1IUTA 4EQWA 3KD9A 4X4JA 4J33A 4U8IA 1PJ7A 1MO9A 1GTHA 3LJPA 3ZYXA 1DOCA 2VQ7A 2X8GA 1QDBA 2GAHB 1COYA 1NDAA 3BNGA 3AE4A 4XXGA 3URHA 1IUVA 4DSGA 1X31B 2WS3A 3B3RA 4BJZA 1H7WA 2OALA 4KPRA 4K8DA 2RF7A 1H6VA 2B9YA 2Q0KA 3L1TA 4U8NA 3IHGA 3RKHA 2BXRA 1PBBA 1S2QA 2OT4A 4TM3A 2Y6QA 4K5RA 1ZOVA 1KSSA 1W4XA 2XLSA 3AWIA 1ONFA 2Q7VA 3DJDA 5GRTA 5C3JA 2YLXA 4Z24A 1XHCA 3CNTA 1NENA 2BS2A 3AE5A 3ICSA 3IWAA 4H4RA 3H8LA 3DGHA 1AOGA 4C5OA 2J7AA 3CGBA 3CPIG 3BI4A 4XWRA 2QCUA 4YSZA 1Y56A 2OLOA 1H81A 1O95A 3COXA 3M13A 1EBDA 4H2PA 1TDOA 4D04A 2IVEA 3DJEA 4Q5CA 4RG3A 2GR2A 4TM0A 3H8IA 4U2TA 3NN6X 4H4TA 1JU2A 3DGZA 3P4QA 4PAAA 1TDFA 2OLNA 4FDCB 2GAGB 3RHAA 1O5WA 4L3YA 4B69A 3UKPA 3UTHA 3BHFA 2QA1A 2E4GA 2YVFA 4USQA 4TM4A 2RGHA 1GESA 4H4SA 4U8KA 1FOHA 4YSHA 4LIIA 1RYIA 3C4AA 1GV4A 3NTDA 1F8SA 3NYFA 2EQ8A 3QFAA 2JB1A 4DSHA 4Y4NA 1SEZA 4Z2UA 1VQWA 2GH5A 3NYEA 1F8WA 4HA6A 3UCLA 2Q6UA 1PBDA 4IA6A 3PO7A 1DODA 3CNJA 3LZWA 1DOEA 1S2YA 4JNQA 1PBFA 2V3AA 4X9NA 4NZHA 4YT0A 3GYJA 2XCGA 2WU5A 1BVBA 3NKSA 4ADWA 2NPXA 5FS7A 1K0LA 2XFUA 1D7YA 2V5ZA 4B64A 2VR0A 2WOIA 1D4EA 1K0IA 2GQWA 2C73A 3ATRA 3AD9B 3QSSA 2RDZA 3EAOA 2E1MA 1P2EA 3ALMA 1L0VA 4AT0A 4EM3A 3NYCA 3GMBA 1VDCA 1NHSA 3UTFA 2BYBA 2WPCA 2R0PA 2C72A 2TMDA 2WU2A 4JDRA 2B7SA 2WQYA 4OPIA 5J7XA 3K7MX 4U2SA 3GM6A 4CCQA 3DJJA 4YSYA 4NTEA 4H50A 3I3LA 2BS4A 4J34A 1VG9A 1YQ3A 4U2LA 4BURA 3KVEA 4TLXA 2LFCA 1P2HA 3QFBA 1KFYA 1N4WA 3BNJA 4L3ZA 3FMWA 4J36A 2YWLA 1XANA 2GV8A 4U8OA 1B4VA 3CTYA 3LXDA 2YR6A 4JN9A 2AQJA 2ZZCA 1CC4A 2B9XA 5LV9A 2BCPA 1LVLA 2XDOA 4AP3A 2JKCA 2VVLG 1CJCA 1XDIA 3AE3A 1MXTA 2YM1A 1GNDA 5CQFA 3V3NA 3ALJA 2XVJA 4EQXA 3NG7X 1ZOYA 1M6IA 3IHMA 4Z2RA 4O5QA 3S7WA 2FJDA 4H2QA 3IC9A 3V76A 2WPFA 2HQMA 1OJAA 1K4QA 2A8XA 2C76A 2Q0LA 3EPTA 3GDPA 3NK0X 4A65A 1GT8A 1F8RA 3GMCA 1E7PA 3D1CA 2QA2A 3VR8A 1VG0A 3G5SA 4GCMA 3AD7B 4U8MA 1FT5A 1M64A 2E80A 2GRTA 2YG4A 1GREA 3NH3X 4H7UA 1NAAA 3LGQA 3AXBA 3CNPA 1NHRA 3PS9A 1YKJA 1Q9IA 1NG4A 1ZDLA 2WOWA 2XVHA 2C70A 3FBSA 3NGCX 5DBJA 2K3VA 2R45A 3ZDNA 5KWFA 3CGCA 4RG4A 3R9UA 1BGNA 3VRDB 5JCKA 4A6NA 3GSIA 1EL8A 4J31A 2ZBWA 5EB4A 4B68A 4Q5BA 3UKQA 3UU9A 1KF6A 3NTAA 4H4ZA 3UOYA 1IUWA 2WEUA 3CN8A 2YAUA 4EMJA 3P1WA 4J56A 4Z2TA 2XLRA 3RP6A 4OPUA 2V3BA 3ITJA 2V60A 4K2XA 3LOVA 3MMOA 3AYIA 4ICYA 1FL2A 2V6OA 2ACZA 3ABVA 4A79A 5HYMA 2GVCA 1K0JA 3ALLA 3I6DA 1Z6LA 3GD4A 4H4YA 3NK2X 4H4XA 3UOXA 1Y56B 1PN0A 2GB0A 4B1BA 2WDVA 3CIRA 3UKAA 1OJTA 4MJWA 4C3XA 4TLZA 2VQBA 1CC2A 4J2WA 1RSGA 5IQ1A 1JNRA 2FBWA 4A99A 2O9ZA 4CNKA 3O0HA 5U25A 2JK6A 3L1RA 3GRTA 4EMIA 1QJDA 4WCTA 4Z44A 1D4CA 2CULA 2VZ2A 1NHQA 1KNPA 4K5SA 3UP5A 1FECA 1OAHA 1F3PA 3SGLA 3BI5A 4DNAA 2IIDA 1PBCA 3UOZA 2FJAA 3T37A 4YTPA 1M1QA 4IA5A 5JCNA 4EQSA 4KX6A 1D5TA 4GDEA 2XFNA 3BNHA 2BK5A 2YVJA 4N9XA 4ZCDA 5GSNA 1CJ4A 2VOUA 2WDRA 4B66A 3UKLA 3AE7A 1JRZA 3NRNA 3P4PA 4YWOA 4CBQA 1GETA 3L8KA 2DKIA 4OPTA 4HB9A 3ICRA 2WP9A 3KA7A
chains in the Genus database with same CATH superfamily
4L38A 3HYVA 2A87A 2R0CA 3P4RA 3GWDA 2JB2A 4NEWA 1O94A 1B8SA 1ZK7A 4YXDA 5FMHA 2X3NA 3TORA 2BRAA 3CPHG 3QVRA 5KMPA 5KNLA 1LQUA 3VRAA 2DKHA 1BGJA 4Q0TA 1PJ5A 2AAQA 2C64A 2YG7A 5BULA 4A5LA 2XYOA 1H83A 2XFOA 2GMHA 1L9CA 3QVPA 3ICTA 1TYTA 2A89A 2XLUA 1GRGA 1TDKA 4I59A 4U8LA 2YG5A 1B5QA 2YLTA 2BA9A 2Y6RA 3EF6A 4CCRA 2BS3A 3UKFA 2VVLA 1QO8A 3CPJG 2BABA 1NHPA 2QAEA 1E1NA 2WOVA 2CFYA 2VRLA 1TRBA 4B63A 1CJ3A 2GF3A 2NVKX 4FK1A 2CDUA 4UDRA 3AE6A 1YY5A 2YG3A 2ZZBA 4CY6A 4DGKA 1BF3A 3TTBA 2IVDA 2WDQA 3T0KA 4Z25A 5JCLA 4FK1C 4OPDA 1FS9A 4H4WA 4YKGA 1YQ4A 1PXBA 4GUVA 1M1RA 4YTMA 5BVAA 2OAMA 3JSKA 3D8XA 4NNJA 2R9ZA 2FJEA 3F8RA 3NN0X 2TPRA 3SZWA 1UKVG 4PABA 2YG6A 3K7QX 3T2YA 1Q1RA 1FEBA 4K22A 3BNUA 4A6NB 3AE2A 1E39A 2E81A 1B37A 2J3NA 3LB8A 2XVIA 1LPFA 1H86A 4II3A 2H88A 3UOVA 2CVJA 4OPCA 4GR1A 4X9MA 3OWMA 1CBOA 1BZLA 1JRXA 1FEAA 1ZMDA 5JCMA 1IUSA 2GQFA 1DJQA 1TDNA 3LZXA 4UP3A 3AE8A 1PJ6A 2R46A 4G6HA 2YR4A 4H2RA 2YLZA 3C4NA 5EOWA 3SCEA 4JY2A 3SZFA 1ZP0A 4YSXA 5KXJA 4JNAA 3VR9A 3KPKA 1E6EA 1NPXA 2APGA 3UP4A 2YLWA 1V59A 2XLPA 3NK1X 4OPGA 4USRA 3II4A 4GDPA 3BNMA 4UDQA 3DJGX 4JQ9A 1FCDA 1REOA 3SXIA 4LA1A 3AECA 1GU6A 3CNSA 4NTDA 1ZY8A 2R0GA 2YR5A 4YKFA 5TR3A 1IJHA 3NIXA 4NWZA 5BRTA 4B65A 2YLSA 4ZN0A 1TYPA 4C3YA 2WP6A 1PDHA 1PHHA 3HZLA 1F6MA 3QSMA 4Q17A 4AOSA 4EIPA 1FT6A 5HXIA 4O5UA 1GRHA 4YTNA 5IQ4A 4U8PA 4REKA 1SP3A 1GERA 2R4JA 1ZX9A 2GR1A 4I58A 1BWCA 1L9DA 1KNRA 1YQZA 1L9EA 1S3EA 2F5ZA 2VRMA 3F8DA 1E1LA 2XVFA 2YLRA 3K7TA 4GAPA 4M52A 1NG3A 2ZZ0A 3B6DA 5M10A 4Q4UA 5CKUA 1H82A 1GRTA 1BKWA 2C3CA 3AYLA 4IV9A 3RNMA 3SM8A 2ZO5A 2EQ6A 1D4DA 1Q1WA 3AE9A 1LV0A 1TDEA 2C67A 4IVMB 2X50A 4C77A 2GR0A 2JB3A 1GRBA 5JCIA 4EQRA 4A9WA 3ADAB 4H4VA 1VRQB 5U63A 3FIMB 1GPEA 2YM2A 2XFQA 3AEFA 3C96A 3UTGA 4E0VA 3NLCA 2B9WA 2YQUA 4GF7A 3RP7A 2BXSA 1S3BA 4OVIA 1EL9A 2WPEA 3AEGA 1XPQA 3Q6JA 4TM1A 2RGJA 1GEUA 5EBKA 5U1OA 4BK1A 4D03A 5KMQA 5KMRA 4BJYA 2PHHA 3NT6A 5IPYA 3IF9A 3E1TA 3LG1A 4OPLA 3G5QA 3P9UA 3DMEA 1ZKQA 2WESA 4Y4MA 2B7RA 1GOSA 3GD3A 4H4PA 1GTEA 3CNDA 3Q9TA 3QSEA 1CL0A 2V61A 3KU9A 2BCGG 4AOXA 3K30A 1DNCA 2X8HA 3VRBA 1JEHA 2RGOA 4FX9A 2B76A 4H4QA 4NTCA 1LQTA 3DH9A 3DK8A 3NHOX 4Y4LA 1HYUA 1CHUA 1IUUA 1GSNA 1N4VA 2WETA 4ZCCA 3UTEA 1GALA 2WP5A 2ARDA 2C75A 3FG2P 4L3XA 1N4UA 2GMJA 2XFPA 3AEBA 3BHKA 4WX1A 2R4EA 5FS6A 3T31A 3FO3A 3AYJA 2BC1A 5KOWA 3F29A 3T2KA 2PYXA 3OC4A 4II2A 4IVOB 1PXAA 3NNEA 3DA1A 1N1PA 3QJ4A 5FS9A 5FS8A 1QLBA 3AE1A 3KKJA 3SXQA 1KDGA 4Q1OA 5J60A 3RP8A 2EQ7A 5BUKA 2GR3A 4ECHA 3S61A 4APNA 4NEVA 2C3DA 1LJ1A 3VQRA 2BACA 3UKKA 3FPZA 4G74A 5ER0A 4LU6A 1OJCA 2Z5XA 3ATQA 2OA1A 4UDPA 1GXFA 4EIQA 1JNZA 3ISHA 1LTXR 3AB1A 2EQ9A 4BK3A 4AP1A 1FS7A 5KRQA 5KVHA 5HY5A 3CGDA 3M0OA 2FJBA 3GYIA 1ZMCA 1DOBA 4BK2A 2WHDA 3UKHA 4Z43A 3V3OA 4CY8A 1PXCA 2BK3A 3AD8B 3F8PA 4H2NA 5KVIA 3SZCA 1RP0A 1KSUA 1PS9A 3GRSA 3H4KA 4CNJA 5KOXA 2JAEA 2VVMA 1D7LA 1CJ2A 5EB5A 4P9SA 4J57A 1M1PA 2H89A 3AEAA 3KPFA 3SFDA 2I0ZA 4RSLA 1EL5A 1OJ9A 3LADA 4EM4A 4CRTA 4U8JA 3M12A 3BI2A 4XWZA 4K7ZA 1PBEA 2E5VA 4H4UA 4BV6A 3REDA 3AEEA 2YVGA 4B67A 4Z26A 4AT2A 2JBVA 1H7XA 3SFEA 1OJDA 1GRFA 4GRTA 1EL7A 1JRYA 3GWFA 1FS8A 1NEKA 2C7GA 2AR8A 1JNIA 3D1IA 3PVCA 4A7AA 3G5RA 3GYXA 3S5WA 5KMSA 1CF3A 1E1KA 1CC6A 2XVEA 1E1MA 2W0HA 3CGEA 3SQPA 1DXLA 1Y0PA 3UBRA 2XLTA 3AEDA 2X8CA 4OCGA 2GEWA 3DK4A 3DK9A 3GDNA 2WBAA 3KLJA 5L46A 3SYIA 3P4SA 1GRAA 1MOKA 1ELIA 1IUXA 3BNFA 2C66A 2X99A 5HHFA 5M0ZA 2UZZA 1DJNA 4WJYA 4EMWA 3WE0A 3OZ2A 2BK4A 5C2TA 1H84A 2RABA 2BC0A 4C74A 2Z5YA 4JY3A 2C65A 1JOAA 3EANA 1IUTA 4EQWA 3KD9A 4X4JA 4J33A 4U8IA 1PJ7A 1MO9A 1GTHA 3LJPA 3ZYXA 1DOCA 2VQ7A 2X8GA 1QDBA 2GAHB 1COYA 1NDAA 3BNGA 3AE4A 4XXGA 3URHA 1IUVA 4DSGA 1X31B 2WS3A 3B3RA 4BJZA 1H7WA 2OALA 4KPRA 4K8DA 2RF7A 1H6VA 2B9YA 2Q0KA 3L1TA 4U8NA 3IHGA 3RKHA 2BXRA 1PBBA 1S2QA 2OT4A 4TM3A 2Y6QA 4K5RA 1ZOVA 1KSSA 1W4XA 2XLSA 3AWIA 1ONFA 2Q7VA 3DJDA 5GRTA 5C3JA 2YLXA 4Z24A 1XHCA 3HYXA 3CNTA 1NENA 2BS2A 3AE5A 3ICSA 3IWAA 4H4RA 3H8LA 3DGHA 1AOGA 4C5OA 2J7AA 3CGBA 3CPIG 3BI4A 4XWRA 2QCUA 4YSZA 1Y56A 2OLOA 1H81A 1O95A 3COXA 3M13A 1EBDA 4H2PA 2CZSA 1TDOA 4D04A 2C4CA 2IVEA 3DJEA 4Q5CA 4RG3A 2GR2A 4TM0A 3H8IA 4U2TA 3NN6X 4H4TA 1JU2A 3DGZA 3P4QA 4PAAA 1TDFA 2OLNA 4FDCB 2GAGB 3RHAA 1O5WA 3T14A 4L3YA 4B69A 3UKPA 3UTHA 3BHFA 2QA1A 2E4GA 2YVFA 4USQA 4TM4A 2RGHA 1GESA 4H4SA 4U8KA 1FOHA 4YSHA 4G73A 1RYIA 3C4AA 4LIIA 1GV4A 3NTDA 1F8SA 3NYFA 2EQ8A 3QFAA 2JB1A 4DSHA 4Y4NA 1SEZA 4Z2UA 1VQWA 2GH5A 3NYEA 1F8WA 4HA6A 3UCLA 2Q6UA 3CMMA 1PBDA 4IA6A 3PO7A 1DODA 3CNJA 4GAVA 3LZWA 1DOEA 1S2YA 4JNQA 1PBFA 2V3AA 4X9NA 4NZHA 4YT0A 3GYJA 2XCGA 2WU5A 1BVBA 3NKSA 4ADWA 2NPXA 5FS7A 1K0LA 2XFUA 1D7YA 2V5ZA 4B64A 2VR0A 2WOIA 1D4EA 1K0IA 2GQWA 2C73A 3ATRA 3AD9B 3QSSA 2RDZA 3EAOA 2E1MA 1P2EA 3ALMA 1L0VA 4AT0A 4EM3A 3NYCA 3GMBA 1VDCA 1NHSA 3UTFA 2BYBA 2WPCA 2R0PA 2C72A 2TMDA 2WU2A 4JDRA 2B7SA 2WQYA 4OPIA 5J7XA 3K7MX 4U2SA 3GM6A 4CCQA 3DJJA 4YSYA 4NTEA 4H50A 3I3LA 2BS4A 4J34A 1VG9A 1YQ3A 4U2LA 4BURA 3KVEA 4TLXA 2LFCA 1P2HA 3QFBA 1KFYA 1N4WA 3BNJA 4L3ZA 3FMWA 4J36A 2YWLA 1XANA 2GV8A 4U8OA 1B4VA 3CTYA 3LXDA 2YR6A 4JN9A 2AQJA 2ZZCA 1CC4A 2B9XA 5LV9A 2BCPA 1LVLA 2XDOA 4AP3A 2JKCA 2VVLG 1CJCA 1XDIA 3AE3A 1MXTA 2YM1A 1GNDA 5CQFA 3V3NA 3ALJA 2XVJA 4EQXA 3NG7X 1ZOYA 1M6IA 3IHMA 3SX6A 4O5QA 4Z2RA 3S7WA 2FJDA 4H2QA 3IC9A 3V76A 2WPFA 2HQMA 1OJAA 1K4QA 2A8XA 2C76A 2Q0LA 3EPTA 3GDPA 3NK0X 4A65A 1GT8A 1F8RA 3GMCA 1E7PA 3D1CA 2QA2A 3VR8A 1VG0A 3G5SA 4GCMA 3AD7B 4U8MA 1FT5A 1M64A 2E80A 2GRTA 2YG4A 1GREA 3NH3X 4H7UA 1NAAA 3LGQA 3AXBA 3CNPA 1NHRA 3PS9A 1YKJA 1Q9IA 1NG4A 1ZDLA 2WOWA 2XVHA 2C70A 3FBSA 3NGCX 5DBJA 2K3VA 2R45A 3ZDNA 5KWFA 3CGCA 4RG4A 3R9UA 1BGNA 3VRDB 5JCKA 3SZ0A 3GSIA 1EL8A 4A6NA 4J31A 2ZBWA 5EB4A 3T2ZA 4B68A 4Q5BA 3UKQA 3UU9A 1KF6A 3NTAA 4H4ZA 3UOYA 1IUWA 2WEUA 3CN8A 2YAUA 4EMJA 3P1WA 4J56A 3HYWA 2XLRA 3RP6A 4Z2TA 4OPUA 2V3BA 3ITJA 2V60A 4K2XA 3LOVA 3MMOA 3AYIA 4ICYA 1FL2A 2V6OA 2ACZA 3ABVA 4A79A 5HYMA 2GVCA 1K0JA 3ALLA 3I6DA 1Z6LA 3GD4A 4H4YA 3NK2X 4H4XA 3UOXA 1Y56B 1PN0A 2GB0A 4B1BA 2WDVA 3CIRA 3UKAA 1OJTA 4MJWA 4C3XA 4TLZA 2VQBA 1CC2A 4J2WA 1RSGA 5IQ1A 1JNRA 2FBWA 4A99A 2O9ZA 4CNKA 3O0HA 5U25A 3SY4A 2JK6A 3L1RA 3GRTA 4EMIA 1QJDA 4WCTA 4G9KA 4Z44A 1D4CA 2CULA 2VZ2A 1NHQA 1KNPA 2BRYA 4K5SA 3UP5A 1FECA 1OAHA 1F3PA 3SGLA 3BI5A 4DNAA 2IIDA 1PBCA 3UOZA 2FJAA 3T37A 4G6GA 4YTPA 1M1QA 4IA5A 5JCNA 4EQSA 4KX6A 1D5TA 4GDEA 2XFNA 3BNHA 2BK5A 2YVJA 4N9XA 4ZCDA 5GSNA 1CJ4A 2VOUA 2WDRA 4B66A 3UKLA 3AE7A 1JRZA 3NRNA 3P4PA 4YWOA 4CBQA 1GETA 3L8KA 2DKIA 4OPTA 4HB9A 3ICRA 2WP9A 3KA7A
chains in the Genus database with same CATH topology
4L38A 3HYVA 2A87A 2R0CA 3P4RA 3GWDA 2JB2A 4NEWA 1O94A 1B8SA 1ZK7A 4YXDA 5FMHA 2X3NA 3TORA 2BRAA 3CPHG 3QVRA 5KMPA 5KNLA 1LQUA 3VRAA 2DKHA 1BGJA 4Q0TA 1PJ5A 2AAQA 2C64A 2YG7A 5BULA 4A5LA 2XYOA 1H83A 2XFOA 2GMHA 1L9CA 3QVPA 3ICTA 1TYTA 2A89A 2XLUA 1GRGA 1TDKA 4I59A 4U8LA 2YG5A 1B5QA 2YLTA 2BA9A 2Y6RA 3EF6A 4CCRA 2BS3A 3UKFA 2VVLA 1QO8A 3CPJG 2BABA 1NHPA 2QAEA 1E1NA 2WOVA 2CFYA 2VRLA 1TRBA 4B63A 1CJ3A 2GF3A 2NVKX 4FK1A 2CDUA 4UDRA 3AE6A 1YY5A 2YG3A 2ZZBA 4CY6A 4DGKA 1BF3A 3TTBA 2IVDA 2WDQA 3T0KA 4Z25A 5JCLA 4FK1C 4OPDA 1FS9A 4H4WA 4YKGA 1YQ4A 1PXBA 4GUVA 1M1RA 4YTMA 5BVAA 2OAMA 3JSKA 3D8XA 4NNJA 2R9ZA 2FJEA 3F8RA 3NN0X 2TPRA 3SZWA 1UKVG 4PABA 2YG6A 3K7QX 3T2YA 1Q1RA 1FEBA 4K22A 3BNUA 4A6NB 3AE2A 1E39A 2E81A 1B37A 2J3NA 3LB8A 2XVIA 1LPFA 1H86A 4II3A 2H88A 3UOVA 2CVJA 4OPCA 4GR1A 4X9MA 3OWMA 1CBOA 1BZLA 1JRXA 1FEAA 1ZMDA 5JCMA 1IUSA 2GQFA 1DJQA 1TDNA 3LZXA 4UP3A 3AE8A 1PJ6A 2R46A 4G6HA 2YR4A 4H2RA 2YLZA 3C4NA 5EOWA 3SCEA 4JY2A 3SZFA 1ZP0A 4YSXA 5KXJA 4JNAA 3VR9A 3KPKA 1E6EA 1NPXA 2APGA 3UP4A 2YLWA 1V59A 2XLPA 3NK1X 4OPGA 4USRA 3II4A 4GDPA 3BNMA 4UDQA 3DJGX 4JQ9A 1FCDA 1REOA 3SXIA 4LA1A 3AECA 1GU6A 3CNSA 4NTDA 1ZY8A 2R0GA 2YR5A 4YKFA 5TR3A 1IJHA 3NIXA 4NWZA 5BRTA 4B65A 2YLSA 4ZN0A 1TYPA 4C3YA 2WP6A 1PDHA 1PHHA 3HZLA 1F6MA 3QSMA 4Q17A 4AOSA 4EIPA 1FT6A 5HXIA 4O5UA 1GRHA 4YTNA 5IQ4A 4U8PA 4REKA 1SP3A 1GERA 2R4JA 1ZX9A 2GR1A 4I58A 1BWCA 1L9DA 1KNRA 1YQZA 1L9EA 1S3EA 2F5ZA 2VRMA 3F8DA 1E1LA 2XVFA 2YLRA 3K7TA 4GAPA 4M52A 1NG3A 2ZZ0A 3B6DA 5M10A 4Q4UA 5CKUA 1H82A 1GRTA 1BKWA 2C3CA 3AYLA 4IV9A 3RNMA 3SM8A 2ZO5A 2EQ6A 1D4DA 1Q1WA 3AE9A 1LV0A 1TDEA 2C67A 4IVMB 2X50A 4C77A 2GR0A 2JB3A 1GRBA 5JCIA 4EQRA 4A9WA 3ADAB 4H4VA 1VRQB 5U63A 3FIMB 1GPEA 2YM2A 2XFQA 3AEFA 3C96A 3UTGA 4E0VA 3NLCA 2B9WA 2YQUA 4GF7A 3RP7A 2BXSA 1S3BA 4OVIA 1EL9A 2WPEA 3AEGA 1XPQA 3Q6JA 4TM1A 2RGJA 1GEUA 5EBKA 5U1OA 4BK1A 4D03A 5KMQA 5KMRA 4BJYA 2PHHA 3NT6A 5IPYA 3IF9A 3E1TA 3LG1A 4OPLA 3G5QA 3P9UA 3DMEA 1ZKQA 2WESA 4Y4MA 2B7RA 1GOSA 3GD3A 4H4PA 1GTEA 3CNDA 3Q9TA 3QSEA 1CL0A 2V61A 3KU9A 2BCGG 4AOXA 3K30A 1DNCA 2X8HA 3VRBA 1JEHA 2RGOA 4FX9A 2B76A 4H4QA 4NTCA 1LQTA 3DH9A 3DK8A 3NHOX 4Y4LA 1HYUA 1CHUA 1IUUA 1GSNA 1N4VA 2WETA 4ZCCA 3UTEA 1GALA 2WP5A 2ARDA 2C75A 3FG2P 4L3XA 1N4UA 2GMJA 2XFPA 3AEBA 3BHKA 4WX1A 2R4EA 5FS6A 3T31A 3FO3A 3AYJA 2BC1A 5KOWA 3F29A 3T2KA 2PYXA 3OC4A 4II2A 4IVOB 1PXAA 3NNEA 3DA1A 1N1PA 3QJ4A 5FS9A 5FS8A 1QLBA 3AE1A 3KKJA 3SXQA 1KDGA 4Q1OA 5J60A 3RP8A 2EQ7A 5BUKA 2GR3A 4ECHA 3S61A 4APNA 4NEVA 2C3DA 1LJ1A 3VQRA 2BACA 3UKKA 3FPZA 4G74A 5ER0A 4LU6A 1OJCA 2Z5XA 3ATQA 2OA1A 4UDPA 1GXFA 4EIQA 1JNZA 3ISHA 1LTXR 3AB1A 2EQ9A 4BK3A 4AP1A 1FS7A 5KRQA 5KVHA 5HY5A 3CGDA 3M0OA 2FJBA 3GYIA 1ZMCA 1DOBA 4BK2A 2WHDA 3UKHA 4Z43A 3V3OA 4CY8A 1PXCA 2BK3A 3AD8B 3F8PA 4H2NA 5KVIA 3SZCA 1RP0A 1KSUA 1PS9A 3GRSA 3H4KA 4CNJA 5KOXA 2JAEA 2VVMA 1D7LA 1CJ2A 5EB5A 4P9SA 4J57A 1M1PA 2H89A 3AEAA 3KPFA 3SFDA 2I0ZA 4RSLA 1EL5A 1OJ9A 3LADA 4EM4A 4CRTA 4U8JA 3M12A 3BI2A 4XWZA 4K7ZA 1PBEA 2E5VA 4H4UA 4BV6A 3REDA 3AEEA 2YVGA 4B67A 4Z26A 4AT2A 2JBVA 1H7XA 3SFEA 1OJDA 1GRFA 4GRTA 1EL7A 1JRYA 3GWFA 1FS8A 1NEKA 2C7GA 2AR8A 1JNIA 3D1IA 3PVCA 4A7AA 3G5RA 3GYXA 3S5WA 5KMSA 1CF3A 1E1KA 1CC6A 2XVEA 1E1MA 2W0HA 3CGEA 3SQPA 1DXLA 1Y0PA 3UBRA 2XLTA 3AEDA 2X8CA 4OCGA 2GEWA 3DK4A 3DK9A 3GDNA 2WBAA 3KLJA 5L46A 3SYIA 3P4SA 1GRAA 1MOKA 1ELIA 1IUXA 3BNFA 2C66A 2X99A 5HHFA 5M0ZA 2UZZA 1DJNA 4WJYA 4EMWA 3WE0A 3OZ2A 2BK4A 5C2TA 1H84A 2RABA 2BC0A 4C74A 2Z5YA 4JY3A 2C65A 1JOAA 3EANA 1IUTA 4EQWA 3KD9A 4X4JA 4J33A 4U8IA 1PJ7A 1MO9A 1GTHA 3LJPA 3ZYXA 1DOCA 2VQ7A 2X8GA 1QDBA 2GAHB 1COYA 1NDAA 3BNGA 3AE4A 4XXGA 3URHA 1IUVA 4DSGA 1X31B 2WS3A 3B3RA 4BJZA 1H7WA 2OALA 4KPRA 4K8DA 2RF7A 1H6VA 2B9YA 2Q0KA 3L1TA 4U8NA 3IHGA 3RKHA 2BXRA 1PBBA 1S2QA 2OT4A 4TM3A 2Y6QA 4K5RA 1ZOVA 1KSSA 1W4XA 2XLSA 3AWIA 1ONFA 2Q7VA 3DJDA 5GRTA 5C3JA 2YLXA 4Z24A 1XHCA 3HYXA 3CNTA 1NENA 2BS2A 3AE5A 3ICSA 3IWAA 4H4RA 3H8LA 3DGHA 1AOGA 4C5OA 2J7AA 3CGBA 3CPIG 3BI4A 4XWRA 2QCUA 4YSZA 1Y56A 2OLOA 1H81A 1O95A 3COXA 3M13A 1EBDA 4H2PA 1TDOA 4D04A 2C4CA 2IVEA 3DJEA 4Q5CA 4RG3A 2GR2A 4TM0A 3H8IA 4U2TA 3NN6X 4H4TA 1JU2A 3DGZA 3P4QA 4PAAA 1TDFA 2OLNA 4FDCB 2GAGB 3RHAA 1O5WA 3T14A 4L3YA 4B69A 3UKPA 3UTHA 3BHFA 2QA1A 2E4GA 2YVFA 4USQA 4TM4A 2RGHA 1GESA 4H4SA 4U8KA 1FOHA 4YSHA 4G73A 1RYIA 3C4AA 4LIIA 1GV4A 3NTDA 1F8SA 3NYFA 2EQ8A 3QFAA 2JB1A 4DSHA 4Y4NA 1SEZA 4Z2UA 1VQWA 2GH5A 3NYEA 1F8WA 4HA6A 3UCLA 2Q6UA 3CMMA 1PBDA 4IA6A 3PO7A 1DODA 3CNJA 4GAVA 3LZWA 1DOEA 1S2YA 4JNQA 1PBFA 2V3AA 4X9NA 4NZHA 4YT0A 3GYJA 2XCGA 2WU5A 1BVBA 3NKSA 4ADWA 2NPXA 5FS7A 1K0LA 2XFUA 1D7YA 2V5ZA 4B64A 2VR0A 2WOIA 1D4EA 1K0IA 2GQWA 2C73A 3ATRA 3AD9B 3QSSA 2RDZA 3EAOA 2E1MA 1P2EA 3ALMA 1L0VA 4AT0A 4EM3A 3NYCA 3GMBA 1VDCA 1NHSA 3UTFA 2BYBA 2WPCA 2R0PA 2C72A 2TMDA 2WU2A 4JDRA 2B7SA 2WQYA 4OPIA 5J7XA 3K7MX 4U2SA 3GM6A 4CCQA 3DJJA 4YSYA 4NTEA 4H50A 3I3LA 2BS4A 4J34A 1VG9A 1YQ3A 4U2LA 4BURA 3KVEA 4TLXA 2LFCA 1P2HA 3QFBA 1KFYA 1N4WA 3BNJA 4L3ZA 3FMWA 4J36A 2YWLA 1XANA 2GV8A 4U8OA 1B4VA 3CTYA 3LXDA 2YR6A 4JN9A 2AQJA 2ZZCA 1CC4A 2B9XA 5LV9A 2BCPA 1LVLA 2XDOA 4AP3A 2JKCA 2VVLG 1CJCA 1XDIA 3AE3A 1MXTA 2YM1A 1GNDA 5CQFA 3V3NA 3ALJA 2XVJA 4EQXA 3NG7X 1ZOYA 1M6IA 3IHMA 3SX6A 4O5QA 4Z2RA 3S7WA 2FJDA 4H2QA 3IC9A 3V76A 2WPFA 2HQMA 1OJAA 1K4QA 2A8XA 2C76A 2Q0LA 3EPTA 3GDPA 3NK0X 4A65A 1GT8A 1F8RA 3GMCA 1E7PA 3D1CA 2QA2A 3VR8A 1VG0A 3G5SA 4GCMA 3AD7B 4U8MA 1FT5A 1M64A 2E80A 2GRTA 2YG4A 1GREA 3NH3X 4H7UA 1NAAA 3LGQA 3AXBA 3CNPA 1NHRA 3PS9A 1YKJA 1Q9IA 1NG4A 1ZDLA 2WOWA 2XVHA 2C70A 3FBSA 3NGCX 5DBJA 2K3VA 2R45A 3ZDNA 5KWFA 3CGCA 4RG4A 3R9UA 1BGNA 3VRDB 5JCKA 3SZ0A 3GSIA 1EL8A 4A6NA 4J31A 2ZBWA 5EB4A 3T2ZA 4B68A 4Q5BA 3UKQA 3UU9A 1KF6A 3NTAA 4H4ZA 3UOYA 1IUWA 2WEUA 3CN8A 2YAUA 4EMJA 3P1WA 4J56A 3HYWA 2XLRA 3RP6A 4Z2TA 4OPUA 2V3BA 3ITJA 2V60A 4K2XA 3LOVA 3MMOA 3AYIA 4ICYA 1FL2A 2V6OA 2ACZA 3ABVA 4A79A 5HYMA 2GVCA 1K0JA 3ALLA 3I6DA 1Z6LA 3GD4A 4H4YA 3NK2X 4H4XA 3UOXA 1Y56B 1PN0A 2GB0A 4B1BA 2WDVA 3CIRA 3UKAA 1OJTA 4MJWA 4C3XA 4TLZA 2VQBA 1CC2A 4J2WA 1RSGA 5IQ1A 1JNRA 2FBWA 4A99A 2O9ZA 4CNKA 3O0HA 5U25A 3SY4A 2JK6A 3L1RA 3GRTA 4EMIA 1QJDA 4WCTA 4G9KA 4Z44A 1D4CA 2CULA 2VZ2A 1NHQA 1KNPA 2BRYA 4K5SA 3UP5A 1FECA 1OAHA 1F3PA 3SGLA 3BI5A 4DNAA 2IIDA 1PBCA 3UOZA 2FJAA 3T37A 4G6GA 4YTPA 1M1QA 4IA5A 5JCNA 4EQSA 4KX6A 1D5TA 4GDEA 2XFNA 3BNHA 2BK5A 2YVJA 4N9XA 4ZCDA 5GSNA 1CJ4A 2VOUA 2WDRA 4B66A 3UKLA 3AE7A 1JRZA 3NRNA 3P4PA 4YWOA 4CBQA 1GETA 3L8KA 2DKIA 4OPTA 4HB9A 3ICRA 2WP9A 3KA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L38 A;  2A87 A;  2R0C A;  3P4R A;  3GWD A;  2JB2 A;  4NEW A;  1O94 A;  1B8S A;  1ZK7 A;  4YXD A;  5FMH A;  2X3N A;  3TOR A;  3CPH G;  3QVR A;  1LQU A;  3VRA A;  2DKH A;  1BGJ A;  4Q0T A;  1PJ5 A;  2AAQ A;  2C64 A;  2YG7 A;  5BUL A;  4A5L A;  2XYO A;  1H83 A;  2XFO A;  2GMH A;  1L9C A;  3QVP A;  3ICT A;  1TYT A;  2A89 A;  2XLU A;  1GRG A;  1TDK A;  4I59 A;  4U8L A;  2YG5 A;  1B5Q A;  2YLT A;  2BA9 A;  2Y6R A;  3EF6 A;  4CCR A;  2BS3 A;  3UKF A;  2VVL A;  1QO8 A;  3CPJ G;  2BAB A;  1NHP A;  2QAE A;  1E1N A;  2WOV A;  2CFY A;  2VRL A;  1TRB A;  4B63 A;  1CJ3 A;  2GF3 A;  2NVK X;  4FK1 A;  2CDU A;  4UDR A;  3AE6 A;  1YY5 A;  2YG3 A;  2ZZB A;  4CY6 A;  4DGK A;  1BF3 A;  3TTB A;  2IVD A;  2WDQ A;  4Z25 A;  5JCL A;  4FK1 C;  4OPD A;  1FS9 A;  4H4W A;  4YKG A;  1YQ4 A;  1PXB A;  4GUV A;  1M1R A;  4YTM A;  5BVA A;  2OAM A;  3JSK A;  3D8X A;  2R9Z A;  2FJE A;  3F8R A;  3NN0 X;  2TPR A;  1UKV G;  4PAB A;  2YG6 A;  3K7Q X;  1Q1R A;  1FEB A;  4K22 A;  3BNU A;  4A6N B;  3AE2 A;  1E39 A;  2E81 A;  1B37 A;  2J3N A;  3LB8 A;  2XVI A;  1LPF A;  1H86 A;  2H88 A;  3UOV A;  2CVJ A;  4OPC A;  4GR1 A;  4X9M A;  3OWM A;  1CBO A;  1BZL A;  1JRX A;  1FEA A;  1ZMD A;  5JCM A;  1IUS A;  2GQF A;  1DJQ A;  1TDN A;  3LZX A;  4UP3 A;  3AE8 A;  1PJ6 A;  2R46 A;  2YR4 A;  4H2R A;  2YLZ A;  3C4N A;  5EOW A;  3SCE A;  4JY2 A;  1ZP0 A;  4YSX A;  5KXJ A;  4JNA A;  3VR9 A;  1E6E A;  1NPX A;  2APG A;  3UP4 A;  2YLW A;  1V59 A;  2XLP A;  3NK1 X;  4OPG A;  4USR A;  3II4 A;  4GDP A;  3BNM A;  4UDQ A;  3DJG X;  4JQ9 A;  1FCD A;  1REO A;  4LA1 A;  3AEC A;  1GU6 A;  3CNS A;  4NTD A;  1ZY8 A;  2R0G A;  2YR5 A;  4YKF A;  5TR3 A;  1IJH A;  3NIX A;  5BRT A;  4B65 A;  2YLS A;  4ZN0 A;  1TYP A;  4C3Y A;  2WP6 A;  1PDH A;  1PHH A;  3HZL A;  1F6M A;  3QSM A;  4Q17 A;  4AOS A;  4EIP A;  1FT6 A;  5HXI A;  4O5U A;  1GRH A;  4YTN A;  5IQ4 A;  4U8P A;  4REK A;  1SP3 A;  1GER A;  2R4J A;  1ZX9 A;  2GR1 A;  4I58 A;  1BWC A;  1L9D A;  1KNR A;  1YQZ A;  1L9E A;  1S3E A;  2F5Z A;  2VRM A;  3F8D A;  1E1L A;  2XVF A;  2YLR A;  3K7T A;  4M52 A;  1NG3 A;  2ZZ0 A;  3B6D A;  5M10 A;  4Q4U A;  5CKU A;  1H82 A;  1GRT A;  1BKW A;  2C3C A;  3AYL A;  4IV9 A;  3RNM A;  3SM8 A;  2ZO5 A;  2EQ6 A;  1D4D A;  1Q1W A;  3AE9 A;  1LV0 A;  1TDE A;  2C67 A;  4IVM B;  2X50 A;  4C77 A;  2GR0 A;  2JB3 A;  1GRB A;  5JCI A;  4EQR A;  4A9W A;  3ADA B;  4H4V A;  1VRQ B;  5U63 A;  3FIM B;  1GPE A;  2YM2 A;  2XFQ A;  3AEF A;  3C96 A;  3UTG A;  4E0V A;  3NLC A;  2B9W A;  2YQU A;  4GF7 A;  3RP7 A;  2BXS A;  1S3B A;  4OVI A;  1EL9 A;  2WPE A;  3AEG A;  1XPQ A;  3Q6J A;  4TM1 A;  2RGJ A;  1GEU A;  5EBK A;  5U1O A;  4BK1 A;  4D03 A;  4BJY A;  2PHH A;  3NT6 A;  5IPY A;  3IF9 A;  3E1T A;  3LG1 A;  4OPL A;  3G5Q A;  3P9U A;  3DME A;  1ZKQ A;  2WES A;  4Y4M A;  2B7R A;  1GOS A;  3GD3 A;  4H4P A;  1GTE A;  3CND A;  3Q9T A;  3QSE A;  1CL0 A;  2V61 A;  3KU9 A;  2BCG G;  4AOX A;  3K30 A;  1DNC A;  2X8H A;  3VRB A;  1JEH A;  2RGO A;  4FX9 A;  2B76 A;  4H4Q A;  4NTC A;  1LQT A;  3DH9 A;  3DK8 A;  3NHO X;  4Y4L A;  1HYU A;  1CHU A;  1IUU A;  1GSN A;  1N4V A;  2WET A;  4ZCC A;  3UTE A;  1GAL A;  2WP5 A;  2ARD A;  2C75 A;  3FG2 P;  4L3X A;  1N4U A;  2GMJ A;  2XFP A;  3AEB A;  3BHK A;  4WX1 A;  2R4E A;  5FS6 A;  3FO3 A;  3AYJ A;  2BC1 A;  5KOW A;  3F29 A;  2PYX A;  3OC4 A;  4IVO B;  1PXA A;  3NNE A;  3DA1 A;  1N1P A;  3QJ4 A;  5FS9 A;  5FS8 A;  1QLB A;  3AE1 A;  3KKJ A;  3SXQ A;  1KDG A;  4Q1O A;  5J60 A;  3RP8 A;  2EQ7 A;  5BUK A;  2GR3 A;  4ECH A;  3S61 A;  4APN A;  4NEV A;  2C3D A;  1LJ1 A;  3VQR A;  2BAC A;  3UKK A;  3FPZ A;  5ER0 A;  4LU6 A;  1OJC A;  2Z5X A;  3ATQ A;  2OA1 A;  4UDP A;  1GXF A;  4EIQ A;  1JNZ A;  3ISH A;  1LTX R;  3AB1 A;  2EQ9 A;  4BK3 A;  4AP1 A;  1FS7 A;  5KRQ A;  5KVH A;  5HY5 A;  3CGD A;  3M0O A;  2FJB A;  3GYI A;  1ZMC A;  1DOB A;  4BK2 A;  2WHD A;  3UKH A;  4Z43 A;  3V3O A;  4CY8 A;  1PXC A;  2BK3 A;  3AD8 B;  3F8P A;  4H2N A;  5KVI A;  1RP0 A;  1KSU A;  1PS9 A;  3GRS A;  3H4K A;  4CNJ A;  5KOX A;  2JAE A;  2VVM A;  1D7L A;  1CJ2 A;  5EB5 A;  4P9S A;  4J57 A;  1M1P A;  2H89 A;  3AEA A;  3KPF A;  3SFD A;  2I0Z A;  4RSL A;  1EL5 A;  1OJ9 A;  3LAD A;  4EM4 A;  4CRT A;  4U8J A;  3M12 A;  3BI2 A;  4XWZ A;  4K7Z A;  1PBE A;  2E5V A;  4H4U A;  4BV6 A;  3RED A;  3AEE A;  2YVG A;  4B67 A;  4Z26 A;  4AT2 A;  2JBV A;  1H7X A;  3SFE A;  1OJD A;  1GRF A;  4GRT A;  1EL7 A;  1JRY A;  3GWF A;  1FS8 A;  1NEK A;  2C7G A;  2AR8 A;  1JNI A;  3D1I A;  3PVC A;  4A7A A;  3G5R A;  3S5W A;  3GYX A;  1CF3 A;  1E1K A;  1CC6 A;  2XVE A;  1E1M A;  2W0H A;  3CGE A;  3SQP A;  1DXL A;  1Y0P A;  3UBR A;  2XLT A;  3AED A;  2X8C A;  4OCG A;  2GEW A;  3DK4 A;  3DK9 A;  3GDN A;  2WBA A;  3KLJ A;  5L46 A;  3P4S A;  1GRA A;  1MOK A;  1ELI A;  1IUX A;  3BNF A;  2C66 A;  2X99 A;  5HHF A;  5M0Z A;  2UZZ A;  1DJN A;  4WJY A;  4EMW A;  3WE0 A;  3OZ2 A;  2BK4 A;  5C2T A;  1H84 A;  2RAB A;  2BC0 A;  4C74 A;  2Z5Y A;  4JY3 A;  2C65 A;  1JOA A;  3EAN A;  1IUT A;  4EQW A;  3KD9 A;  4X4J A;  4J33 A;  4U8I A;  1PJ7 A;  1MO9 A;  1GTH A;  3LJP A;  3ZYX A;  1DOC A;  2VQ7 A;  2X8G A;  1QDB A;  2GAH B;  1COY A;  1NDA A;  3BNG A;  3AE4 A;  4XXG A;  3URH A;  1IUV A;  4DSG A;  1X31 B;  2WS3 A;  3B3R A;  4BJZ A;  1H7W A;  2OAL A;  4KPR A;  4K8D A;  2RF7 A;  1H6V A;  2B9Y A;  2Q0K A;  3L1T A;  4U8N A;  3IHG A;  3RKH A;  2BXR A;  1PBB A;  1S2Q A;  2OT4 A;  4TM3 A;  2Y6Q A;  4K5R A;  1ZOV A;  1KSS A;  1W4X A;  2XLS A;  3AWI A;  1ONF A;  2Q7V A;  3DJD A;  5GRT A;  5C3J A;  2YLX A;  4Z24 A;  1XHC A;  3CNT A;  1NEN A;  2BS2 A;  3AE5 A;  3ICS A;  3IWA A;  4H4R A;  3H8L A;  3DGH A;  1AOG A;  4C5O A;  2J7A A;  3CGB A;  3CPI G;  3BI4 A;  4XWR A;  2QCU A;  4YSZ A;  1Y56 A;  2OLO A;  1H81 A;  1O95 A;  3COX A;  3M13 A;  1EBD A;  4H2P A;  1TDO A;  4D04 A;  2IVE A;  3DJE A;  4Q5C A;  4RG3 A;  2GR2 A;  4TM0 A;  3H8I A;  4U2T A;  3NN6 X;  4H4T A;  1JU2 A;  3DGZ A;  3P4Q A;  4PAA A;  1TDF A;  2OLN A;  4FDC B;  2GAG B;  3RHA A;  1O5W A;  4L3Y A;  4B69 A;  3UKP A;  3UTH A;  3BHF A;  2QA1 A;  2E4G A;  2YVF A;  4USQ A;  4TM4 A;  2RGH A;  1GES A;  4H4S A;  4U8K A;  1FOH A;  4YSH A;  4LII A;  1RYI A;  3C4A A;  1GV4 A;  3NTD A;  1F8S A;  3NYF A;  2EQ8 A;  3QFA A;  2JB1 A;  4DSH A;  4Y4N A;  1SEZ A;  4Z2U A;  1VQW A;  2GH5 A;  3NYE A;  1F8W A;  4HA6 A;  3UCL A;  2Q6U A;  1PBD A;  4IA6 A;  3PO7 A;  1DOD A;  3CNJ A;  3LZW A;  1DOE A;  1S2Y A;  4JNQ A;  1PBF A;  2V3A A;  4X9N A;  4NZH A;  4YT0 A;  3GYJ A;  2XCG A;  2WU5 A;  1BVB A;  3NKS A;  4ADW A;  2NPX A;  5FS7 A;  1K0L A;  2XFU A;  1D7Y A;  2V5Z A;  4B64 A;  2VR0 A;  2WOI A;  1D4E A;  1K0I A;  2GQW A;  2C73 A;  3ATR A;  3AD9 B;  3QSS A;  2RDZ A;  3EAO A;  2E1M A;  1P2E A;  3ALM A;  1L0V A;  4AT0 A;  4EM3 A;  3NYC A;  3GMB A;  1VDC A;  1NHS A;  3UTF A;  2BYB A;  2WPC A;  2R0P A;  2C72 A;  2TMD A;  2WU2 A;  4JDR A;  2B7S A;  2WQY A;  4OPI A;  5J7X A;  3K7M X;  4U2S A;  3GM6 A;  4CCQ A;  3DJJ A;  4YSY A;  4NTE A;  4H50 A;  3I3L A;  2BS4 A;  4J34 A;  1VG9 A;  1YQ3 A;  4U2L A;  4BUR A;  3KVE A;  4TLX A;  2LFC A;  1P2H A;  3QFB A;  1KFY A;  1N4W A;  3BNJ A;  4L3Z A;  3FMW A;  4J36 A;  2YWL A;  1XAN A;  2GV8 A;  4U8O A;  1B4V A;  3CTY A;  3LXD A;  2YR6 A;  4JN9 A;  2AQJ A;  2ZZC A;  1CC4 A;  2B9X A;  5LV9 A;  2BCP A;  1LVL A;  2XDO A;  4AP3 A;  2JKC A;  2VVL G;  1CJC A;  1XDI A;  3AE3 A;  1MXT A;  2YM1 A;  1GND A;  5CQF A;  3V3N A;  3ALJ A;  2XVJ A;  4EQX A;  3NG7 X;  1ZOY A;  1M6I A;  3IHM A;  4Z2R A;  4O5Q A;  3S7W A;  2FJD A;  4H2Q A;  3IC9 A;  3V76 A;  2WPF A;  2HQM A;  1OJA A;  1K4Q A;  2A8X A;  2C76 A;  2Q0L A;  3EPT A;  3GDP A;  3NK0 X;  4A65 A;  1GT8 A;  1F8R A;  3GMC A;  1E7P A;  3D1C A;  2QA2 A;  3VR8 A;  1VG0 A;  3G5S A;  4GCM A;  3AD7 B;  4U8M A;  1FT5 A;  1M64 A;  2E80 A;  2GRT A;  2YG4 A;  1GRE A;  3NH3 X;  4H7U A;  1NAA A;  3LGQ A;  3AXB A;  3CNP A;  1NHR A;  3PS9 A;  1YKJ A;  1Q9I A;  1NG4 A;  1ZDL A;  2WOW A;  2XVH A;  2C70 A;  3FBS A;  3NGC X;  5DBJ A;  2K3V A;  2R45 A;  3ZDN A;  5KWF A;  3CGC A;  4RG4 A;  3R9U A;  1BGN A;  3VRD B;  5JCK A;  4A6N A;  3GSI A;  1EL8 A;  4J31 A;  2ZBW A;  5EB4 A;  4B68 A;  4Q5B A;  3UKQ A;  3UU9 A;  1KF6 A;  3NTA A;  4H4Z A;  3UOY A;  1IUW A;  2WEU A;  3CN8 A;  2YAU A;  4EMJ A;  3P1W A;  4J56 A;  4Z2T A;  2XLR A;  3RP6 A;  4OPU A;  2V3B A;  3ITJ A;  2V60 A;  4K2X A;  3LOV A;  3MMO A;  3AYI A;  4ICY A;  1FL2 A;  2V6O A;  2ACZ A;  3ABV A;  4A79 A;  5HYM A;  2GVC A;  1K0J A;  3ALL A;  3I6D A;  1Z6L A;  3GD4 A;  4H4Y A;  3NK2 X;  4H4X A;  3UOX A;  1Y56 B;  1PN0 A;  2GB0 A;  4B1B A;  2WDV A;  3CIR A;  3UKA A;  1OJT A;  4MJW A;  4C3X A;  4TLZ A;  2VQB A;  1CC2 A;  4J2W A;  1RSG A;  5IQ1 A;  1JNR A;  2FBW A;  4A99 A;  2O9Z A;  4CNK A;  3O0H A;  5U25 A;  2JK6 A;  3L1R A;  3GRT A;  4EMI A;  1QJD A;  4WCT A;  4Z44 A;  1D4C A;  2CUL A;  2VZ2 A;  1NHQ A;  1KNP A;  4K5S A;  3UP5 A;  1FEC A;  1OAH A;  1F3P A;  3SGL A;  3BI5 A;  4DNA A;  2IID A;  1PBC A;  3UOZ A;  2FJA A;  3T37 A;  4YTP A;  1M1Q A;  4IA5 A;  5JCN A;  4EQS A;  4KX6 A;  1D5T A;  4GDE A;  2XFN A;  3BNH A;  2BK5 A;  2YVJ A;  4N9X A;  4ZCD A;  5GSN A;  1CJ4 A;  2VOU A;  2WDR A;  4B66 A;  3UKL A;  3AE7 A;  1JRZ A;  3NRN A;  3P4P A;  4YWO A;  4CBQ A;  1GET A;  3L8K A;  2DKI A;  4OPT A;  4HB9 A;  3ICR A;  2WP9 A;  3KA7 A; 
#chains in the Genus database with same CATH topology
 4L38 A;  3HYV A;  2A87 A;  2R0C A;  3P4R A;  3GWD A;  2JB2 A;  4NEW A;  1O94 A;  1B8S A;  1ZK7 A;  4YXD A;  5FMH A;  2X3N A;  3TOR A;  2BRA A;  3CPH G;  3QVR A;  5KMP A;  5KNL A;  1LQU A;  3VRA A;  2DKH A;  1BGJ A;  4Q0T A;  1PJ5 A;  2AAQ A;  2C64 A;  2YG7 A;  5BUL A;  4A5L A;  2XYO A;  1H83 A;  2XFO A;  2GMH A;  1L9C A;  3QVP A;  3ICT A;  1TYT A;  2A89 A;  2XLU A;  1GRG A;  1TDK A;  4I59 A;  4U8L A;  2YG5 A;  1B5Q A;  2YLT A;  2BA9 A;  2Y6R A;  3EF6 A;  4CCR A;  2BS3 A;  3UKF A;  2VVL A;  1QO8 A;  3CPJ G;  2BAB A;  1NHP A;  2QAE A;  1E1N A;  2WOV A;  2CFY A;  2VRL A;  1TRB A;  4B63 A;  1CJ3 A;  2GF3 A;  2NVK X;  4FK1 A;  2CDU A;  4UDR A;  3AE6 A;  1YY5 A;  2YG3 A;  2ZZB A;  4CY6 A;  4DGK A;  1BF3 A;  3TTB A;  2IVD A;  2WDQ A;  3T0K A;  4Z25 A;  5JCL A;  4FK1 C;  4OPD A;  1FS9 A;  4H4W A;  4YKG A;  1YQ4 A;  1PXB A;  4GUV A;  1M1R A;  4YTM A;  5BVA A;  2OAM A;  3JSK A;  3D8X A;  4NNJ A;  2R9Z A;  2FJE A;  3F8R A;  3NN0 X;  2TPR A;  3SZW A;  1UKV G;  4PAB A;  2YG6 A;  3K7Q X;  3T2Y A;  1Q1R A;  1FEB A;  4K22 A;  3BNU A;  4A6N B;  3AE2 A;  1E39 A;  2E81 A;  1B37 A;  2J3N A;  3LB8 A;  2XVI A;  1LPF A;  1H86 A;  4II3 A;  2H88 A;  3UOV A;  2CVJ A;  4OPC A;  4GR1 A;  4X9M A;  3OWM A;  1CBO A;  1BZL A;  1JRX A;  1FEA A;  1ZMD A;  5JCM A;  1IUS A;  2GQF A;  1DJQ A;  1TDN A;  3LZX A;  4UP3 A;  3AE8 A;  1PJ6 A;  2R46 A;  4G6H A;  2YR4 A;  4H2R A;  2YLZ A;  3C4N A;  5EOW A;  3SCE A;  4JY2 A;  3SZF A;  1ZP0 A;  4YSX A;  5KXJ A;  4JNA A;  3VR9 A;  3KPK A;  1E6E A;  1NPX A;  2APG A;  3UP4 A;  2YLW A;  1V59 A;  2XLP A;  3NK1 X;  4OPG A;  4USR A;  3II4 A;  4GDP A;  3BNM A;  4UDQ A;  3DJG X;  4JQ9 A;  1FCD A;  1REO A;  3SXI A;  4LA1 A;  3AEC A;  1GU6 A;  3CNS A;  4NTD A;  1ZY8 A;  2R0G A;  2YR5 A;  4YKF A;  5TR3 A;  1IJH A;  3NIX A;  4NWZ A;  5BRT A;  4B65 A;  2YLS A;  4ZN0 A;  1TYP A;  4C3Y A;  2WP6 A;  1PDH A;  1PHH A;  3HZL A;  1F6M A;  3QSM A;  4Q17 A;  4AOS A;  4EIP A;  1FT6 A;  5HXI A;  4O5U A;  1GRH A;  4YTN A;  5IQ4 A;  4U8P A;  4REK A;  1SP3 A;  1GER A;  2R4J A;  1ZX9 A;  2GR1 A;  4I58 A;  1BWC A;  1L9D A;  1KNR A;  1YQZ A;  1L9E A;  1S3E A;  2F5Z A;  2VRM A;  3F8D A;  1E1L A;  2XVF A;  2YLR A;  3K7T A;  4GAP A;  4M52 A;  1NG3 A;  2ZZ0 A;  3B6D A;  5M10 A;  4Q4U A;  5CKU A;  1H82 A;  1GRT A;  1BKW A;  2C3C A;  3AYL A;  4IV9 A;  3RNM A;  3SM8 A;  2ZO5 A;  2EQ6 A;  1D4D A;  1Q1W A;  3AE9 A;  1LV0 A;  1TDE A;  2C67 A;  4IVM B;  2X50 A;  4C77 A;  2GR0 A;  2JB3 A;  1GRB A;  5JCI A;  4EQR A;  4A9W A;  3ADA B;  4H4V A;  1VRQ B;  5U63 A;  3FIM B;  1GPE A;  2YM2 A;  2XFQ A;  3AEF A;  3C96 A;  3UTG A;  4E0V A;  3NLC A;  2B9W A;  2YQU A;  4GF7 A;  3RP7 A;  2BXS A;  1S3B A;  4OVI A;  1EL9 A;  2WPE A;  3AEG A;  1XPQ A;  3Q6J A;  4TM1 A;  2RGJ A;  1GEU A;  5EBK A;  5U1O A;  4BK1 A;  4D03 A;  5KMQ A;  5KMR A;  4BJY A;  2PHH A;  3NT6 A;  5IPY A;  3IF9 A;  3E1T A;  3LG1 A;  4OPL A;  3G5Q A;  3P9U A;  3DME A;  1ZKQ A;  2WES A;  4Y4M A;  2B7R A;  1GOS A;  3GD3 A;  4H4P A;  1GTE A;  3CND A;  3Q9T A;  3QSE A;  1CL0 A;  2V61 A;  3KU9 A;  2BCG G;  4AOX A;  3K30 A;  1DNC A;  2X8H A;  3VRB A;  1JEH A;  2RGO A;  4FX9 A;  2B76 A;  4H4Q A;  4NTC A;  1LQT A;  3DH9 A;  3DK8 A;  3NHO X;  4Y4L A;  1HYU A;  1CHU A;  1IUU A;  1GSN A;  1N4V A;  2WET A;  4ZCC A;  3UTE A;  1GAL A;  2WP5 A;  2ARD A;  2C75 A;  3FG2 P;  4L3X A;  1N4U A;  2GMJ A;  2XFP A;  3AEB A;  3BHK A;  4WX1 A;  2R4E A;  5FS6 A;  3T31 A;  3FO3 A;  3AYJ A;  2BC1 A;  5KOW A;  3F29 A;  3T2K A;  2PYX A;  3OC4 A;  4II2 A;  4IVO B;  1PXA A;  3NNE A;  3DA1 A;  1N1P A;  3QJ4 A;  5FS9 A;  5FS8 A;  1QLB A;  3AE1 A;  3KKJ A;  3SXQ A;  1KDG A;  4Q1O A;  5J60 A;  3RP8 A;  2EQ7 A;  5BUK A;  2GR3 A;  4ECH A;  3S61 A;  4APN A;  4NEV A;  2C3D A;  1LJ1 A;  3VQR A;  2BAC A;  3UKK A;  3FPZ A;  4G74 A;  5ER0 A;  4LU6 A;  1OJC A;  2Z5X A;  3ATQ A;  2OA1 A;  4UDP A;  1GXF A;  4EIQ A;  1JNZ A;  3ISH A;  1LTX R;  3AB1 A;  2EQ9 A;  4BK3 A;  4AP1 A;  1FS7 A;  5KRQ A;  5KVH A;  5HY5 A;  3CGD A;  3M0O A;  2FJB A;  3GYI A;  1ZMC A;  1DOB A;  4BK2 A;  2WHD A;  3UKH A;  4Z43 A;  3V3O A;  4CY8 A;  1PXC A;  2BK3 A;  3AD8 B;  3F8P A;  4H2N A;  5KVI A;  3SZC A;  1RP0 A;  1KSU A;  1PS9 A;  3GRS A;  3H4K A;  4CNJ A;  5KOX A;  2JAE A;  2VVM A;  1D7L A;  1CJ2 A;  5EB5 A;  4P9S A;  4J57 A;  1M1P A;  2H89 A;  3AEA A;  3KPF A;  3SFD A;  2I0Z A;  4RSL A;  1EL5 A;  1OJ9 A;  3LAD A;  4EM4 A;  4CRT A;  4U8J A;  3M12 A;  3BI2 A;  4XWZ A;  4K7Z A;  1PBE A;  2E5V A;  4H4U A;  4BV6 A;  3RED A;  3AEE A;  2YVG A;  4B67 A;  4Z26 A;  4AT2 A;  2JBV A;  1H7X A;  3SFE A;  1OJD A;  1GRF A;  4GRT A;  1EL7 A;  1JRY A;  3GWF A;  1FS8 A;  1NEK A;  2C7G A;  2AR8 A;  1JNI A;  3D1I A;  3PVC A;  4A7A A;  3G5R A;  3GYX A;  3S5W A;  5KMS A;  1CF3 A;  1E1K A;  1CC6 A;  2XVE A;  1E1M A;  2W0H A;  3CGE A;  3SQP A;  1DXL A;  1Y0P A;  3UBR A;  2XLT A;  3AED A;  2X8C A;  4OCG A;  2GEW A;  3DK4 A;  3DK9 A;  3GDN A;  2WBA A;  3KLJ A;  5L46 A;  3SYI A;  3P4S A;  1GRA A;  1MOK A;  1ELI A;  1IUX A;  3BNF A;  2C66 A;  2X99 A;  5HHF A;  5M0Z A;  2UZZ A;  1DJN A;  4WJY A;  4EMW A;  3WE0 A;  3OZ2 A;  2BK4 A;  5C2T A;  1H84 A;  2RAB A;  2BC0 A;  4C74 A;  2Z5Y A;  4JY3 A;  2C65 A;  1JOA A;  3EAN A;  1IUT A;  4EQW A;  3KD9 A;  4X4J A;  4J33 A;  4U8I A;  1PJ7 A;  1MO9 A;  1GTH A;  3LJP A;  3ZYX A;  1DOC A;  2VQ7 A;  2X8G A;  1QDB A;  2GAH B;  1COY A;  1NDA A;  3BNG A;  3AE4 A;  4XXG A;  3URH A;  1IUV A;  4DSG A;  1X31 B;  2WS3 A;  3B3R A;  4BJZ A;  1H7W A;  2OAL A;  4KPR A;  4K8D A;  2RF7 A;  1H6V A;  2B9Y A;  2Q0K A;  3L1T A;  4U8N A;  3IHG A;  3RKH A;  2BXR A;  1PBB A;  1S2Q A;  2OT4 A;  4TM3 A;  2Y6Q A;  4K5R A;  1ZOV A;  1KSS A;  1W4X A;  2XLS A;  3AWI A;  1ONF A;  2Q7V A;  3DJD A;  5GRT A;  5C3J A;  2YLX A;  4Z24 A;  1XHC A;  3HYX A;  3CNT A;  1NEN A;  2BS2 A;  3AE5 A;  3ICS A;  3IWA A;  4H4R A;  3H8L A;  3DGH A;  1AOG A;  4C5O A;  2J7A A;  3CGB A;  3CPI G;  3BI4 A;  4XWR A;  2QCU A;  4YSZ A;  1Y56 A;  2OLO A;  1H81 A;  1O95 A;  3COX A;  3M13 A;  1EBD A;  4H2P A;  2CZS A;  1TDO A;  4D04 A;  2C4C A;  2IVE A;  3DJE A;  4Q5C A;  4RG3 A;  2GR2 A;  4TM0 A;  3H8I A;  4U2T A;  3NN6 X;  4H4T A;  1JU2 A;  3DGZ A;  3P4Q A;  4PAA A;  1TDF A;  2OLN A;  4FDC B;  2GAG B;  3RHA A;  1O5W A;  3T14 A;  4L3Y A;  4B69 A;  3UKP A;  3UTH A;  3BHF A;  2QA1 A;  2E4G A;  2YVF A;  4USQ A;  4TM4 A;  2RGH A;  1GES A;  4H4S A;  4U8K A;  1FOH A;  4YSH A;  4G73 A;  1RYI A;  3C4A A;  4LII A;  1GV4 A;  3NTD A;  1F8S A;  3NYF A;  2EQ8 A;  3QFA A;  2JB1 A;  4DSH A;  4Y4N A;  1SEZ A;  4Z2U A;  1VQW A;  2GH5 A;  3NYE A;  1F8W A;  4HA6 A;  3UCL A;  2Q6U A;  3CMM A;  1PBD A;  4IA6 A;  3PO7 A;  1DOD A;  3CNJ A;  4GAV A;  3LZW A;  1DOE A;  1S2Y A;  4JNQ A;  1PBF A;  2V3A A;  4X9N A;  4NZH A;  4YT0 A;  3GYJ A;  2XCG A;  2WU5 A;  1BVB A;  3NKS A;  4ADW A;  2NPX A;  5FS7 A;  1K0L A;  2XFU A;  1D7Y A;  2V5Z A;  4B64 A;  2VR0 A;  2WOI A;  1D4E A;  1K0I A;  2GQW A;  2C73 A;  3ATR A;  3AD9 B;  3QSS A;  2RDZ A;  3EAO A;  2E1M A;  1P2E A;  3ALM A;  1L0V A;  4AT0 A;  4EM3 A;  3NYC A;  3GMB A;  1VDC A;  1NHS A;  3UTF A;  2BYB A;  2WPC A;  2R0P A;  2C72 A;  2TMD A;  2WU2 A;  4JDR A;  2B7S A;  2WQY A;  4OPI A;  5J7X A;  3K7M X;  4U2S A;  3GM6 A;  4CCQ A;  3DJJ A;  4YSY A;  4NTE A;  4H50 A;  3I3L A;  2BS4 A;  4J34 A;  1VG9 A;  1YQ3 A;  4U2L A;  4BUR A;  3KVE A;  4TLX A;  2LFC A;  1P2H A;  3QFB A;  1KFY A;  1N4W A;  3BNJ A;  4L3Z A;  3FMW A;  4J36 A;  2YWL A;  1XAN A;  2GV8 A;  4U8O A;  1B4V A;  3CTY A;  3LXD A;  2YR6 A;  4JN9 A;  2AQJ A;  2ZZC A;  1CC4 A;  2B9X A;  5LV9 A;  2BCP A;  1LVL A;  2XDO A;  4AP3 A;  2JKC A;  2VVL G;  1CJC A;  1XDI A;  3AE3 A;  1MXT A;  2YM1 A;  1GND A;  5CQF A;  3V3N A;  3ALJ A;  2XVJ A;  4EQX A;  3NG7 X;  1ZOY A;  1M6I A;  3IHM A;  3SX6 A;  4O5Q A;  4Z2R A;  3S7W A;  2FJD A;  4H2Q A;  3IC9 A;  3V76 A;  2WPF A;  2HQM A;  1OJA A;  1K4Q A;  2A8X A;  2C76 A;  2Q0L A;  3EPT A;  3GDP A;  3NK0 X;  4A65 A;  1GT8 A;  1F8R A;  3GMC A;  1E7P A;  3D1C A;  2QA2 A;  3VR8 A;  1VG0 A;  3G5S A;  4GCM A;  3AD7 B;  4U8M A;  1FT5 A;  1M64 A;  2E80 A;  2GRT A;  2YG4 A;  1GRE A;  3NH3 X;  4H7U A;  1NAA A;  3LGQ A;  3AXB A;  3CNP A;  1NHR A;  3PS9 A;  1YKJ A;  1Q9I A;  1NG4 A;  1ZDL A;  2WOW A;  2XVH A;  2C70 A;  3FBS A;  3NGC X;  5DBJ A;  2K3V A;  2R45 A;  3ZDN A;  5KWF A;  3CGC A;  4RG4 A;  3R9U A;  1BGN A;  3VRD B;  5JCK A;  3SZ0 A;  3GSI A;  1EL8 A;  4A6N A;  4J31 A;  2ZBW A;  5EB4 A;  3T2Z A;  4B68 A;  4Q5B A;  3UKQ A;  3UU9 A;  1KF6 A;  3NTA A;  4H4Z A;  3UOY A;  1IUW A;  2WEU A;  3CN8 A;  2YAU A;  4EMJ A;  3P1W A;  4J56 A;  3HYW A;  2XLR A;  3RP6 A;  4Z2T A;  4OPU A;  2V3B A;  3ITJ A;  2V60 A;  4K2X A;  3LOV A;  3MMO A;  3AYI A;  4ICY A;  1FL2 A;  2V6O A;  2ACZ A;  3ABV A;  4A79 A;  5HYM A;  2GVC A;  1K0J A;  3ALL A;  3I6D A;  1Z6L A;  3GD4 A;  4H4Y A;  3NK2 X;  4H4X A;  3UOX A;  1Y56 B;  1PN0 A;  2GB0 A;  4B1B A;  2WDV A;  3CIR A;  3UKA A;  1OJT A;  4MJW A;  4C3X A;  4TLZ A;  2VQB A;  1CC2 A;  4J2W A;  1RSG A;  5IQ1 A;  1JNR A;  2FBW A;  4A99 A;  2O9Z A;  4CNK A;  3O0H A;  5U25 A;  3SY4 A;  2JK6 A;  3L1R A;  3GRT A;  4EMI A;  1QJD A;  4WCT A;  4G9K A;  4Z44 A;  1D4C A;  2CUL A;  2VZ2 A;  1NHQ A;  1KNP A;  2BRY A;  4K5S A;  3UP5 A;  1FEC A;  1OAH A;  1F3P A;  3SGL A;  3BI5 A;  4DNA A;  2IID A;  1PBC A;  3UOZ A;  2FJA A;  3T37 A;  4G6G A;  4YTP A;  1M1Q A;  4IA5 A;  5JCN A;  4EQS A;  4KX6 A;  1D5T A;  4GDE A;  2XFN A;  3BNH A;  2BK5 A;  2YVJ A;  4N9X A;  4ZCD A;  5GSN A;  1CJ4 A;  2VOU A;  2WDR A;  4B66 A;  3UKL A;  3AE7 A;  1JRZ A;  3NRN A;  3P4P A;  4YWO A;  4CBQ A;  1GET A;  3L8K A;  2DKI A;  4OPT A;  4HB9 A;  3ICR A;  2WP9 A;  3KA7 A; 
#chains in the Genus database with same CATH homology
 4L38 A;  3HYV A;  2A87 A;  2R0C A;  3P4R A;  3GWD A;  2JB2 A;  4NEW A;  1O94 A;  1B8S A;  1ZK7 A;  4YXD A;  5FMH A;  2X3N A;  3TOR A;  2BRA A;  3CPH G;  3QVR A;  5KMP A;  5KNL A;  1LQU A;  3VRA A;  2DKH A;  1BGJ A;  4Q0T A;  1PJ5 A;  2AAQ A;  2C64 A;  2YG7 A;  5BUL A;  4A5L A;  2XYO A;  1H83 A;  2XFO A;  2GMH A;  1L9C A;  3QVP A;  3ICT A;  1TYT A;  2A89 A;  2XLU A;  1GRG A;  1TDK A;  4I59 A;  4U8L A;  2YG5 A;  1B5Q A;  2YLT A;  2BA9 A;  2Y6R A;  3EF6 A;  4CCR A;  2BS3 A;  3UKF A;  2VVL A;  1QO8 A;  3CPJ G;  2BAB A;  1NHP A;  2QAE A;  1E1N A;  2WOV A;  2CFY A;  2VRL A;  1TRB A;  4B63 A;  1CJ3 A;  2GF3 A;  2NVK X;  4FK1 A;  2CDU A;  4UDR A;  3AE6 A;  1YY5 A;  2YG3 A;  2ZZB A;  4CY6 A;  4DGK A;  1BF3 A;  3TTB A;  2IVD A;  2WDQ A;  3T0K A;  4Z25 A;  5JCL A;  4FK1 C;  4OPD A;  1FS9 A;  4H4W A;  4YKG A;  1YQ4 A;  1PXB A;  4GUV A;  1M1R A;  4YTM A;  5BVA A;  2OAM A;  3JSK A;  3D8X A;  4NNJ A;  2R9Z A;  2FJE A;  3F8R A;  3NN0 X;  2TPR A;  3SZW A;  1UKV G;  4PAB A;  2YG6 A;  3K7Q X;  3T2Y A;  1Q1R A;  1FEB A;  4K22 A;  3BNU A;  4A6N B;  3AE2 A;  1E39 A;  2E81 A;  1B37 A;  2J3N A;  3LB8 A;  2XVI A;  1LPF A;  1H86 A;  4II3 A;  2H88 A;  3UOV A;  2CVJ A;  4OPC A;  4GR1 A;  4X9M A;  3OWM A;  1CBO A;  1BZL A;  1JRX A;  1FEA A;  1ZMD A;  5JCM A;  1IUS A;  2GQF A;  1DJQ A;  1TDN A;  3LZX A;  4UP3 A;  3AE8 A;  1PJ6 A;  2R46 A;  4G6H A;  2YR4 A;  4H2R A;  2YLZ A;  3C4N A;  5EOW A;  3SCE A;  4JY2 A;  3SZF A;  1ZP0 A;  4YSX A;  5KXJ A;  4JNA A;  3VR9 A;  3KPK A;  1E6E A;  1NPX A;  2APG A;  3UP4 A;  2YLW A;  1V59 A;  2XLP A;  3NK1 X;  4OPG A;  4USR A;  3II4 A;  4GDP A;  3BNM A;  4UDQ A;  3DJG X;  4JQ9 A;  1FCD A;  1REO A;  3SXI A;  4LA1 A;  3AEC A;  1GU6 A;  3CNS A;  4NTD A;  1ZY8 A;  2R0G A;  2YR5 A;  4YKF A;  5TR3 A;  1IJH A;  3NIX A;  4NWZ A;  5BRT A;  4B65 A;  2YLS A;  4ZN0 A;  1TYP A;  4C3Y A;  2WP6 A;  1PDH A;  1PHH A;  3HZL A;  1F6M A;  3QSM A;  4Q17 A;  4AOS A;  4EIP A;  1FT6 A;  5HXI A;  4O5U A;  1GRH A;  4YTN A;  5IQ4 A;  4U8P A;  4REK A;  1SP3 A;  1GER A;  2R4J A;  1ZX9 A;  2GR1 A;  4I58 A;  1BWC A;  1L9D A;  1KNR A;  1YQZ A;  1L9E A;  1S3E A;  2F5Z A;  2VRM A;  3F8D A;  1E1L A;  2XVF A;  2YLR A;  3K7T A;  4GAP A;  4M52 A;  1NG3 A;  2ZZ0 A;  3B6D A;  5M10 A;  4Q4U A;  5CKU A;  1H82 A;  1GRT A;  1BKW A;  2C3C A;  3AYL A;  4IV9 A;  3RNM A;  3SM8 A;  2ZO5 A;  2EQ6 A;  1D4D A;  1Q1W A;  3AE9 A;  1LV0 A;  1TDE A;  2C67 A;  4IVM B;  2X50 A;  4C77 A;  2GR0 A;  2JB3 A;  1GRB A;  5JCI A;  4EQR A;  4A9W A;  3ADA B;  4H4V A;  1VRQ B;  5U63 A;  3FIM B;  1GPE A;  2YM2 A;  2XFQ A;  3AEF A;  3C96 A;  3UTG A;  4E0V A;  3NLC A;  2B9W A;  2YQU A;  4GF7 A;  3RP7 A;  2BXS A;  1S3B A;  4OVI A;  1EL9 A;  2WPE A;  3AEG A;  1XPQ A;  3Q6J A;  4TM1 A;  2RGJ A;  1GEU A;  5EBK A;  5U1O A;  4BK1 A;  4D03 A;  5KMQ A;  5KMR A;  4BJY A;  2PHH A;  3NT6 A;  5IPY A;  3IF9 A;  3E1T A;  3LG1 A;  4OPL A;  3G5Q A;  3P9U A;  3DME A;  1ZKQ A;  2WES A;  4Y4M A;  2B7R A;  1GOS A;  3GD3 A;  4H4P A;  1GTE A;  3CND A;  3Q9T A;  3QSE A;  1CL0 A;  2V61 A;  3KU9 A;  2BCG G;  4AOX A;  3K30 A;  1DNC A;  2X8H A;  3VRB A;  1JEH A;  2RGO A;  4FX9 A;  2B76 A;  4H4Q A;  4NTC A;  1LQT A;  3DH9 A;  3DK8 A;  3NHO X;  4Y4L A;  1HYU A;  1CHU A;  1IUU A;  1GSN A;  1N4V A;  2WET A;  4ZCC A;  3UTE A;  1GAL A;  2WP5 A;  2ARD A;  2C75 A;  3FG2 P;  4L3X A;  1N4U A;  2GMJ A;  2XFP A;  3AEB A;  3BHK A;  4WX1 A;  2R4E A;  5FS6 A;  3T31 A;  3FO3 A;  3AYJ A;  2BC1 A;  5KOW A;  3F29 A;  3T2K A;  2PYX A;  3OC4 A;  4II2 A;  4IVO B;  1PXA A;  3NNE A;  3DA1 A;  1N1P A;  3QJ4 A;  5FS9 A;  5FS8 A;  1QLB A;  3AE1 A;  3KKJ A;  3SXQ A;  1KDG A;  4Q1O A;  5J60 A;  3RP8 A;  2EQ7 A;  5BUK A;  2GR3 A;  4ECH A;  3S61 A;  4APN A;  4NEV A;  2C3D A;  1LJ1 A;  3VQR A;  2BAC A;  3UKK A;  3FPZ A;  4G74 A;  5ER0 A;  4LU6 A;  1OJC A;  2Z5X A;  3ATQ A;  2OA1 A;  4UDP A;  1GXF A;  4EIQ A;  1JNZ A;  3ISH A;  1LTX R;  3AB1 A;  2EQ9 A;  4BK3 A;  4AP1 A;  1FS7 A;  5KRQ A;  5KVH A;  5HY5 A;  3CGD A;  3M0O A;  2FJB A;  3GYI A;  1ZMC A;  1DOB A;  4BK2 A;  2WHD A;  3UKH A;  4Z43 A;  3V3O A;  4CY8 A;  1PXC A;  2BK3 A;  3AD8 B;  3F8P A;  4H2N A;  5KVI A;  3SZC A;  1RP0 A;  1KSU A;  1PS9 A;  3GRS A;  3H4K A;  4CNJ A;  5KOX A;  2JAE A;  2VVM A;  1D7L A;  1CJ2 A;  5EB5 A;  4P9S A;  4J57 A;  1M1P A;  2H89 A;  3AEA A;  3KPF A;  3SFD A;  2I0Z A;  4RSL A;  1EL5 A;  1OJ9 A;  3LAD A;  4EM4 A;  4CRT A;  4U8J A;  3M12 A;  3BI2 A;  4XWZ A;  4K7Z A;  1PBE A;  2E5V A;  4H4U A;  4BV6 A;  3RED A;  3AEE A;  2YVG A;  4B67 A;  4Z26 A;  4AT2 A;  2JBV A;  1H7X A;  3SFE A;  1OJD A;  1GRF A;  4GRT A;  1EL7 A;  1JRY A;  3GWF A;  1FS8 A;  1NEK A;  2C7G A;  2AR8 A;  1JNI A;  3D1I A;  3PVC A;  4A7A A;  3G5R A;  3GYX A;  3S5W A;  5KMS A;  1CF3 A;  1E1K A;  1CC6 A;  2XVE A;  1E1M A;  2W0H A;  3CGE A;  3SQP A;  1DXL A;  1Y0P A;  3UBR A;  2XLT A;  3AED A;  2X8C A;  4OCG A;  2GEW A;  3DK4 A;  3DK9 A;  3GDN A;  2WBA A;  3KLJ A;  5L46 A;  3SYI A;  3P4S A;  1GRA A;  1MOK A;  1ELI A;  1IUX A;  3BNF A;  2C66 A;  2X99 A;  5HHF A;  5M0Z A;  2UZZ A;  1DJN A;  4WJY A;  4EMW A;  3WE0 A;  3OZ2 A;  2BK4 A;  5C2T A;  1H84 A;  2RAB A;  2BC0 A;  4C74 A;  2Z5Y A;  4JY3 A;  2C65 A;  1JOA A;  3EAN A;  1IUT A;  4EQW A;  3KD9 A;  4X4J A;  4J33 A;  4U8I A;  1PJ7 A;  1MO9 A;  1GTH A;  3LJP A;  3ZYX A;  1DOC A;  2VQ7 A;  2X8G A;  1QDB A;  2GAH B;  1COY A;  1NDA A;  3BNG A;  3AE4 A;  4XXG A;  3URH A;  1IUV A;  4DSG A;  1X31 B;  2WS3 A;  3B3R A;  4BJZ A;  1H7W A;  2OAL A;  4KPR A;  4K8D A;  2RF7 A;  1H6V A;  2B9Y A;  2Q0K A;  3L1T A;  4U8N A;  3IHG A;  3RKH A;  2BXR A;  1PBB A;  1S2Q A;  2OT4 A;  4TM3 A;  2Y6Q A;  4K5R A;  1ZOV A;  1KSS A;  1W4X A;  2XLS A;  3AWI A;  1ONF A;  2Q7V A;  3DJD A;  5GRT A;  5C3J A;  2YLX A;  4Z24 A;  1XHC A;  3HYX A;  3CNT A;  1NEN A;  2BS2 A;  3AE5 A;  3ICS A;  3IWA A;  4H4R A;  3H8L A;  3DGH A;  1AOG A;  4C5O A;  2J7A A;  3CGB A;  3CPI G;  3BI4 A;  4XWR A;  2QCU A;  4YSZ A;  1Y56 A;  2OLO A;  1H81 A;  1O95 A;  3COX A;  3M13 A;  1EBD A;  4H2P A;  1TDO A;  4D04 A;  2C4C A;  2IVE A;  3DJE A;  4Q5C A;  4RG3 A;  2GR2 A;  4TM0 A;  3H8I A;  4U2T A;  3NN6 X;  4H4T A;  1JU2 A;  3DGZ A;  3P4Q A;  4PAA A;  1TDF A;  2OLN A;  4FDC B;  2GAG B;  3RHA A;  1O5W A;  3T14 A;  4L3Y A;  4B69 A;  3UKP A;  3UTH A;  3BHF A;  2QA1 A;  2E4G A;  2YVF A;  4USQ A;  4TM4 A;  2RGH A;  1GES A;  4H4S A;  4U8K A;  1FOH A;  4YSH A;  4G73 A;  1RYI A;  3C4A A;  4LII A;  1GV4 A;  3NTD A;  1F8S A;  3NYF A;  2EQ8 A;  3QFA A;  2JB1 A;  4DSH A;  4Y4N A;  1SEZ A;  4Z2U A;  1VQW A;  2GH5 A;  3NYE A;  1F8W A;  4HA6 A;  3UCL A;  2Q6U A;  3CMM A;  1PBD A;  4IA6 A;  3PO7 A;  1DOD A;  3CNJ A;  4GAV A;  3LZW A;  1DOE A;  1S2Y A;  4JNQ A;  1PBF A;  2V3A A;  4X9N A;  4NZH A;  4YT0 A;  3GYJ A;  2XCG A;  2WU5 A;  1BVB A;  3NKS A;  4ADW A;  2NPX A;  5FS7 A;  1K0L A;  2XFU A;  1D7Y A;  2V5Z A;  4B64 A;  2VR0 A;  2WOI A;  1D4E A;  1K0I A;  2GQW A;  2C73 A;  3ATR A;  3AD9 B;  3QSS A;  2RDZ A;  3EAO A;  2E1M A;  1P2E A;  3ALM A;  1L0V A;  4AT0 A;  4EM3 A;  3NYC A;  3GMB A;  1VDC A;  1NHS A;  3UTF A;  2BYB A;  2WPC A;  2R0P A;  2C72 A;  2TMD A;  2WU2 A;  4JDR A;  2B7S A;  2WQY A;  4OPI A;  5J7X A;  3K7M X;  4U2S A;  3GM6 A;  4CCQ A;  3DJJ A;  4YSY A;  4NTE A;  4H50 A;  3I3L A;  2BS4 A;  4J34 A;  1VG9 A;  1YQ3 A;  4U2L A;  4BUR A;  3KVE A;  4TLX A;  2LFC A;  1P2H A;  3QFB A;  1KFY A;  1N4W A;  3BNJ A;  4L3Z A;  3FMW A;  4J36 A;  2YWL A;  1XAN A;  2GV8 A;  4U8O A;  1B4V A;  3CTY A;  3LXD A;  2YR6 A;  4JN9 A;  2AQJ A;  2ZZC A;  1CC4 A;  2B9X A;  5LV9 A;  2BCP A;  1LVL A;  2XDO A;  4AP3 A;  2JKC A;  2VVL G;  1CJC A;  1XDI A;  3AE3 A;  1MXT A;  2YM1 A;  1GND A;  5CQF A;  3V3N A;  3ALJ A;  2XVJ A;  4EQX A;  3NG7 X;  1ZOY A;  1M6I A;  3IHM A;  3SX6 A;  4O5Q A;  4Z2R A;  3S7W A;  2FJD A;  4H2Q A;  3IC9 A;  3V76 A;  2WPF A;  2HQM A;  1OJA A;  1K4Q A;  2A8X A;  2C76 A;  2Q0L A;  3EPT A;  3GDP A;  3NK0 X;  4A65 A;  1GT8 A;  1F8R A;  3GMC A;  1E7P A;  3D1C A;  2QA2 A;  3VR8 A;  1VG0 A;  3G5S A;  4GCM A;  3AD7 B;  4U8M A;  1FT5 A;  1M64 A;  2E80 A;  2GRT A;  2YG4 A;  1GRE A;  3NH3 X;  4H7U A;  1NAA A;  3LGQ A;  3AXB A;  3CNP A;  1NHR A;  3PS9 A;  1YKJ A;  1Q9I A;  1NG4 A;  1ZDL A;  2WOW A;  2XVH A;  2C70 A;  3FBS A;  3NGC X;  5DBJ A;  2K3V A;  2R45 A;  3ZDN A;  5KWF A;  3CGC A;  4RG4 A;  3R9U A;  1BGN A;  3VRD B;  5JCK A;  3SZ0 A;  3GSI A;  1EL8 A;  4A6N A;  4J31 A;  2ZBW A;  5EB4 A;  3T2Z A;  4B68 A;  4Q5B A;  3UKQ A;  3UU9 A;  1KF6 A;  3NTA A;  4H4Z A;  3UOY A;  1IUW A;  2WEU A;  3CN8 A;  2YAU A;  4EMJ A;  3P1W A;  4J56 A;  3HYW A;  2XLR A;  3RP6 A;  4Z2T A;  4OPU A;  2V3B A;  3ITJ A;  2V60 A;  4K2X A;  3LOV A;  3MMO A;  3AYI A;  4ICY A;  1FL2 A;  2V6O A;  2ACZ A;  3ABV A;  4A79 A;  5HYM A;  2GVC A;  1K0J A;  3ALL A;  3I6D A;  1Z6L A;  3GD4 A;  4H4Y A;  3NK2 X;  4H4X A;  3UOX A;  1Y56 B;  1PN0 A;  2GB0 A;  4B1B A;  2WDV A;  3CIR A;  3UKA A;  1OJT A;  4MJW A;  4C3X A;  4TLZ A;  2VQB A;  1CC2 A;  4J2W A;  1RSG A;  5IQ1 A;  1JNR A;  2FBW A;  4A99 A;  2O9Z A;  4CNK A;  3O0H A;  5U25 A;  3SY4 A;  2JK6 A;  3L1R A;  3GRT A;  4EMI A;  1QJD A;  4WCT A;  4G9K A;  4Z44 A;  1D4C A;  2CUL A;  2VZ2 A;  1NHQ A;  1KNP A;  2BRY A;  4K5S A;  3UP5 A;  1FEC A;  1OAH A;  1F3P A;  3SGL A;  3BI5 A;  4DNA A;  2IID A;  1PBC A;  3UOZ A;  2FJA A;  3T37 A;  4G6G A;  4YTP A;  1M1Q A;  4IA5 A;  5JCN A;  4EQS A;  4KX6 A;  1D5T A;  4GDE A;  2XFN A;  3BNH A;  2BK5 A;  2YVJ A;  4N9X A;  4ZCD A;  5GSN A;  1CJ4 A;  2VOU A;  2WDR A;  4B66 A;  3UKL A;  3AE7 A;  1JRZ A;  3NRN A;  3P4P A;  4YWO A;  4CBQ A;  1GET A;  3L8K A;  2DKI A;  4OPT A;  4HB9 A;  3ICR A;  2WP9 A;  3KA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...