1Y0PA

Flavocytochrome c3 with mesaconate bound
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrocatalytic Generation of Chiral Fumarate Derivatives by Flavocytochrome c3
rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 194
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2004-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1y0pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1y0pA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1y0pA03
4B68A 3F8DA 2YAUA 3SFDA 1PJ7A 1TDFA 3NN0X 3L8KA 3CGCA 2QA2A 3UU9A 2JAEA 1GRBA 2C3CA 3OC4A 4HB9A 1LQUA 3K7TA 1BZLA 4NTCA 3C4AA 2BYBA 4GCMA 4TLXA 2OAMA 2J3NA 2EQ7A 4Z2TA 4TM4A 4Z2RA 1PBCA 4OPIA 3ALLA 1ELIA 1YY5A 2R46A 4L38A 3GDNA 3H8IA 3NGCX 1ZOVA 3CTYA 4OPTA 1TRBA 2YG3A 5FMHA 1E1KA 4B64A 4UDQA 3VRDB 2IVEA 4FK1A 1FEBA 2XLSA 4NTDA 4O5UA 2R0GA 1H7XA 3UTGA 2GF3A 2AAQA 4X4JA 3SM8A 4I58A 1K4QA 4NEVA 4BJZA 1W4XA 2OA1A 4UDRA 3T37A 3P1WA 2JK6A 3ZYXA 4EQXA 2VRLA 3LJPA 2GR0A 1DXLA 1TYTA 4PABA 2XLTA 3E1TA 4JQ9A 4KX6A 3NK0X 4GUVA 4H2NA 4X9NA 2GEWA 2VR0A 1IJHA 2XVFA 3BNHA 1CC4A 4H4VA 3PVCA 1E7PA 1FECA 2GRTA 2WESA 4B63A 5CQFA 4FDCB 1E6EA 2VRMA 3AEDA 2PYXA 1PXCA 1YQZA 5J7XA 1GT8A 2BS2A 3QVRA 1M1QA 2GR3A 2YLRA 4EMIA 4ZCDA 5U1OA 1DNCA 2EQ6A 1E39A 2X8GA 2ZZCA 3F29A 2QAEA 4H4ZA 4USQA 4AP3A 4YT0A 3AYLA 2XVHA 2C75A 3RP6A 1GALA 1JRYA 2Q6UA 1CBOA 4H4PA 1IUWA 5JCKA 1B8SA 2WHDA 4NEWA 4U8PA 4AT2A 1RYIA 3I6DA 4DNAA 3C4NA 3NTDA 4C3YA 1VDCA 1GTHA 2R4EA 4DGKA 2XVJA 1F8SA 3AD9B 3UOYA 2YLTA 2FJDA 2BABA 3ICRA 3Q9TA 1FS7A 1M64A 2YLXA 3I3LA 2GV8A 4NTEA 4UDPA 2B7SA 3AE9A 1OAHA 2WPCA 3BI2A 1JOAA 1XANA 2R0CA 4IA5A 1KSSA 3NNEA 4YTPA 4U2TA 2BCPA 4A65A 4RG3A 3FG2P 2CVJA 4K5SA 3RHAA 3G5QA 1PN0A 1S3EA 3DH9A 5KVHA 1GOSA 3H4KA 3NT6A 4A99A 5TR3A 2ACZA 3GMCA 3FBSA 3Q6JA 4BURA 1EL7A 1L9CA 1E1MA 3VQRA 3KKJA 2E80A 1EL8A 4OPUA 3UP4A 1NHSA 3AEEA 3P4SA 4RG4A 4A6NB 3WE0A 2C3DA 1KDGA 4JN9A 3NLCA 4Z2UA 3COXA 1ONFA 4B67A 4EM4A 1CL0A 5IPYA 1JNIA 5KOWA 4U8OA 4P9SA 1KF6A 3CNJA 1DJNA 3IHGA 3URHA 3DK4A 1GU6A 2GB0A 1YKJA 2RGHA 4TM3A 3QSEA 3BNJA 2Q7VA 3LXDA 1LPFA 3NYFA 5M0ZA 1DOEA 4H2QA 4J57A 2O9ZA 1SEZA 1PS9A 4H4WA 1GNDA 1REOA 2VVMA 5GRTA 2V5ZA 4CBQA 3QSSA 2FJAA 3V3OA 3UKLA 4K7ZA 1TDKA 1GESA 2ARDA 2BK4A 3KLJA 3UKFA 2B9YA 5JCLA 1K0IA 4OPCA 3BNMA 4U8JA 4YSHA 3NH3X 2R9ZA 4LU6A 1VG9A 2GMHA 1OJAA 2E4GA 1L0VA 3BHFA 1Z6LA 3KA7A 2XYOA 1E1LA 1K0JA 2X3NA 3F8PA 2FJEA 3P9UA 4H4YA 4L3YA 1PJ6A 5BULA 2C67A 3AXBA 4YXDA 2EQ8A 3AYIA 3GM6A 2UZZA 3S5WA 3GYJA 5KXJA 4WJYA 2B9WA 1V59A 1O94A 4FK1C 4EM3A 1B4VA 2VQBA 1F3PA 4Y4LA 2X99A 4TM0A 3K30A 1PXBA 2H89A 2A89A 4L3ZA 2OALA 3GRTA 4Q1OA 4Q0TA 3AYJA 4H7UA 1PBFA 4Z43A 3HZLA 4EQSA 3JSKA 3LZXA 2WPEA 4REKA 1PBDA 2WDRA 4J34A 4JNAA 1B37A 3AEFA 2DKIA 3GWFA 2AR8A 4AP1A 3ALJA 4OCGA 2YLZA 3BI4A 3UOZA 4H50A 1H81A 4A7AA 1ZX9A 1LQTA 4U2LA 2YG5A 1GSNA 1NENA 3GD4A 3UOVA 1D4CA 2XFQA 1FT5A 1FCDA 2WU2A 4B65A 3QJ4A 1EL9A 3UKAA 4AT0A 1N4VA 4EQWA 1NHPA 3ALMA 3UKKA 3OZ2A 2Z5XA 3LG1A 1XHCA 2H88A 2RF7A 3UCLA 3DK8A 2GQWA 3GMBA 5JCMA 1ZOYA 5EB4A 3II4A 2RDZA 3CPJG 4Z24A 4YSZA 2WOWA 4U8NA 2YVGA 2WEUA 3RP7A 3DGZA 4WX1A 3UTFA 2IIDA 3DMEA 3NTAA 2C76A 4BK1A 5DBJA 4CY6A 1HYUA 3V3NA 3NYCA 2EQ9A 5EOWA 1BWCA 4CNJA 2BS4A 2C70A 4ICYA 2F5ZA 2V3BA 1DOCA 1Q1RA 3AEAA 3VR9A 1ZKQA 1PBEA 2ZZ0A 1B5QA 3CN8A 3DK9A 4C5OA 1M6IA 4GR1A 4A9WA 1NEKA 1OJDA 4YKGA 2C64A 3F8RA 3QFBA 1GETA 1BF3A 1JNRA 3CGEA 4KPRA 3BI5A 2C73A 2VZ2A 1NPXA 3QVPA 3IHMA 3AE5A 3LZWA 2GR2A 1Q9IA 3NN6X 1PDHA 4FX9A 4Q5CA 3NHOX 3AD7B 1XDIA 1Y56A 3DGHA 1F8RA 2C65A 2VVLG 4J56A 4AOSA 3GSIA 1LJ1A 1P2HA 5HHFA 3SQPA 5EBKA 1ZMCA 3KVEA 1S2YA 1ZK7A 4CNKA 3GDPA 2Q0LA 3ISHA 1K0LA 1D4EA 3AE1A 3CNSA 3FIMB 3G5RA 3DJGX 5C3JA 4K22A 4USRA 3ITJA 3AE6A 1M1RA 1PBBA 4EQRA 4GDEA 1GEUA 1TDEA 1GREA 2WOIA 2YVJA 5J60A 1NG3A 3AE8A 3RNMA 1RP0A 1DOBA 1GTEA 2OLNA 2ZO5A 2WP9A 3AWIA 1X31B 3M0OA 5GSNA 1XPQA 5C2TA 2C7GA 2XLPA 2X8HA 3EAOA 4U8KA 5FS6A 1O95A 3FMWA 5KVIA 2QA1A 4A79A 1CJ3A 3LB8A 4YKFA 2BK3A 2NPXA 2ZZBA 2YR4A 2YG4A 3VRBA 5U63A 4B66A 3S61A 2XFPA 1FS9A 2GR1A 1BKWA 4TM1A 4ADWA 1PHHA 2GQFA 1LV0A 2R4JA 4JDRA 3B6DA 1H82A 1NAAA 3GYIA 1JRXA 1Y0PA 4U2SA 3IWAA 1YQ3A 1D7YA 2AQJA 3LGQA 2GH5A 2BXRA 4C77A 2YQUA 2GAHB 5JCIA 2WETA 1KSUA 2WP5A 1O5WA 2X50A 4GDPA 4X9MA 2XVEA 3ABVA 4DSGA 4GRTA 1GRAA 5FS9A 4BK3A 2FJBA 2VOUA 1COYA 4XWRA 1TDOA 3OWMA 5JCNA 5KOXA 3CNDA 3AECA 4XXGA 2TPRA 2E81A 4J2WA 3DJDA 3UTEA 2B9XA 1IUTA 2RGJA 3ADAB 3L1RA 4AOXA 2V61A 2WOVA 3D1IA 3GYXA 1CF3A 4H4TA 1NHQA 3AE7A 2YLSA 1IUXA 2WS3A 3QSMA 1GRTA 3ICSA 1AOGA 3PS9A 1QO8A 3NRNA 4OVIA 2WU5A 3ATRA 3BHKA 4Z26A 2A8XA 5LV9A 1N4WA 2BC1A 2BACA 3O0HA 4JY2A 1H6VA 1N1PA 5EB5A 4LIIA 2YM1A 3CGBA 3VRAA 2WQYA 1P2EA 1GRFA 1NG4A 4BV6A 4ZCCA 3MMOA 1QLBA 1CJ4A 1GV4A 3K7QX 1FOHA 3AEGA 2VQ7A 4BJYA 4IA6A 1GRGA 3C96A 4ECHA 4K8DA 2YVFA 4K2XA 3RKHA 4MJWA 3REDA 1SP3A 1GRHA 2BC0A 3GRSA 3AE4A 4YTMA 2B76A 2CDUA 1LVLA 3AB1A 1H86A 4L3XA 3SCEA 4TLZA 1MXTA 1OJTA 1RSGA 3V76A 4YSXA 1D7LA 3UKQA 2CFYA 5ER0A 1L9DA 1MO9A 3P4RA 1FT6A 2K3VA 1Y56B 2APGA 2YWLA 1D5TA 1BVBA 1NHRA 3UKPA 2BA9A 3TORA 4NZHA 1L9EA 4APNA 4B1BA 1TDNA 4XWZA 2VVLA 3H8LA 2C66A 3S7WA 3EANA 1FL2A 1F8WA 4C74A 1LTXR 1CHUA 1JNZA 4H4XA 4YSYA 2BK5A 1DJQA 3AD8B 3UOXA 1H83A 2YR5A 4Q4UA 4PAAA 2WP6A 2XFNA 2J7AA 5FS8A 1IUUA 1H84A 1VQWA 4RSLA 4EMJA 1EL5A 4H2PA 2Y6RA 3GD3A 4OPGA 5BUKA 4D04A 5CKUA 1S3BA 3RP8A 1BGJA 3PO7A 2JBVA 4I59A 4YTNA 4IV9A 2R0PA 3NG7X 1QDBA 4Y4NA 1GPEA 1ZMDA 3CNPA 4EMWA 1H7WA 2ZBWA 2OLOA 1CJ2A 1DODA 3L1TA 2V60A 3CNTA 5HYMA 2X8CA 3K7MX 2WDQA 2B7RA 2GAGB 2BCGG 2RGOA 3M13A 2A87A 3AE3A 4U8LA 3TTBA 4H4UA 2YG6A 2DKHA 4YWOA 3KPFA 4Q17A 1MOKA 1IUVA 1JEHA 3CGDA 3IF9A 4JY3A 1E1NA 2IVDA 4J36A 1OJ9A 2WPFA 5U25A 3BNUA 2GVCA 4CCQA 1BGNA 3R9UA 3D8XA 3UKHA 3ATQA 3M12A 4J31A 4EIQA 4DSHA 2JB3A 2BXSA 3NYEA 2NVKX 3SGLA 5BRTA 1GERA 3DA1A 3NK1X 4H4RA 3CIRA 2JB1A 2GMJA 2OT4A 3DJEA 1F6MA 3IC9A 1UKVG 1VG0A 4OPLA 4M52A 3ZDNA 4UP3A 2HQMA 4O5QA 2RABA 5M10A 3DJJA 3EPTA 2XFUA 4JNQA 2E1MA 5KWFA 1CC6A 2JB2A 2W0HA 3AEBA 2BS3A 1VRQB 1IUSA 2YR6A 4U8MA 3KD9A 3LOVA 4OPDA 1M1PA 1N4UA 2V6OA 1S2QA 3QFAA 3B3RA 3LADA 1JRZA 3GWDA 3SFEA 3CPHG 4IVMB 3UP5A 1CJCA 2I0ZA 4U8IA 3VR8A 2V3AA 1NDAA 2Q0KA 2FBWA 4EIPA 1CC2A 4Y4MA 1Q1WA 2E5VA 2PHHA 2XLUA 2XVIA 2WBAA 2XLRA 5IQ1A 4BK2A 4E0VA 2TMDA 4HA6A 4A6NA 4CY8A 2YG7A 5L46A 4Q5BA 1FS8A 1ZDLA 2YM2A 3KU9A 4Z44A 4N9XA 4Z25A 2LFCA 1D4DA 4A5LA 1ZP0A 3FPZA 3NKSA 1KNPA 2QCUA 1FEAA 1JU2A 5FS7A 3UTHA 1GXFA 5HY5A 5IQ4A 3UBRA 1PXAA 1EBDA 1KNRA 2CULA 4J33A 1QJDA 1PJ5A 2XCGA 4ZN0A 5KRQA 4K5RA 4CRTA 3CPIG 4D03A 3EF6A 2Y6QA 3D1CA 4WCTA 3BNGA 4LA1A 3SXQA 1OJCA 4H4QA 4IVOB 5BVAA 1KFYA 5HXIA 1TYPA 3AE2A 3P4PA 4H4SA 2WDVA 2R45A 3G5SA 3BNFA 3FO3A 2Z5YA 3NK2X 4C3XA 2JKCA 2XFOA 4GF7A 4H2RA 4B69A 2YLWA 2C72A 1ZY8A 3NIXA 3P4QA 3ICTA 2XDOA 4CCRA 1YQ4A
chains in the Genus database with same CATH superfamily
4B68A 3F8DA 2YAUA 3SFDA 1PJ7A 1TDFA 3NN0X 3L8KA 3CGCA 2QA2A 3UU9A 2JAEA 1GRBA 2C3CA 3OC4A 4HB9A 1LQUA 3K7TA 1BZLA 4NTCA 3C4AA 2BYBA 4GCMA 2CZSA 4TLXA 2OAMA 2J3NA 2EQ7A 4GAPA 4Z2TA 4TM4A 4Z2RA 1PBCA 4OPIA 3ALLA 1ELIA 1YY5A 2R46A 4L38A 3GDNA 3H8IA 3NGCX 3T2KA 1ZOVA 3CTYA 4OPTA 1TRBA 2YG3A 5FMHA 1E1KA 4B64A 4UDQA 3VRDB 2IVEA 4FK1A 1FEBA 3SZFA 2XLSA 4NTDA 4O5UA 2R0GA 1H7XA 3UTGA 2GF3A 2AAQA 4X4JA 3SM8A 4I58A 1K4QA 4NEVA 4BJZA 1W4XA 2OA1A 4UDRA 3T37A 3P1WA 2JK6A 3ZYXA 4EQXA 2VRLA 3LJPA 2GR0A 1DXLA 1TYTA 4PABA 2XLTA 3E1TA 3T14A 4JQ9A 4KX6A 2BRAA 3NK0X 4GUVA 4H2NA 4X9NA 2GEWA 2VR0A 1IJHA 3T2YA 2XVFA 3BNHA 1CC4A 4H4VA 3PVCA 1E7PA 1FECA 2GRTA 2WESA 4B63A 5CQFA 4G73A 4FDCB 1E6EA 2VRMA 3AEDA 2PYXA 4II3A 1PXCA 1YQZA 5J7XA 1GT8A 2BS2A 3QVRA 3KPKA 1M1QA 2GR3A 2YLRA 4EMIA 4ZCDA 5U1OA 1DNCA 2EQ6A 1E39A 2X8GA 2ZZCA 3F29A 2QAEA 4H4ZA 4USQA 4AP3A 4YT0A 3AYLA 2XVHA 2C75A 3RP6A 1GALA 1JRYA 2Q6UA 1CBOA 4H4PA 1IUWA 5JCKA 1B8SA 2WHDA 4NEWA 4U8PA 3SZCA 4AT2A 1RYIA 3I6DA 4DNAA 3C4NA 3NTDA 4C3YA 1VDCA 1GTHA 2R4EA 4DGKA 2XVJA 1F8SA 3AD9B 3UOYA 2YLTA 2FJDA 2BABA 3ICRA 3HYVA 3Q9TA 1FS7A 1M64A 2YLXA 3I3LA 2GV8A 4NTEA 4UDPA 2B7SA 3AE9A 1OAHA 2WPCA 3BI2A 3HYWA 1JOAA 1XANA 2R0CA 4IA5A 1KSSA 3NNEA 4YTPA 4U2TA 2BCPA 4A65A 4RG3A 3FG2P 2CVJA 4K5SA 3RHAA 3G5QA 1PN0A 1S3EA 3DH9A 5KVHA 1GOSA 3H4KA 3NT6A 4A99A 5TR3A 2ACZA 3GMCA 3FBSA 3Q6JA 4BURA 1EL7A 1L9CA 1E1MA 3VQRA 3KKJA 2E80A 1EL8A 4OPUA 3UP4A 1NHSA 3AEEA 3P4SA 4RG4A 4A6NB 3WE0A 3T0KA 2C3DA 1KDGA 4JN9A 3NLCA 4Z2UA 3COXA 1ONFA 4B67A 4EM4A 1CL0A 5IPYA 1JNIA 5KOWA 4U8OA 4P9SA 1KF6A 3CNJA 1DJNA 3IHGA 3URHA 3DK4A 1GU6A 2GB0A 1YKJA 2RGHA 4G6GA 4TM3A 3QSEA 3BNJA 2Q7VA 3LXDA 5KMPA 1LPFA 3NYFA 5M0ZA 1DOEA 4H2QA 4J57A 2O9ZA 1SEZA 1PS9A 4H4WA 1GNDA 1REOA 2VVMA 5GRTA 2V5ZA 4CBQA 3QSSA 2FJAA 3V3OA 3UKLA 4K7ZA 1TDKA 1GESA 2ARDA 2BK4A 3KLJA 3UKFA 2B9YA 5JCLA 1K0IA 5KMSA 4OPCA 3BNMA 4U8JA 4YSHA 3NH3X 2R9ZA 4LU6A 1VG9A 2GMHA 1OJAA 2E4GA 1L0VA 3BHFA 1Z6LA 3KA7A 2XYOA 1E1LA 1K0JA 2X3NA 3F8PA 2FJEA 3P9UA 4H4YA 4L3YA 1PJ6A 5BULA 2C67A 3AXBA 4YXDA 2EQ8A 3AYIA 3GM6A 2BRYA 2UZZA 3S5WA 3GYJA 5KXJA 4WJYA 2B9WA 1V59A 1O94A 4FK1C 4EM3A 1B4VA 2VQBA 1F3PA 4Y4LA 2X99A 4TM0A 3K30A 1PXBA 2H89A 2A89A 4L3ZA 2OALA 3GRTA 4Q1OA 4Q0TA 3AYJA 4H7UA 1PBFA 4Z43A 3HZLA 4EQSA 3JSKA 3LZXA 2WPEA 4REKA 1PBDA 2WDRA 4J34A 4JNAA 1B37A 3AEFA 2DKIA 3GWFA 2AR8A 3SY4A 3ALJA 4OCGA 4AP1A 2YLZA 4G74A 3BI4A 3UOZA 4H50A 1H81A 4A7AA 1ZX9A 1LQTA 4U2LA 2YG5A 1GSNA 1NENA 3GD4A 3UOVA 1D4CA 2XFQA 1FT5A 1FCDA 2WU2A 4B65A 3QJ4A 1EL9A 3UKAA 4AT0A 1N4VA 4EQWA 1NHPA 3ALMA 3UKKA 3OZ2A 2Z5XA 3LG1A 1XHCA 2H88A 2RF7A 3UCLA 3DK8A 2GQWA 3GMBA 5JCMA 1ZOYA 5EB4A 3II4A 2RDZA 3CPJG 4Z24A 4YSZA 5KMRA 2WOWA 4U8NA 2YVGA 2WEUA 4G9KA 3RP7A 3DGZA 4WX1A 3UTFA 2IIDA 3DMEA 3NTAA 2C76A 4BK1A 5DBJA 4CY6A 1HYUA 3V3NA 3NYCA 2EQ9A 5EOWA 1BWCA 3SZ0A 2BS4A 4CNJA 2C70A 4ICYA 2F5ZA 2V3BA 1DOCA 1Q1RA 3AEAA 3VR9A 1ZKQA 1PBEA 2ZZ0A 1B5QA 3CN8A 3DK9A 4II2A 4C5OA 1M6IA 4GR1A 4A9WA 1NEKA 1OJDA 4YKGA 2C64A 3F8RA 3QFBA 1GETA 1BF3A 1JNRA 3CGEA 4KPRA 3BI5A 2C73A 2VZ2A 1NPXA 3QVPA 3IHMA 3AE5A 3LZWA 2GR2A 1Q9IA 3NN6X 1PDHA 4FX9A 4Q5CA 3NHOX 3AD7B 1XDIA 1Y56A 3DGHA 1F8RA 2C65A 2VVLG 4J56A 4AOSA 3GSIA 1LJ1A 1P2HA 5HHFA 3SQPA 5EBKA 3SZWA 1ZMCA 3KVEA 1S2YA 1ZK7A 4CNKA 3GDPA 2Q0LA 3ISHA 1K0LA 1D4EA 3AE1A 3CNSA 3FIMB 3G5RA 3DJGX 5C3JA 4K22A 4USRA 3ITJA 3AE6A 1M1RA 1PBBA 4EQRA 4GDEA 1GEUA 1TDEA 1GREA 2WOIA 2YVJA 5J60A 1NG3A 3AE8A 3RNMA 1RP0A 1DOBA 1GTEA 2OLNA 2ZO5A 2WP9A 3AWIA 1X31B 3M0OA 5GSNA 1XPQA 3SYIA 2C7GA 5C2TA 2XLPA 2X8HA 3EAOA 4U8KA 5FS6A 1O95A 3FMWA 5KVIA 2QA1A 4A79A 1CJ3A 3LB8A 4YKFA 2BK3A 2NPXA 2ZZBA 2YR4A 2YG4A 3VRBA 5U63A 4B66A 3S61A 3T2ZA 2XFPA 1FS9A 2GR1A 1BKWA 3HYXA 4TM1A 4ADWA 1PHHA 2GQFA 1LV0A 2R4JA 4JDRA 3B6DA 1H82A 1NAAA 5KMQA 3T31A 3GYIA 1JRXA 1Y0PA 4U2SA 3IWAA 1YQ3A 1D7YA 2AQJA 3LGQA 2GH5A 2BXRA 4C77A 2YQUA 2GAHB 5JCIA 2WETA 1KSUA 2WP5A 1O5WA 2X50A 4GDPA 4X9MA 2XVEA 3ABVA 4DSGA 4GRTA 1GRAA 5FS9A 4BK3A 2FJBA 2VOUA 1COYA 4XWRA 1TDOA 3OWMA 5JCNA 5KOXA 3CNDA 3AECA 4XXGA 2TPRA 2E81A 4J2WA 3DJDA 3UTEA 2B9XA 1IUTA 2RGJA 3ADAB 3L1RA 4AOXA 2V61A 2WOVA 3D1IA 3GYXA 4NWZA 1CF3A 4H4TA 1NHQA 4G6HA 3AE7A 2YLSA 1IUXA 2WS3A 3QSMA 1GRTA 3ICSA 1AOGA 3PS9A 1QO8A 3NRNA 4OVIA 2WU5A 3ATRA 3BHKA 4Z26A 2A8XA 5LV9A 1N4WA 2BC1A 2BACA 3O0HA 4JY2A 1H6VA 1N1PA 5EB5A 4LIIA 2YM1A 3CGBA 3VRAA 2WQYA 1P2EA 2C4CA 1GRFA 1NG4A 4BV6A 4ZCCA 3MMOA 1QLBA 1CJ4A 1GV4A 3K7QX 1FOHA 3AEGA 2VQ7A 4BJYA 4IA6A 1GRGA 3C96A 4ECHA 4K8DA 2YVFA 4K2XA 3RKHA 4MJWA 3REDA 1SP3A 1GRHA 2BC0A 3GRSA 3AE4A 4YTMA 2B76A 2CDUA 1LVLA 3AB1A 1H86A 4L3XA 3SCEA 4TLZA 1MXTA 1OJTA 1RSGA 3V76A 4YSXA 1D7LA 3UKQA 2CFYA 5ER0A 1L9DA 1MO9A 3P4RA 1FT6A 2K3VA 1Y56B 2APGA 2YWLA 1D5TA 1BVBA 1NHRA 3UKPA 2BA9A 3TORA 4NZHA 1L9EA 4APNA 4B1BA 1TDNA 4XWZA 2VVLA 3H8LA 2C66A 3S7WA 3CMMA 3EANA 1FL2A 1F8WA 4C74A 1LTXR 1CHUA 1JNZA 4H4XA 4YSYA 2BK5A 1DJQA 3AD8B 3UOXA 1H83A 2YR5A 4Q4UA 4PAAA 2WP6A 2XFNA 2J7AA 5FS8A 1IUUA 1H84A 1VQWA 4RSLA 4EMJA 1EL5A 4H2PA 2Y6RA 3GD3A 4OPGA 5BUKA 4D04A 5CKUA 1S3BA 3RP8A 1BGJA 3PO7A 2JBVA 4I59A 4YTNA 4IV9A 2R0PA 3NG7X 1QDBA 4Y4NA 1GPEA 1ZMDA 3CNPA 4EMWA 1H7WA 2ZBWA 2OLOA 1CJ2A 1DODA 3L1TA 2V60A 3CNTA 5HYMA 2X8CA 3K7MX 2WDQA 2B7RA 2GAGB 2BCGG 2RGOA 3M13A 2A87A 3AE3A 4U8LA 3TTBA 4H4UA 2YG6A 2DKHA 4YWOA 3KPFA 4Q17A 1MOKA 1IUVA 1JEHA 3CGDA 3IF9A 4JY3A 1E1NA 2IVDA 4J36A 1OJ9A 2WPFA 5U25A 3BNUA 2GVCA 4CCQA 1BGNA 3R9UA 3D8XA 3UKHA 3ATQA 3M12A 4J31A 4EIQA 4DSHA 2JB3A 2BXSA 3NYEA 2NVKX 3SGLA 5BRTA 1GERA 3DA1A 3NK1X 4H4RA 3CIRA 2JB1A 2GMJA 4GAVA 2OT4A 3DJEA 1F6MA 3IC9A 1UKVG 1VG0A 4OPLA 4M52A 3ZDNA 4UP3A 2HQMA 4O5QA 2RABA 5M10A 3DJJA 3EPTA 2XFUA 4JNQA 2E1MA 5KWFA 1CC6A 2JB2A 2W0HA 3AEBA 2BS3A 1VRQB 1IUSA 2YR6A 4U8MA 3KD9A 3LOVA 4OPDA 1M1PA 1N4UA 2V6OA 1S2QA 3QFAA 3B3RA 3LADA 1JRZA 3GWDA 3SFEA 3CPHG 4IVMB 3UP5A 3SX6A 1CJCA 2I0ZA 4U8IA 3VR8A 4NNJA 2V3AA 1NDAA 2Q0KA 2FBWA 4EIPA 1CC2A 4Y4MA 1Q1WA 2E5VA 2PHHA 2XLUA 2XVIA 2WBAA 2XLRA 5IQ1A 4BK2A 4E0VA 2TMDA 4HA6A 4A6NA 3SXIA 4CY8A 2YG7A 5L46A 4Q5BA 1FS8A 1ZDLA 2YM2A 3KU9A 4Z44A 4N9XA 4Z25A 2LFCA 1D4DA 4A5LA 1ZP0A 3FPZA 3NKSA 1KNPA 2QCUA 1FEAA 1JU2A 5FS7A 3UTHA 1GXFA 5HY5A 5IQ4A 3UBRA 1PXAA 1EBDA 1KNRA 2CULA 4J33A 5KNLA 1QJDA 1PJ5A 2XCGA 4ZN0A 5KRQA 4K5RA 4CRTA 3CPIG 4D03A 3EF6A 2Y6QA 3D1CA 4WCTA 3BNGA 4LA1A 3SXQA 1OJCA 4H4QA 4IVOB 5BVAA 1KFYA 5HXIA 1TYPA 3AE2A 3P4PA 4H4SA 2WDVA 2R45A 3G5SA 3BNFA 3FO3A 2Z5YA 3NK2X 4C3XA 2JKCA 2XFOA 4GF7A 4H2RA 4B69A 2YLWA 2C72A 1ZY8A 3NIXA 3P4QA 3ICTA 2XDOA 4CCRA 1YQ4A
chains in the Genus database with same CATH topology
4B68A 3F8DA 2YAUA 3SFDA 1PJ7A 1TDFA 3NN0X 3L8KA 3CGCA 2QA2A 3UU9A 2JAEA 1GRBA 2C3CA 3OC4A 4HB9A 1LQUA 3K7TA 1BZLA 4NTCA 3C4AA 2BYBA 4GCMA 4TLXA 2OAMA 2J3NA 2EQ7A 4GAPA 4Z2TA 4TM4A 4Z2RA 1PBCA 4OPIA 3ALLA 1ELIA 1YY5A 2R46A 4L38A 3GDNA 3H8IA 3NGCX 3T2KA 1ZOVA 3CTYA 4OPTA 1TRBA 2YG3A 5FMHA 1E1KA 4B64A 4UDQA 3VRDB 2IVEA 4FK1A 1FEBA 3SZFA 2XLSA 4NTDA 4O5UA 2R0GA 1H7XA 3UTGA 2GF3A 2AAQA 4X4JA 3SM8A 4I58A 1K4QA 4NEVA 4BJZA 1W4XA 2OA1A 4UDRA 3T37A 3P1WA 2JK6A 3ZYXA 4EQXA 2VRLA 3LJPA 2GR0A 1DXLA 1TYTA 4PABA 2XLTA 3E1TA 3T14A 4JQ9A 4KX6A 2BRAA 3NK0X 4GUVA 4H2NA 4X9NA 2GEWA 2VR0A 1IJHA 3T2YA 2XVFA 3BNHA 1CC4A 4H4VA 3PVCA 1E7PA 1FECA 2GRTA 2WESA 4B63A 5CQFA 4G73A 4FDCB 1E6EA 2VRMA 3AEDA 2PYXA 4II3A 1PXCA 1YQZA 5J7XA 1GT8A 2BS2A 3QVRA 3KPKA 1M1QA 2GR3A 2YLRA 4EMIA 4ZCDA 5U1OA 1DNCA 2EQ6A 1E39A 2X8GA 2ZZCA 3F29A 2QAEA 4H4ZA 4USQA 4AP3A 4YT0A 3AYLA 2XVHA 2C75A 3RP6A 1GALA 1JRYA 2Q6UA 1CBOA 4H4PA 1IUWA 5JCKA 1B8SA 2WHDA 4NEWA 4U8PA 3SZCA 4AT2A 1RYIA 3I6DA 4DNAA 3C4NA 3NTDA 4C3YA 1VDCA 1GTHA 2R4EA 4DGKA 2XVJA 1F8SA 3AD9B 3UOYA 2YLTA 2FJDA 2BABA 3ICRA 3HYVA 3Q9TA 1FS7A 1M64A 2YLXA 3I3LA 2GV8A 4NTEA 4UDPA 2B7SA 3AE9A 1OAHA 2WPCA 3BI2A 3HYWA 1JOAA 1XANA 2R0CA 4IA5A 1KSSA 3NNEA 4YTPA 4U2TA 2BCPA 4A65A 4RG3A 3FG2P 2CVJA 4K5SA 3RHAA 3G5QA 1PN0A 1S3EA 3DH9A 5KVHA 1GOSA 3H4KA 3NT6A 4A99A 5TR3A 2ACZA 3GMCA 3FBSA 3Q6JA 4BURA 1EL7A 1L9CA 1E1MA 3VQRA 3KKJA 2E80A 1EL8A 4OPUA 3UP4A 1NHSA 3AEEA 3P4SA 4RG4A 4A6NB 3WE0A 3T0KA 2C3DA 1KDGA 4JN9A 3NLCA 4Z2UA 3COXA 1ONFA 4B67A 4EM4A 1CL0A 5IPYA 1JNIA 5KOWA 4U8OA 4P9SA 1KF6A 3CNJA 1DJNA 3IHGA 3URHA 3DK4A 1GU6A 2GB0A 1YKJA 2RGHA 4G6GA 4TM3A 3QSEA 3BNJA 2Q7VA 3LXDA 5KMPA 1LPFA 3NYFA 5M0ZA 1DOEA 4H2QA 4J57A 2O9ZA 1SEZA 1PS9A 4H4WA 1GNDA 1REOA 2VVMA 5GRTA 2V5ZA 4CBQA 3QSSA 2FJAA 3V3OA 3UKLA 4K7ZA 1TDKA 1GESA 2ARDA 2BK4A 3KLJA 3UKFA 2B9YA 5JCLA 1K0IA 5KMSA 4OPCA 3BNMA 4U8JA 4YSHA 3NH3X 2R9ZA 4LU6A 1VG9A 2GMHA 1OJAA 2E4GA 1L0VA 3BHFA 1Z6LA 3KA7A 2XYOA 1E1LA 1K0JA 2X3NA 3F8PA 2FJEA 3P9UA 4H4YA 4L3YA 1PJ6A 5BULA 2C67A 3AXBA 4YXDA 2EQ8A 3AYIA 3GM6A 2BRYA 2UZZA 3S5WA 3GYJA 5KXJA 4WJYA 2B9WA 1V59A 1O94A 4FK1C 4EM3A 1B4VA 2VQBA 1F3PA 4Y4LA 2X99A 4TM0A 3K30A 1PXBA 2H89A 2A89A 4L3ZA 2OALA 3GRTA 4Q1OA 4Q0TA 3AYJA 4H7UA 1PBFA 4Z43A 3HZLA 4EQSA 3JSKA 3LZXA 2WPEA 4REKA 1PBDA 2WDRA 4J34A 4JNAA 1B37A 3AEFA 2DKIA 3GWFA 2AR8A 3SY4A 3ALJA 4OCGA 4AP1A 2YLZA 4G74A 3BI4A 3UOZA 4H50A 1H81A 4A7AA 1ZX9A 1LQTA 4U2LA 2YG5A 1GSNA 1NENA 3GD4A 3UOVA 1D4CA 2XFQA 1FT5A 1FCDA 2WU2A 4B65A 3QJ4A 1EL9A 3UKAA 4AT0A 1N4VA 4EQWA 1NHPA 3ALMA 3UKKA 3OZ2A 2Z5XA 3LG1A 1XHCA 2H88A 2RF7A 3UCLA 3DK8A 2GQWA 3GMBA 5JCMA 1ZOYA 5EB4A 3II4A 2RDZA 3CPJG 4Z24A 4YSZA 5KMRA 2WOWA 4U8NA 2YVGA 2WEUA 4G9KA 3RP7A 3DGZA 4WX1A 3UTFA 2IIDA 3DMEA 3NTAA 2C76A 4BK1A 5DBJA 4CY6A 1HYUA 3V3NA 3NYCA 2EQ9A 5EOWA 1BWCA 3SZ0A 2BS4A 4CNJA 2C70A 4ICYA 2F5ZA 2V3BA 1DOCA 1Q1RA 3AEAA 3VR9A 1ZKQA 1PBEA 2ZZ0A 1B5QA 3CN8A 3DK9A 4II2A 4C5OA 1M6IA 4GR1A 4A9WA 1NEKA 1OJDA 4YKGA 2C64A 3F8RA 3QFBA 1GETA 1BF3A 1JNRA 3CGEA 4KPRA 3BI5A 2C73A 2VZ2A 1NPXA 3QVPA 3IHMA 3AE5A 3LZWA 2GR2A 1Q9IA 3NN6X 1PDHA 4FX9A 4Q5CA 3NHOX 3AD7B 1XDIA 1Y56A 3DGHA 1F8RA 2C65A 2VVLG 4J56A 4AOSA 3GSIA 1LJ1A 1P2HA 5HHFA 3SQPA 5EBKA 3SZWA 1ZMCA 3KVEA 1S2YA 1ZK7A 4CNKA 3GDPA 2Q0LA 3ISHA 1K0LA 1D4EA 3AE1A 3CNSA 3FIMB 3G5RA 3DJGX 5C3JA 4K22A 4USRA 3ITJA 3AE6A 1M1RA 1PBBA 4EQRA 4GDEA 1GEUA 1TDEA 1GREA 2WOIA 2YVJA 5J60A 1NG3A 3AE8A 3RNMA 1RP0A 1DOBA 1GTEA 2OLNA 2ZO5A 2WP9A 3AWIA 1X31B 3M0OA 5GSNA 1XPQA 3SYIA 2C7GA 5C2TA 2XLPA 2X8HA 3EAOA 4U8KA 5FS6A 1O95A 3FMWA 5KVIA 2QA1A 4A79A 1CJ3A 3LB8A 4YKFA 2BK3A 2NPXA 2ZZBA 2YR4A 2YG4A 3VRBA 5U63A 4B66A 3S61A 3T2ZA 2XFPA 1FS9A 2GR1A 1BKWA 3HYXA 4TM1A 4ADWA 1PHHA 2GQFA 1LV0A 2R4JA 4JDRA 3B6DA 1H82A 1NAAA 5KMQA 3T31A 3GYIA 1JRXA 1Y0PA 4U2SA 3IWAA 1YQ3A 1D7YA 2AQJA 3LGQA 2GH5A 2BXRA 4C77A 2YQUA 2GAHB 5JCIA 2WETA 1KSUA 2WP5A 1O5WA 2X50A 4GDPA 4X9MA 2XVEA 3ABVA 4DSGA 4GRTA 1GRAA 5FS9A 4BK3A 2FJBA 2VOUA 1COYA 4XWRA 1TDOA 3OWMA 5JCNA 5KOXA 3CNDA 3AECA 4XXGA 2TPRA 2E81A 4J2WA 3DJDA 3UTEA 2B9XA 1IUTA 2RGJA 3ADAB 3L1RA 4AOXA 2V61A 2WOVA 3D1IA 3GYXA 4NWZA 1CF3A 4H4TA 1NHQA 4G6HA 3AE7A 2YLSA 1IUXA 2WS3A 3QSMA 1GRTA 3ICSA 1AOGA 3PS9A 1QO8A 3NRNA 4OVIA 2WU5A 3ATRA 3BHKA 4Z26A 2A8XA 5LV9A 1N4WA 2BC1A 2BACA 3O0HA 4JY2A 1H6VA 1N1PA 5EB5A 4LIIA 2YM1A 3CGBA 3VRAA 2WQYA 1P2EA 2C4CA 1GRFA 1NG4A 4BV6A 4ZCCA 3MMOA 1QLBA 1CJ4A 1GV4A 3K7QX 1FOHA 3AEGA 2VQ7A 4BJYA 4IA6A 1GRGA 3C96A 4ECHA 4K8DA 2YVFA 4K2XA 3RKHA 4MJWA 3REDA 1SP3A 1GRHA 2BC0A 3GRSA 3AE4A 4YTMA 2B76A 2CDUA 1LVLA 3AB1A 1H86A 4L3XA 3SCEA 4TLZA 1MXTA 1OJTA 1RSGA 3V76A 4YSXA 1D7LA 3UKQA 2CFYA 5ER0A 1L9DA 1MO9A 3P4RA 1FT6A 2K3VA 1Y56B 2APGA 2YWLA 1D5TA 1BVBA 1NHRA 3UKPA 2BA9A 3TORA 4NZHA 1L9EA 4APNA 4B1BA 1TDNA 4XWZA 2VVLA 3H8LA 2C66A 3S7WA 3CMMA 3EANA 1FL2A 1F8WA 4C74A 1LTXR 1CHUA 1JNZA 4H4XA 4YSYA 2BK5A 1DJQA 3AD8B 3UOXA 1H83A 2YR5A 4Q4UA 4PAAA 2WP6A 2XFNA 2J7AA 5FS8A 1IUUA 1H84A 1VQWA 4RSLA 4EMJA 1EL5A 4H2PA 2Y6RA 3GD3A 4OPGA 5BUKA 4D04A 5CKUA 1S3BA 3RP8A 1BGJA 3PO7A 2JBVA 4I59A 4YTNA 4IV9A 2R0PA 3NG7X 1QDBA 4Y4NA 1GPEA 1ZMDA 3CNPA 4EMWA 1H7WA 2ZBWA 2OLOA 1CJ2A 1DODA 3L1TA 2V60A 3CNTA 5HYMA 2X8CA 3K7MX 2WDQA 2B7RA 2GAGB 2BCGG 2RGOA 3M13A 2A87A 3AE3A 4U8LA 3TTBA 4H4UA 2YG6A 2DKHA 4YWOA 3KPFA 4Q17A 1MOKA 1IUVA 1JEHA 3CGDA 3IF9A 4JY3A 1E1NA 2IVDA 4J36A 1OJ9A 2WPFA 5U25A 3BNUA 2GVCA 4CCQA 1BGNA 3R9UA 3D8XA 3UKHA 3ATQA 3M12A 4J31A 4EIQA 4DSHA 2JB3A 2BXSA 3NYEA 2NVKX 3SGLA 5BRTA 1GERA 3DA1A 3NK1X 4H4RA 3CIRA 2JB1A 2GMJA 4GAVA 2OT4A 3DJEA 1F6MA 3IC9A 1UKVG 1VG0A 4OPLA 4M52A 3ZDNA 4UP3A 2HQMA 4O5QA 2RABA 5M10A 3DJJA 3EPTA 2XFUA 4JNQA 2E1MA 5KWFA 1CC6A 2JB2A 2W0HA 3AEBA 2BS3A 1VRQB 1IUSA 2YR6A 4U8MA 3KD9A 3LOVA 4OPDA 1M1PA 1N4UA 2V6OA 1S2QA 3QFAA 3B3RA 3LADA 1JRZA 3GWDA 3SFEA 3CPHG 4IVMB 3UP5A 3SX6A 1CJCA 2I0ZA 4U8IA 3VR8A 4NNJA 2V3AA 1NDAA 2Q0KA 2FBWA 4EIPA 1CC2A 4Y4MA 1Q1WA 2E5VA 2PHHA 2XLUA 2XVIA 2WBAA 2XLRA 5IQ1A 4BK2A 4E0VA 2TMDA 4HA6A 4A6NA 3SXIA 4CY8A 2YG7A 5L46A 4Q5BA 1FS8A 1ZDLA 2YM2A 3KU9A 4Z44A 4N9XA 4Z25A 2LFCA 1D4DA 4A5LA 1ZP0A 3FPZA 3NKSA 1KNPA 2QCUA 1FEAA 1JU2A 5FS7A 3UTHA 1GXFA 5HY5A 5IQ4A 3UBRA 1PXAA 1EBDA 1KNRA 2CULA 4J33A 5KNLA 1QJDA 1PJ5A 2XCGA 4ZN0A 5KRQA 4K5RA 4CRTA 3CPIG 4D03A 3EF6A 2Y6QA 3D1CA 4WCTA 3BNGA 4LA1A 3SXQA 1OJCA 4H4QA 4IVOB 5BVAA 1KFYA 5HXIA 1TYPA 3AE2A 3P4PA 4H4SA 2WDVA 2R45A 3G5SA 3BNFA 3FO3A 2Z5YA 3NK2X 4C3XA 2JKCA 2XFOA 4GF7A 4H2RA 4B69A 2YLWA 2C72A 1ZY8A 3NIXA 3P4QA 3ICTA 2XDOA 4CCRA 1YQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B68 A;  3F8D A;  2YAU A;  3SFD A;  1PJ7 A;  1TDF A;  3NN0 X;  3L8K A;  3CGC A;  2QA2 A;  3UU9 A;  2JAE A;  1GRB A;  2C3C A;  3OC4 A;  4HB9 A;  1LQU A;  3K7T A;  1BZL A;  4NTC A;  3C4A A;  2BYB A;  4GCM A;  4TLX A;  2OAM A;  2J3N A;  2EQ7 A;  4Z2T A;  4TM4 A;  4Z2R A;  1PBC A;  4OPI A;  3ALL A;  1ELI A;  1YY5 A;  2R46 A;  4L38 A;  3GDN A;  3H8I A;  3NGC X;  1ZOV A;  3CTY A;  4OPT A;  1TRB A;  2YG3 A;  5FMH A;  1E1K A;  4B64 A;  4UDQ A;  3VRD B;  2IVE A;  4FK1 A;  1FEB A;  2XLS A;  4NTD A;  4O5U A;  2R0G A;  1H7X A;  3UTG A;  2GF3 A;  2AAQ A;  4X4J A;  3SM8 A;  4I58 A;  1K4Q A;  4NEV A;  4BJZ A;  1W4X A;  2OA1 A;  4UDR A;  3T37 A;  3P1W A;  2JK6 A;  3ZYX A;  4EQX A;  2VRL A;  3LJP A;  2GR0 A;  1DXL A;  1TYT A;  4PAB A;  2XLT A;  3E1T A;  4JQ9 A;  4KX6 A;  3NK0 X;  4GUV A;  4H2N A;  4X9N A;  2GEW A;  2VR0 A;  1IJH A;  2XVF A;  3BNH A;  1CC4 A;  4H4V A;  3PVC A;  1E7P A;  1FEC A;  2GRT A;  2WES A;  4B63 A;  5CQF A;  4FDC B;  1E6E A;  2VRM A;  3AED A;  2PYX A;  1PXC A;  1YQZ A;  5J7X A;  1GT8 A;  2BS2 A;  3QVR A;  1M1Q A;  2GR3 A;  2YLR A;  4EMI A;  4ZCD A;  5U1O A;  1DNC A;  2EQ6 A;  1E39 A;  2X8G A;  2ZZC A;  3F29 A;  2QAE A;  4H4Z A;  4USQ A;  4AP3 A;  4YT0 A;  3AYL A;  2XVH A;  2C75 A;  3RP6 A;  1GAL A;  1JRY A;  2Q6U A;  1CBO A;  4H4P A;  1IUW A;  5JCK A;  1B8S A;  2WHD A;  4NEW A;  4U8P A;  4AT2 A;  1RYI A;  3I6D A;  4DNA A;  3C4N A;  3NTD A;  4C3Y A;  1VDC A;  1GTH A;  2R4E A;  4DGK A;  2XVJ A;  1F8S A;  3AD9 B;  3UOY A;  2YLT A;  2FJD A;  2BAB A;  3ICR A;  3Q9T A;  1FS7 A;  1M64 A;  2YLX A;  3I3L A;  2GV8 A;  4NTE A;  4UDP A;  2B7S A;  3AE9 A;  1OAH A;  2WPC A;  3BI2 A;  1JOA A;  1XAN A;  2R0C A;  4IA5 A;  1KSS A;  3NNE A;  4YTP A;  4U2T A;  2BCP A;  4A65 A;  4RG3 A;  3FG2 P;  2CVJ A;  4K5S A;  3RHA A;  3G5Q A;  1PN0 A;  1S3E A;  3DH9 A;  5KVH A;  1GOS A;  3H4K A;  3NT6 A;  4A99 A;  5TR3 A;  2ACZ A;  3GMC A;  3FBS A;  3Q6J A;  4BUR A;  1EL7 A;  1L9C A;  1E1M A;  3VQR A;  3KKJ A;  2E80 A;  1EL8 A;  4OPU A;  3UP4 A;  1NHS A;  3AEE A;  3P4S A;  4RG4 A;  4A6N B;  3WE0 A;  2C3D A;  1KDG A;  4JN9 A;  3NLC A;  4Z2U A;  3COX A;  1ONF A;  4B67 A;  4EM4 A;  1CL0 A;  5IPY A;  1JNI A;  5KOW A;  4U8O A;  4P9S A;  1KF6 A;  3CNJ A;  1DJN A;  3IHG A;  3URH A;  3DK4 A;  1GU6 A;  2GB0 A;  1YKJ A;  2RGH A;  4TM3 A;  3QSE A;  3BNJ A;  2Q7V A;  3LXD A;  1LPF A;  3NYF A;  5M0Z A;  1DOE A;  4H2Q A;  4J57 A;  2O9Z A;  1SEZ A;  1PS9 A;  4H4W A;  1GND A;  1REO A;  2VVM A;  5GRT A;  2V5Z A;  4CBQ A;  3QSS A;  2FJA A;  3V3O A;  3UKL A;  4K7Z A;  1TDK A;  1GES A;  2ARD A;  2BK4 A;  3KLJ A;  3UKF A;  2B9Y A;  5JCL A;  1K0I A;  4OPC A;  3BNM A;  4U8J A;  4YSH A;  3NH3 X;  2R9Z A;  4LU6 A;  1VG9 A;  2GMH A;  1OJA A;  2E4G A;  1L0V A;  3BHF A;  1Z6L A;  3KA7 A;  2XYO A;  1E1L A;  1K0J A;  2X3N A;  3F8P A;  2FJE A;  3P9U A;  4H4Y A;  4L3Y A;  1PJ6 A;  5BUL A;  2C67 A;  3AXB A;  4YXD A;  2EQ8 A;  3AYI A;  3GM6 A;  2UZZ A;  3S5W A;  3GYJ A;  5KXJ A;  4WJY A;  2B9W A;  1V59 A;  1O94 A;  4FK1 C;  4EM3 A;  1B4V A;  2VQB A;  1F3P A;  4Y4L A;  2X99 A;  4TM0 A;  3K30 A;  1PXB A;  2H89 A;  2A89 A;  4L3Z A;  2OAL A;  3GRT A;  4Q1O A;  4Q0T A;  3AYJ A;  4H7U A;  1PBF A;  4Z43 A;  3HZL A;  4EQS A;  3JSK A;  3LZX A;  2WPE A;  4REK A;  1PBD A;  2WDR A;  4J34 A;  4JNA A;  1B37 A;  3AEF A;  2DKI A;  3GWF A;  2AR8 A;  4AP1 A;  3ALJ A;  4OCG A;  2YLZ A;  3BI4 A;  3UOZ A;  4H50 A;  1H81 A;  4A7A A;  1ZX9 A;  1LQT A;  4U2L A;  2YG5 A;  1GSN A;  1NEN A;  3GD4 A;  3UOV A;  1D4C A;  2XFQ A;  1FT5 A;  1FCD A;  2WU2 A;  4B65 A;  3QJ4 A;  1EL9 A;  3UKA A;  4AT0 A;  1N4V A;  4EQW A;  1NHP A;  3ALM A;  3UKK A;  3OZ2 A;  2Z5X A;  3LG1 A;  1XHC A;  2H88 A;  2RF7 A;  3UCL A;  3DK8 A;  2GQW A;  3GMB A;  5JCM A;  1ZOY A;  5EB4 A;  3II4 A;  2RDZ A;  3CPJ G;  4Z24 A;  4YSZ A;  2WOW A;  4U8N A;  2YVG A;  2WEU A;  3RP7 A;  3DGZ A;  4WX1 A;  3UTF A;  2IID A;  3DME A;  3NTA A;  2C76 A;  4BK1 A;  5DBJ A;  4CY6 A;  1HYU A;  3V3N A;  3NYC A;  2EQ9 A;  5EOW A;  1BWC A;  4CNJ A;  2BS4 A;  2C70 A;  4ICY A;  2F5Z A;  2V3B A;  1DOC A;  1Q1R A;  3AEA A;  3VR9 A;  1ZKQ A;  1PBE A;  2ZZ0 A;  1B5Q A;  3CN8 A;  3DK9 A;  4C5O A;  1M6I A;  4GR1 A;  4A9W A;  1NEK A;  1OJD A;  4YKG A;  2C64 A;  3F8R A;  3QFB A;  1GET A;  1BF3 A;  1JNR A;  3CGE A;  4KPR A;  3BI5 A;  2C73 A;  2VZ2 A;  1NPX A;  3QVP A;  3IHM A;  3AE5 A;  3LZW A;  2GR2 A;  1Q9I A;  3NN6 X;  1PDH A;  4FX9 A;  4Q5C A;  3NHO X;  3AD7 B;  1XDI A;  1Y56 A;  3DGH A;  1F8R A;  2C65 A;  2VVL G;  4J56 A;  4AOS A;  3GSI A;  1LJ1 A;  1P2H A;  5HHF A;  3SQP A;  5EBK A;  1ZMC A;  3KVE A;  1S2Y A;  1ZK7 A;  4CNK A;  3GDP A;  2Q0L A;  3ISH A;  1K0L A;  1D4E A;  3AE1 A;  3CNS A;  3FIM B;  3G5R A;  3DJG X;  5C3J A;  4K22 A;  4USR A;  3ITJ A;  3AE6 A;  1M1R A;  1PBB A;  4EQR A;  4GDE A;  1GEU A;  1TDE A;  1GRE A;  2WOI A;  2YVJ A;  5J60 A;  1NG3 A;  3AE8 A;  3RNM A;  1RP0 A;  1DOB A;  1GTE A;  2OLN A;  2ZO5 A;  2WP9 A;  3AWI A;  1X31 B;  3M0O A;  5GSN A;  1XPQ A;  5C2T A;  2C7G A;  2XLP A;  2X8H A;  3EAO A;  4U8K A;  5FS6 A;  1O95 A;  3FMW A;  5KVI A;  2QA1 A;  4A79 A;  1CJ3 A;  3LB8 A;  4YKF A;  2BK3 A;  2NPX A;  2ZZB A;  2YR4 A;  2YG4 A;  3VRB A;  5U63 A;  4B66 A;  3S61 A;  2XFP A;  1FS9 A;  2GR1 A;  1BKW A;  4TM1 A;  4ADW A;  1PHH A;  2GQF A;  1LV0 A;  2R4J A;  4JDR A;  3B6D A;  1H82 A;  1NAA A;  3GYI A;  1JRX A;  1Y0P A;  4U2S A;  3IWA A;  1YQ3 A;  1D7Y A;  2AQJ A;  3LGQ A;  2GH5 A;  2BXR A;  4C77 A;  2YQU A;  2GAH B;  5JCI A;  2WET A;  1KSU A;  2WP5 A;  1O5W A;  2X50 A;  4GDP A;  4X9M A;  2XVE A;  3ABV A;  4DSG A;  4GRT A;  1GRA A;  5FS9 A;  4BK3 A;  2FJB A;  2VOU A;  1COY A;  4XWR A;  1TDO A;  3OWM A;  5JCN A;  5KOX A;  3CND A;  3AEC A;  4XXG A;  2TPR A;  2E81 A;  4J2W A;  3DJD A;  3UTE A;  2B9X A;  1IUT A;  2RGJ A;  3ADA B;  3L1R A;  4AOX A;  2V61 A;  2WOV A;  3D1I A;  3GYX A;  1CF3 A;  4H4T A;  1NHQ A;  3AE7 A;  2YLS A;  1IUX A;  2WS3 A;  3QSM A;  1GRT A;  3ICS A;  1AOG A;  3PS9 A;  1QO8 A;  3NRN A;  4OVI A;  2WU5 A;  3ATR A;  3BHK A;  4Z26 A;  2A8X A;  5LV9 A;  1N4W A;  2BC1 A;  2BAC A;  3O0H A;  4JY2 A;  1H6V A;  1N1P A;  5EB5 A;  4LII A;  2YM1 A;  3CGB A;  3VRA A;  2WQY A;  1P2E A;  1GRF A;  1NG4 A;  4BV6 A;  4ZCC A;  3MMO A;  1QLB A;  1CJ4 A;  1GV4 A;  3K7Q X;  1FOH A;  3AEG A;  2VQ7 A;  4BJY A;  4IA6 A;  1GRG A;  3C96 A;  4ECH A;  4K8D A;  2YVF A;  4K2X A;  3RKH A;  4MJW A;  3RED A;  1SP3 A;  1GRH A;  2BC0 A;  3GRS A;  3AE4 A;  4YTM A;  2B76 A;  2CDU A;  1LVL A;  3AB1 A;  1H86 A;  4L3X A;  3SCE A;  4TLZ A;  1MXT A;  1OJT A;  1RSG A;  3V76 A;  4YSX A;  1D7L A;  3UKQ A;  2CFY A;  5ER0 A;  1L9D A;  1MO9 A;  3P4R A;  1FT6 A;  2K3V A;  1Y56 B;  2APG A;  2YWL A;  1D5T A;  1BVB A;  1NHR A;  3UKP A;  2BA9 A;  3TOR A;  4NZH A;  1L9E A;  4APN A;  4B1B A;  1TDN A;  4XWZ A;  2VVL A;  3H8L A;  2C66 A;  3S7W A;  3EAN A;  1FL2 A;  1F8W A;  4C74 A;  1LTX R;  1CHU A;  1JNZ A;  4H4X A;  4YSY A;  2BK5 A;  1DJQ A;  3AD8 B;  3UOX A;  1H83 A;  2YR5 A;  4Q4U A;  4PAA A;  2WP6 A;  2XFN A;  2J7A A;  5FS8 A;  1IUU A;  1H84 A;  1VQW A;  4RSL A;  4EMJ A;  1EL5 A;  4H2P A;  2Y6R A;  3GD3 A;  4OPG A;  5BUK A;  4D04 A;  5CKU A;  1S3B A;  3RP8 A;  1BGJ A;  3PO7 A;  2JBV A;  4I59 A;  4YTN A;  4IV9 A;  2R0P A;  3NG7 X;  1QDB A;  4Y4N A;  1GPE A;  1ZMD A;  3CNP A;  4EMW A;  1H7W A;  2ZBW A;  2OLO A;  1CJ2 A;  1DOD A;  3L1T A;  2V60 A;  3CNT A;  5HYM A;  2X8C A;  3K7M X;  2WDQ A;  2B7R A;  2GAG B;  2BCG G;  2RGO A;  3M13 A;  2A87 A;  3AE3 A;  4U8L A;  3TTB A;  4H4U A;  2YG6 A;  2DKH A;  4YWO A;  3KPF A;  4Q17 A;  1MOK A;  1IUV A;  1JEH A;  3CGD A;  3IF9 A;  4JY3 A;  1E1N A;  2IVD A;  4J36 A;  1OJ9 A;  2WPF A;  5U25 A;  3BNU A;  2GVC A;  4CCQ A;  1BGN A;  3R9U A;  3D8X A;  3UKH A;  3ATQ A;  3M12 A;  4J31 A;  4EIQ A;  4DSH A;  2JB3 A;  2BXS A;  3NYE A;  2NVK X;  3SGL A;  5BRT A;  1GER A;  3DA1 A;  3NK1 X;  4H4R A;  3CIR A;  2JB1 A;  2GMJ A;  2OT4 A;  3DJE A;  1F6M A;  3IC9 A;  1UKV G;  1VG0 A;  4OPL A;  4M52 A;  3ZDN A;  4UP3 A;  2HQM A;  4O5Q A;  2RAB A;  5M10 A;  3DJJ A;  3EPT A;  2XFU A;  4JNQ A;  2E1M A;  5KWF A;  1CC6 A;  2JB2 A;  2W0H A;  3AEB A;  2BS3 A;  1VRQ B;  1IUS A;  2YR6 A;  4U8M A;  3KD9 A;  3LOV A;  4OPD A;  1M1P A;  1N4U A;  2V6O A;  1S2Q A;  3QFA A;  3B3R A;  3LAD A;  1JRZ A;  3GWD A;  3SFE A;  3CPH G;  4IVM B;  3UP5 A;  1CJC A;  2I0Z A;  4U8I A;  3VR8 A;  2V3A A;  1NDA A;  2Q0K A;  2FBW A;  4EIP A;  1CC2 A;  4Y4M A;  1Q1W A;  2E5V A;  2PHH A;  2XLU A;  2XVI A;  2WBA A;  2XLR A;  5IQ1 A;  4BK2 A;  4E0V A;  2TMD A;  4HA6 A;  4A6N A;  4CY8 A;  2YG7 A;  5L46 A;  4Q5B A;  1FS8 A;  1ZDL A;  2YM2 A;  3KU9 A;  4Z44 A;  4N9X A;  4Z25 A;  2LFC A;  1D4D A;  4A5L A;  1ZP0 A;  3FPZ A;  3NKS A;  1KNP A;  2QCU A;  1FEA A;  1JU2 A;  5FS7 A;  3UTH A;  1GXF A;  5HY5 A;  5IQ4 A;  3UBR A;  1PXA A;  1EBD A;  1KNR A;  2CUL A;  4J33 A;  1QJD A;  1PJ5 A;  2XCG A;  4ZN0 A;  5KRQ A;  4K5R A;  4CRT A;  3CPI G;  4D03 A;  3EF6 A;  2Y6Q A;  3D1C A;  4WCT A;  3BNG A;  4LA1 A;  3SXQ A;  1OJC A;  4H4Q A;  4IVO B;  5BVA A;  1KFY A;  5HXI A;  1TYP A;  3AE2 A;  3P4P A;  4H4S A;  2WDV A;  2R45 A;  3G5S A;  3BNF A;  3FO3 A;  2Z5Y A;  3NK2 X;  4C3X A;  2JKC A;  2XFO A;  4GF7 A;  4H2R A;  4B69 A;  2YLW A;  2C72 A;  1ZY8 A;  3NIX A;  3P4Q A;  3ICT A;  2XDO A;  4CCR A;  1YQ4 A; 
#chains in the Genus database with same CATH topology
 4B68 A;  3F8D A;  2YAU A;  3SFD A;  1PJ7 A;  1TDF A;  3NN0 X;  3L8K A;  3CGC A;  2QA2 A;  3UU9 A;  2JAE A;  1GRB A;  2C3C A;  3OC4 A;  4HB9 A;  1LQU A;  3K7T A;  1BZL A;  4NTC A;  3C4A A;  2BYB A;  4GCM A;  2CZS A;  4TLX A;  2OAM A;  2J3N A;  2EQ7 A;  4GAP A;  4Z2T A;  4TM4 A;  4Z2R A;  1PBC A;  4OPI A;  3ALL A;  1ELI A;  1YY5 A;  2R46 A;  4L38 A;  3GDN A;  3H8I A;  3NGC X;  3T2K A;  1ZOV A;  3CTY A;  4OPT A;  1TRB A;  2YG3 A;  5FMH A;  1E1K A;  4B64 A;  4UDQ A;  3VRD B;  2IVE A;  4FK1 A;  1FEB A;  3SZF A;  2XLS A;  4NTD A;  4O5U A;  2R0G A;  1H7X A;  3UTG A;  2GF3 A;  2AAQ A;  4X4J A;  3SM8 A;  4I58 A;  1K4Q A;  4NEV A;  4BJZ A;  1W4X A;  2OA1 A;  4UDR A;  3T37 A;  3P1W A;  2JK6 A;  3ZYX A;  4EQX A;  2VRL A;  3LJP A;  2GR0 A;  1DXL A;  1TYT A;  4PAB A;  2XLT A;  3E1T A;  3T14 A;  4JQ9 A;  4KX6 A;  2BRA A;  3NK0 X;  4GUV A;  4H2N A;  4X9N A;  2GEW A;  2VR0 A;  1IJH A;  3T2Y A;  2XVF A;  3BNH A;  1CC4 A;  4H4V A;  3PVC A;  1E7P A;  1FEC A;  2GRT A;  2WES A;  4B63 A;  5CQF A;  4G73 A;  4FDC B;  1E6E A;  2VRM A;  3AED A;  2PYX A;  4II3 A;  1PXC A;  1YQZ A;  5J7X A;  1GT8 A;  2BS2 A;  3QVR A;  3KPK A;  1M1Q A;  2GR3 A;  2YLR A;  4EMI A;  4ZCD A;  5U1O A;  1DNC A;  2EQ6 A;  1E39 A;  2X8G A;  2ZZC A;  3F29 A;  2QAE A;  4H4Z A;  4USQ A;  4AP3 A;  4YT0 A;  3AYL A;  2XVH A;  2C75 A;  3RP6 A;  1GAL A;  1JRY A;  2Q6U A;  1CBO A;  4H4P A;  1IUW A;  5JCK A;  1B8S A;  2WHD A;  4NEW A;  4U8P A;  3SZC A;  4AT2 A;  1RYI A;  3I6D A;  4DNA A;  3C4N A;  3NTD A;  4C3Y A;  1VDC A;  1GTH A;  2R4E A;  4DGK A;  2XVJ A;  1F8S A;  3AD9 B;  3UOY A;  2YLT A;  2FJD A;  2BAB A;  3ICR A;  3HYV A;  3Q9T A;  1FS7 A;  1M64 A;  2YLX A;  3I3L A;  2GV8 A;  4NTE A;  4UDP A;  2B7S A;  3AE9 A;  1OAH A;  2WPC A;  3BI2 A;  3HYW A;  1JOA A;  1XAN A;  2R0C A;  4IA5 A;  1KSS A;  3NNE A;  4YTP A;  4U2T A;  2BCP A;  4A65 A;  4RG3 A;  3FG2 P;  2CVJ A;  4K5S A;  3RHA A;  3G5Q A;  1PN0 A;  1S3E A;  3DH9 A;  5KVH A;  1GOS A;  3H4K A;  3NT6 A;  4A99 A;  5TR3 A;  2ACZ A;  3GMC A;  3FBS A;  3Q6J A;  4BUR A;  1EL7 A;  1L9C A;  1E1M A;  3VQR A;  3KKJ A;  2E80 A;  1EL8 A;  4OPU A;  3UP4 A;  1NHS A;  3AEE A;  3P4S A;  4RG4 A;  4A6N B;  3WE0 A;  3T0K A;  2C3D A;  1KDG A;  4JN9 A;  3NLC A;  4Z2U A;  3COX A;  1ONF A;  4B67 A;  4EM4 A;  1CL0 A;  5IPY A;  1JNI A;  5KOW A;  4U8O A;  4P9S A;  1KF6 A;  3CNJ A;  1DJN A;  3IHG A;  3URH A;  3DK4 A;  1GU6 A;  2GB0 A;  1YKJ A;  2RGH A;  4G6G A;  4TM3 A;  3QSE A;  3BNJ A;  2Q7V A;  3LXD A;  5KMP A;  1LPF A;  3NYF A;  5M0Z A;  1DOE A;  4H2Q A;  4J57 A;  2O9Z A;  1SEZ A;  1PS9 A;  4H4W A;  1GND A;  1REO A;  2VVM A;  5GRT A;  2V5Z A;  4CBQ A;  3QSS A;  2FJA A;  3V3O A;  3UKL A;  4K7Z A;  1TDK A;  1GES A;  2ARD A;  2BK4 A;  3KLJ A;  3UKF A;  2B9Y A;  5JCL A;  1K0I A;  5KMS A;  4OPC A;  3BNM A;  4U8J A;  4YSH A;  3NH3 X;  2R9Z A;  4LU6 A;  1VG9 A;  2GMH A;  1OJA A;  2E4G A;  1L0V A;  3BHF A;  1Z6L A;  3KA7 A;  2XYO A;  1E1L A;  1K0J A;  2X3N A;  3F8P A;  2FJE A;  3P9U A;  4H4Y A;  4L3Y A;  1PJ6 A;  5BUL A;  2C67 A;  3AXB A;  4YXD A;  2EQ8 A;  3AYI A;  3GM6 A;  2BRY A;  2UZZ A;  3S5W A;  3GYJ A;  5KXJ A;  4WJY A;  2B9W A;  1V59 A;  1O94 A;  4FK1 C;  4EM3 A;  1B4V A;  2VQB A;  1F3P A;  4Y4L A;  2X99 A;  4TM0 A;  3K30 A;  1PXB A;  2H89 A;  2A89 A;  4L3Z A;  2OAL A;  3GRT A;  4Q1O A;  4Q0T A;  3AYJ A;  4H7U A;  1PBF A;  4Z43 A;  3HZL A;  4EQS A;  3JSK A;  3LZX A;  2WPE A;  4REK A;  1PBD A;  2WDR A;  4J34 A;  4JNA A;  1B37 A;  3AEF A;  2DKI A;  3GWF A;  2AR8 A;  3SY4 A;  3ALJ A;  4OCG A;  4AP1 A;  2YLZ A;  4G74 A;  3BI4 A;  3UOZ A;  4H50 A;  1H81 A;  4A7A A;  1ZX9 A;  1LQT A;  4U2L A;  2YG5 A;  1GSN A;  1NEN A;  3GD4 A;  3UOV A;  1D4C A;  2XFQ A;  1FT5 A;  1FCD A;  2WU2 A;  4B65 A;  3QJ4 A;  1EL9 A;  3UKA A;  4AT0 A;  1N4V A;  4EQW A;  1NHP A;  3ALM A;  3UKK A;  3OZ2 A;  2Z5X A;  3LG1 A;  1XHC A;  2H88 A;  2RF7 A;  3UCL A;  3DK8 A;  2GQW A;  3GMB A;  5JCM A;  1ZOY A;  5EB4 A;  3II4 A;  2RDZ A;  3CPJ G;  4Z24 A;  4YSZ A;  5KMR A;  2WOW A;  4U8N A;  2YVG A;  2WEU A;  4G9K A;  3RP7 A;  3DGZ A;  4WX1 A;  3UTF A;  2IID A;  3DME A;  3NTA A;  2C76 A;  4BK1 A;  5DBJ A;  4CY6 A;  1HYU A;  3V3N A;  3NYC A;  2EQ9 A;  5EOW A;  1BWC A;  3SZ0 A;  2BS4 A;  4CNJ A;  2C70 A;  4ICY A;  2F5Z A;  2V3B A;  1DOC A;  1Q1R A;  3AEA A;  3VR9 A;  1ZKQ A;  1PBE A;  2ZZ0 A;  1B5Q A;  3CN8 A;  3DK9 A;  4II2 A;  4C5O A;  1M6I A;  4GR1 A;  4A9W A;  1NEK A;  1OJD A;  4YKG A;  2C64 A;  3F8R A;  3QFB A;  1GET A;  1BF3 A;  1JNR A;  3CGE A;  4KPR A;  3BI5 A;  2C73 A;  2VZ2 A;  1NPX A;  3QVP A;  3IHM A;  3AE5 A;  3LZW A;  2GR2 A;  1Q9I A;  3NN6 X;  1PDH A;  4FX9 A;  4Q5C A;  3NHO X;  3AD7 B;  1XDI A;  1Y56 A;  3DGH A;  1F8R A;  2C65 A;  2VVL G;  4J56 A;  4AOS A;  3GSI A;  1LJ1 A;  1P2H A;  5HHF A;  3SQP A;  5EBK A;  3SZW A;  1ZMC A;  3KVE A;  1S2Y A;  1ZK7 A;  4CNK A;  3GDP A;  2Q0L A;  3ISH A;  1K0L A;  1D4E A;  3AE1 A;  3CNS A;  3FIM B;  3G5R A;  3DJG X;  5C3J A;  4K22 A;  4USR A;  3ITJ A;  3AE6 A;  1M1R A;  1PBB A;  4EQR A;  4GDE A;  1GEU A;  1TDE A;  1GRE A;  2WOI A;  2YVJ A;  5J60 A;  1NG3 A;  3AE8 A;  3RNM A;  1RP0 A;  1DOB A;  1GTE A;  2OLN A;  2ZO5 A;  2WP9 A;  3AWI A;  1X31 B;  3M0O A;  5GSN A;  1XPQ A;  3SYI A;  2C7G A;  5C2T A;  2XLP A;  2X8H A;  3EAO A;  4U8K A;  5FS6 A;  1O95 A;  3FMW A;  5KVI A;  2QA1 A;  4A79 A;  1CJ3 A;  3LB8 A;  4YKF A;  2BK3 A;  2NPX A;  2ZZB A;  2YR4 A;  2YG4 A;  3VRB A;  5U63 A;  4B66 A;  3S61 A;  3T2Z A;  2XFP A;  1FS9 A;  2GR1 A;  1BKW A;  3HYX A;  4TM1 A;  4ADW A;  1PHH A;  2GQF A;  1LV0 A;  2R4J A;  4JDR A;  3B6D A;  1H82 A;  1NAA A;  5KMQ A;  3T31 A;  3GYI A;  1JRX A;  1Y0P A;  4U2S A;  3IWA A;  1YQ3 A;  1D7Y A;  2AQJ A;  3LGQ A;  2GH5 A;  2BXR A;  4C77 A;  2YQU A;  2GAH B;  5JCI A;  2WET A;  1KSU A;  2WP5 A;  1O5W A;  2X50 A;  4GDP A;  4X9M A;  2XVE A;  3ABV A;  4DSG A;  4GRT A;  1GRA A;  5FS9 A;  4BK3 A;  2FJB A;  2VOU A;  1COY A;  4XWR A;  1TDO A;  3OWM A;  5JCN A;  5KOX A;  3CND A;  3AEC A;  4XXG A;  2TPR A;  2E81 A;  4J2W A;  3DJD A;  3UTE A;  2B9X A;  1IUT A;  2RGJ A;  3ADA B;  3L1R A;  4AOX A;  2V61 A;  2WOV A;  3D1I A;  3GYX A;  4NWZ A;  1CF3 A;  4H4T A;  1NHQ A;  4G6H A;  3AE7 A;  2YLS A;  1IUX A;  2WS3 A;  3QSM A;  1GRT A;  3ICS A;  1AOG A;  3PS9 A;  1QO8 A;  3NRN A;  4OVI A;  2WU5 A;  3ATR A;  3BHK A;  4Z26 A;  2A8X A;  5LV9 A;  1N4W A;  2BC1 A;  2BAC A;  3O0H A;  4JY2 A;  1H6V A;  1N1P A;  5EB5 A;  4LII A;  2YM1 A;  3CGB A;  3VRA A;  2WQY A;  1P2E A;  2C4C A;  1GRF A;  1NG4 A;  4BV6 A;  4ZCC A;  3MMO A;  1QLB A;  1CJ4 A;  1GV4 A;  3K7Q X;  1FOH A;  3AEG A;  2VQ7 A;  4BJY A;  4IA6 A;  1GRG A;  3C96 A;  4ECH A;  4K8D A;  2YVF A;  4K2X A;  3RKH A;  4MJW A;  3RED A;  1SP3 A;  1GRH A;  2BC0 A;  3GRS A;  3AE4 A;  4YTM A;  2B76 A;  2CDU A;  1LVL A;  3AB1 A;  1H86 A;  4L3X A;  3SCE A;  4TLZ A;  1MXT A;  1OJT A;  1RSG A;  3V76 A;  4YSX A;  1D7L A;  3UKQ A;  2CFY A;  5ER0 A;  1L9D A;  1MO9 A;  3P4R A;  1FT6 A;  2K3V A;  1Y56 B;  2APG A;  2YWL A;  1D5T A;  1BVB A;  1NHR A;  3UKP A;  2BA9 A;  3TOR A;  4NZH A;  1L9E A;  4APN A;  4B1B A;  1TDN A;  4XWZ A;  2VVL A;  3H8L A;  2C66 A;  3S7W A;  3CMM A;  3EAN A;  1FL2 A;  1F8W A;  4C74 A;  1LTX R;  1CHU A;  1JNZ A;  4H4X A;  4YSY A;  2BK5 A;  1DJQ A;  3AD8 B;  3UOX A;  1H83 A;  2YR5 A;  4Q4U A;  4PAA A;  2WP6 A;  2XFN A;  2J7A A;  5FS8 A;  1IUU A;  1H84 A;  1VQW A;  4RSL A;  4EMJ A;  1EL5 A;  4H2P A;  2Y6R A;  3GD3 A;  4OPG A;  5BUK A;  4D04 A;  5CKU A;  1S3B A;  3RP8 A;  1BGJ A;  3PO7 A;  2JBV A;  4I59 A;  4YTN A;  4IV9 A;  2R0P A;  3NG7 X;  1QDB A;  4Y4N A;  1GPE A;  1ZMD A;  3CNP A;  4EMW A;  1H7W A;  2ZBW A;  2OLO A;  1CJ2 A;  1DOD A;  3L1T A;  2V60 A;  3CNT A;  5HYM A;  2X8C A;  3K7M X;  2WDQ A;  2B7R A;  2GAG B;  2BCG G;  2RGO A;  3M13 A;  2A87 A;  3AE3 A;  4U8L A;  3TTB A;  4H4U A;  2YG6 A;  2DKH A;  4YWO A;  3KPF A;  4Q17 A;  1MOK A;  1IUV A;  1JEH A;  3CGD A;  3IF9 A;  4JY3 A;  1E1N A;  2IVD A;  4J36 A;  1OJ9 A;  2WPF A;  5U25 A;  3BNU A;  2GVC A;  4CCQ A;  1BGN A;  3R9U A;  3D8X A;  3UKH A;  3ATQ A;  3M12 A;  4J31 A;  4EIQ A;  4DSH A;  2JB3 A;  2BXS A;  3NYE A;  2NVK X;  3SGL A;  5BRT A;  1GER A;  3DA1 A;  3NK1 X;  4H4R A;  3CIR A;  2JB1 A;  2GMJ A;  4GAV A;  2OT4 A;  3DJE A;  1F6M A;  3IC9 A;  1UKV G;  1VG0 A;  4OPL A;  4M52 A;  3ZDN A;  4UP3 A;  2HQM A;  4O5Q A;  2RAB A;  5M10 A;  3DJJ A;  3EPT A;  2XFU A;  4JNQ A;  2E1M A;  5KWF A;  1CC6 A;  2JB2 A;  2W0H A;  3AEB A;  2BS3 A;  1VRQ B;  1IUS A;  2YR6 A;  4U8M A;  3KD9 A;  3LOV A;  4OPD A;  1M1P A;  1N4U A;  2V6O A;  1S2Q A;  3QFA A;  3B3R A;  3LAD A;  1JRZ A;  3GWD A;  3SFE A;  3CPH G;  4IVM B;  3UP5 A;  3SX6 A;  1CJC A;  2I0Z A;  4U8I A;  3VR8 A;  4NNJ A;  2V3A A;  1NDA A;  2Q0K A;  2FBW A;  4EIP A;  1CC2 A;  4Y4M A;  1Q1W A;  2E5V A;  2PHH A;  2XLU A;  2XVI A;  2WBA A;  2XLR A;  5IQ1 A;  4BK2 A;  4E0V A;  2TMD A;  4HA6 A;  4A6N A;  3SXI A;  4CY8 A;  2YG7 A;  5L46 A;  4Q5B A;  1FS8 A;  1ZDL A;  2YM2 A;  3KU9 A;  4Z44 A;  4N9X A;  4Z25 A;  2LFC A;  1D4D A;  4A5L A;  1ZP0 A;  3FPZ A;  3NKS A;  1KNP A;  2QCU A;  1FEA A;  1JU2 A;  5FS7 A;  3UTH A;  1GXF A;  5HY5 A;  5IQ4 A;  3UBR A;  1PXA A;  1EBD A;  1KNR A;  2CUL A;  4J33 A;  5KNL A;  1QJD A;  1PJ5 A;  2XCG A;  4ZN0 A;  5KRQ A;  4K5R A;  4CRT A;  3CPI G;  4D03 A;  3EF6 A;  2Y6Q A;  3D1C A;  4WCT A;  3BNG A;  4LA1 A;  3SXQ A;  1OJC A;  4H4Q A;  4IVO B;  5BVA A;  1KFY A;  5HXI A;  1TYP A;  3AE2 A;  3P4P A;  4H4S A;  2WDV A;  2R45 A;  3G5S A;  3BNF A;  3FO3 A;  2Z5Y A;  3NK2 X;  4C3X A;  2JKC A;  2XFO A;  4GF7 A;  4H2R A;  4B69 A;  2YLW A;  2C72 A;  1ZY8 A;  3NIX A;  3P4Q A;  3ICT A;  2XDO A;  4CCR A;  1YQ4 A; 
#chains in the Genus database with same CATH homology
 4B68 A;  3F8D A;  2YAU A;  3SFD A;  1PJ7 A;  1TDF A;  3NN0 X;  3L8K A;  3CGC A;  2QA2 A;  3UU9 A;  2JAE A;  1GRB A;  2C3C A;  3OC4 A;  4HB9 A;  1LQU A;  3K7T A;  1BZL A;  4NTC A;  3C4A A;  2BYB A;  4GCM A;  4TLX A;  2OAM A;  2J3N A;  2EQ7 A;  4GAP A;  4Z2T A;  4TM4 A;  4Z2R A;  1PBC A;  4OPI A;  3ALL A;  1ELI A;  1YY5 A;  2R46 A;  4L38 A;  3GDN A;  3H8I A;  3NGC X;  3T2K A;  1ZOV A;  3CTY A;  4OPT A;  1TRB A;  2YG3 A;  5FMH A;  1E1K A;  4B64 A;  4UDQ A;  3VRD B;  2IVE A;  4FK1 A;  1FEB A;  3SZF A;  2XLS A;  4NTD A;  4O5U A;  2R0G A;  1H7X A;  3UTG A;  2GF3 A;  2AAQ A;  4X4J A;  3SM8 A;  4I58 A;  1K4Q A;  4NEV A;  4BJZ A;  1W4X A;  2OA1 A;  4UDR A;  3T37 A;  3P1W A;  2JK6 A;  3ZYX A;  4EQX A;  2VRL A;  3LJP A;  2GR0 A;  1DXL A;  1TYT A;  4PAB A;  2XLT A;  3E1T A;  3T14 A;  4JQ9 A;  4KX6 A;  2BRA A;  3NK0 X;  4GUV A;  4H2N A;  4X9N A;  2GEW A;  2VR0 A;  1IJH A;  3T2Y A;  2XVF A;  3BNH A;  1CC4 A;  4H4V A;  3PVC A;  1E7P A;  1FEC A;  2GRT A;  2WES A;  4B63 A;  5CQF A;  4G73 A;  4FDC B;  1E6E A;  2VRM A;  3AED A;  2PYX A;  4II3 A;  1PXC A;  1YQZ A;  5J7X A;  1GT8 A;  2BS2 A;  3QVR A;  3KPK A;  1M1Q A;  2GR3 A;  2YLR A;  4EMI A;  4ZCD A;  5U1O A;  1DNC A;  2EQ6 A;  1E39 A;  2X8G A;  2ZZC A;  3F29 A;  2QAE A;  4H4Z A;  4USQ A;  4AP3 A;  4YT0 A;  3AYL A;  2XVH A;  2C75 A;  3RP6 A;  1GAL A;  1JRY A;  2Q6U A;  1CBO A;  4H4P A;  1IUW A;  5JCK A;  1B8S A;  2WHD A;  4NEW A;  4U8P A;  3SZC A;  4AT2 A;  1RYI A;  3I6D A;  4DNA A;  3C4N A;  3NTD A;  4C3Y A;  1VDC A;  1GTH A;  2R4E A;  4DGK A;  2XVJ A;  1F8S A;  3AD9 B;  3UOY A;  2YLT A;  2FJD A;  2BAB A;  3ICR A;  3HYV A;  3Q9T A;  1FS7 A;  1M64 A;  2YLX A;  3I3L A;  2GV8 A;  4NTE A;  4UDP A;  2B7S A;  3AE9 A;  1OAH A;  2WPC A;  3BI2 A;  3HYW A;  1JOA A;  1XAN A;  2R0C A;  4IA5 A;  1KSS A;  3NNE A;  4YTP A;  4U2T A;  2BCP A;  4A65 A;  4RG3 A;  3FG2 P;  2CVJ A;  4K5S A;  3RHA A;  3G5Q A;  1PN0 A;  1S3E A;  3DH9 A;  5KVH A;  1GOS A;  3H4K A;  3NT6 A;  4A99 A;  5TR3 A;  2ACZ A;  3GMC A;  3FBS A;  3Q6J A;  4BUR A;  1EL7 A;  1L9C A;  1E1M A;  3VQR A;  3KKJ A;  2E80 A;  1EL8 A;  4OPU A;  3UP4 A;  1NHS A;  3AEE A;  3P4S A;  4RG4 A;  4A6N B;  3WE0 A;  3T0K A;  2C3D A;  1KDG A;  4JN9 A;  3NLC A;  4Z2U A;  3COX A;  1ONF A;  4B67 A;  4EM4 A;  1CL0 A;  5IPY A;  1JNI A;  5KOW A;  4U8O A;  4P9S A;  1KF6 A;  3CNJ A;  1DJN A;  3IHG A;  3URH A;  3DK4 A;  1GU6 A;  2GB0 A;  1YKJ A;  2RGH A;  4G6G A;  4TM3 A;  3QSE A;  3BNJ A;  2Q7V A;  3LXD A;  5KMP A;  1LPF A;  3NYF A;  5M0Z A;  1DOE A;  4H2Q A;  4J57 A;  2O9Z A;  1SEZ A;  1PS9 A;  4H4W A;  1GND A;  1REO A;  2VVM A;  5GRT A;  2V5Z A;  4CBQ A;  3QSS A;  2FJA A;  3V3O A;  3UKL A;  4K7Z A;  1TDK A;  1GES A;  2ARD A;  2BK4 A;  3KLJ A;  3UKF A;  2B9Y A;  5JCL A;  1K0I A;  5KMS A;  4OPC A;  3BNM A;  4U8J A;  4YSH A;  3NH3 X;  2R9Z A;  4LU6 A;  1VG9 A;  2GMH A;  1OJA A;  2E4G A;  1L0V A;  3BHF A;  1Z6L A;  3KA7 A;  2XYO A;  1E1L A;  1K0J A;  2X3N A;  3F8P A;  2FJE A;  3P9U A;  4H4Y A;  4L3Y A;  1PJ6 A;  5BUL A;  2C67 A;  3AXB A;  4YXD A;  2EQ8 A;  3AYI A;  3GM6 A;  2BRY A;  2UZZ A;  3S5W A;  3GYJ A;  5KXJ A;  4WJY A;  2B9W A;  1V59 A;  1O94 A;  4FK1 C;  4EM3 A;  1B4V A;  2VQB A;  1F3P A;  4Y4L A;  2X99 A;  4TM0 A;  3K30 A;  1PXB A;  2H89 A;  2A89 A;  4L3Z A;  2OAL A;  3GRT A;  4Q1O A;  4Q0T A;  3AYJ A;  4H7U A;  1PBF A;  4Z43 A;  3HZL A;  4EQS A;  3JSK A;  3LZX A;  2WPE A;  4REK A;  1PBD A;  2WDR A;  4J34 A;  4JNA A;  1B37 A;  3AEF A;  2DKI A;  3GWF A;  2AR8 A;  3SY4 A;  3ALJ A;  4OCG A;  4AP1 A;  2YLZ A;  4G74 A;  3BI4 A;  3UOZ A;  4H50 A;  1H81 A;  4A7A A;  1ZX9 A;  1LQT A;  4U2L A;  2YG5 A;  1GSN A;  1NEN A;  3GD4 A;  3UOV A;  1D4C A;  2XFQ A;  1FT5 A;  1FCD A;  2WU2 A;  4B65 A;  3QJ4 A;  1EL9 A;  3UKA A;  4AT0 A;  1N4V A;  4EQW A;  1NHP A;  3ALM A;  3UKK A;  3OZ2 A;  2Z5X A;  3LG1 A;  1XHC A;  2H88 A;  2RF7 A;  3UCL A;  3DK8 A;  2GQW A;  3GMB A;  5JCM A;  1ZOY A;  5EB4 A;  3II4 A;  2RDZ A;  3CPJ G;  4Z24 A;  4YSZ A;  5KMR A;  2WOW A;  4U8N A;  2YVG A;  2WEU A;  4G9K A;  3RP7 A;  3DGZ A;  4WX1 A;  3UTF A;  2IID A;  3DME A;  3NTA A;  2C76 A;  4BK1 A;  5DBJ A;  4CY6 A;  1HYU A;  3V3N A;  3NYC A;  2EQ9 A;  5EOW A;  1BWC A;  3SZ0 A;  2BS4 A;  4CNJ A;  2C70 A;  4ICY A;  2F5Z A;  2V3B A;  1DOC A;  1Q1R A;  3AEA A;  3VR9 A;  1ZKQ A;  1PBE A;  2ZZ0 A;  1B5Q A;  3CN8 A;  3DK9 A;  4II2 A;  4C5O A;  1M6I A;  4GR1 A;  4A9W A;  1NEK A;  1OJD A;  4YKG A;  2C64 A;  3F8R A;  3QFB A;  1GET A;  1BF3 A;  1JNR A;  3CGE A;  4KPR A;  3BI5 A;  2C73 A;  2VZ2 A;  1NPX A;  3QVP A;  3IHM A;  3AE5 A;  3LZW A;  2GR2 A;  1Q9I A;  3NN6 X;  1PDH A;  4FX9 A;  4Q5C A;  3NHO X;  3AD7 B;  1XDI A;  1Y56 A;  3DGH A;  1F8R A;  2C65 A;  2VVL G;  4J56 A;  4AOS A;  3GSI A;  1LJ1 A;  1P2H A;  5HHF A;  3SQP A;  5EBK A;  3SZW A;  1ZMC A;  3KVE A;  1S2Y A;  1ZK7 A;  4CNK A;  3GDP A;  2Q0L A;  3ISH A;  1K0L A;  1D4E A;  3AE1 A;  3CNS A;  3FIM B;  3G5R A;  3DJG X;  5C3J A;  4K22 A;  4USR A;  3ITJ A;  3AE6 A;  1M1R A;  1PBB A;  4EQR A;  4GDE A;  1GEU A;  1TDE A;  1GRE A;  2WOI A;  2YVJ A;  5J60 A;  1NG3 A;  3AE8 A;  3RNM A;  1RP0 A;  1DOB A;  1GTE A;  2OLN A;  2ZO5 A;  2WP9 A;  3AWI A;  1X31 B;  3M0O A;  5GSN A;  1XPQ A;  3SYI A;  2C7G A;  5C2T A;  2XLP A;  2X8H A;  3EAO A;  4U8K A;  5FS6 A;  1O95 A;  3FMW A;  5KVI A;  2QA1 A;  4A79 A;  1CJ3 A;  3LB8 A;  4YKF A;  2BK3 A;  2NPX A;  2ZZB A;  2YR4 A;  2YG4 A;  3VRB A;  5U63 A;  4B66 A;  3S61 A;  3T2Z A;  2XFP A;  1FS9 A;  2GR1 A;  1BKW A;  3HYX A;  4TM1 A;  4ADW A;  1PHH A;  2GQF A;  1LV0 A;  2R4J A;  4JDR A;  3B6D A;  1H82 A;  1NAA A;  5KMQ A;  3T31 A;  3GYI A;  1JRX A;  1Y0P A;  4U2S A;  3IWA A;  1YQ3 A;  1D7Y A;  2AQJ A;  3LGQ A;  2GH5 A;  2BXR A;  4C77 A;  2YQU A;  2GAH B;  5JCI A;  2WET A;  1KSU A;  2WP5 A;  1O5W A;  2X50 A;  4GDP A;  4X9M A;  2XVE A;  3ABV A;  4DSG A;  4GRT A;  1GRA A;  5FS9 A;  4BK3 A;  2FJB A;  2VOU A;  1COY A;  4XWR A;  1TDO A;  3OWM A;  5JCN A;  5KOX A;  3CND A;  3AEC A;  4XXG A;  2TPR A;  2E81 A;  4J2W A;  3DJD A;  3UTE A;  2B9X A;  1IUT A;  2RGJ A;  3ADA B;  3L1R A;  4AOX A;  2V61 A;  2WOV A;  3D1I A;  3GYX A;  4NWZ A;  1CF3 A;  4H4T A;  1NHQ A;  4G6H A;  3AE7 A;  2YLS A;  1IUX A;  2WS3 A;  3QSM A;  1GRT A;  3ICS A;  1AOG A;  3PS9 A;  1QO8 A;  3NRN A;  4OVI A;  2WU5 A;  3ATR A;  3BHK A;  4Z26 A;  2A8X A;  5LV9 A;  1N4W A;  2BC1 A;  2BAC A;  3O0H A;  4JY2 A;  1H6V A;  1N1P A;  5EB5 A;  4LII A;  2YM1 A;  3CGB A;  3VRA A;  2WQY A;  1P2E A;  2C4C A;  1GRF A;  1NG4 A;  4BV6 A;  4ZCC A;  3MMO A;  1QLB A;  1CJ4 A;  1GV4 A;  3K7Q X;  1FOH A;  3AEG A;  2VQ7 A;  4BJY A;  4IA6 A;  1GRG A;  3C96 A;  4ECH A;  4K8D A;  2YVF A;  4K2X A;  3RKH A;  4MJW A;  3RED A;  1SP3 A;  1GRH A;  2BC0 A;  3GRS A;  3AE4 A;  4YTM A;  2B76 A;  2CDU A;  1LVL A;  3AB1 A;  1H86 A;  4L3X A;  3SCE A;  4TLZ A;  1MXT A;  1OJT A;  1RSG A;  3V76 A;  4YSX A;  1D7L A;  3UKQ A;  2CFY A;  5ER0 A;  1L9D A;  1MO9 A;  3P4R A;  1FT6 A;  2K3V A;  1Y56 B;  2APG A;  2YWL A;  1D5T A;  1BVB A;  1NHR A;  3UKP A;  2BA9 A;  3TOR A;  4NZH A;  1L9E A;  4APN A;  4B1B A;  1TDN A;  4XWZ A;  2VVL A;  3H8L A;  2C66 A;  3S7W A;  3CMM A;  3EAN A;  1FL2 A;  1F8W A;  4C74 A;  1LTX R;  1CHU A;  1JNZ A;  4H4X A;  4YSY A;  2BK5 A;  1DJQ A;  3AD8 B;  3UOX A;  1H83 A;  2YR5 A;  4Q4U A;  4PAA A;  2WP6 A;  2XFN A;  2J7A A;  5FS8 A;  1IUU A;  1H84 A;  1VQW A;  4RSL A;  4EMJ A;  1EL5 A;  4H2P A;  2Y6R A;  3GD3 A;  4OPG A;  5BUK A;  4D04 A;  5CKU A;  1S3B A;  3RP8 A;  1BGJ A;  3PO7 A;  2JBV A;  4I59 A;  4YTN A;  4IV9 A;  2R0P A;  3NG7 X;  1QDB A;  4Y4N A;  1GPE A;  1ZMD A;  3CNP A;  4EMW A;  1H7W A;  2ZBW A;  2OLO A;  1CJ2 A;  1DOD A;  3L1T A;  2V60 A;  3CNT A;  5HYM A;  2X8C A;  3K7M X;  2WDQ A;  2B7R A;  2GAG B;  2BCG G;  2RGO A;  3M13 A;  2A87 A;  3AE3 A;  4U8L A;  3TTB A;  4H4U A;  2YG6 A;  2DKH A;  4YWO A;  3KPF A;  4Q17 A;  1MOK A;  1IUV A;  1JEH A;  3CGD A;  3IF9 A;  4JY3 A;  1E1N A;  2IVD A;  4J36 A;  1OJ9 A;  2WPF A;  5U25 A;  3BNU A;  2GVC A;  4CCQ A;  1BGN A;  3R9U A;  3D8X A;  3UKH A;  3ATQ A;  3M12 A;  4J31 A;  4EIQ A;  4DSH A;  2JB3 A;  2BXS A;  3NYE A;  2NVK X;  3SGL A;  5BRT A;  1GER A;  3DA1 A;  3NK1 X;  4H4R A;  3CIR A;  2JB1 A;  2GMJ A;  4GAV A;  2OT4 A;  3DJE A;  1F6M A;  3IC9 A;  1UKV G;  1VG0 A;  4OPL A;  4M52 A;  3ZDN A;  4UP3 A;  2HQM A;  4O5Q A;  2RAB A;  5M10 A;  3DJJ A;  3EPT A;  2XFU A;  4JNQ A;  2E1M A;  5KWF A;  1CC6 A;  2JB2 A;  2W0H A;  3AEB A;  2BS3 A;  1VRQ B;  1IUS A;  2YR6 A;  4U8M A;  3KD9 A;  3LOV A;  4OPD A;  1M1P A;  1N4U A;  2V6O A;  1S2Q A;  3QFA A;  3B3R A;  3LAD A;  1JRZ A;  3GWD A;  3SFE A;  3CPH G;  4IVM B;  3UP5 A;  3SX6 A;  1CJC A;  2I0Z A;  4U8I A;  3VR8 A;  4NNJ A;  2V3A A;  1NDA A;  2Q0K A;  2FBW A;  4EIP A;  1CC2 A;  4Y4M A;  1Q1W A;  2E5V A;  2PHH A;  2XLU A;  2XVI A;  2WBA A;  2XLR A;  5IQ1 A;  4BK2 A;  4E0V A;  2TMD A;  4HA6 A;  4A6N A;  3SXI A;  4CY8 A;  2YG7 A;  5L46 A;  4Q5B A;  1FS8 A;  1ZDL A;  2YM2 A;  3KU9 A;  4Z44 A;  4N9X A;  4Z25 A;  2LFC A;  1D4D A;  4A5L A;  1ZP0 A;  3FPZ A;  3NKS A;  1KNP A;  2QCU A;  1FEA A;  1JU2 A;  5FS7 A;  3UTH A;  1GXF A;  5HY5 A;  5IQ4 A;  3UBR A;  1PXA A;  1EBD A;  1KNR A;  2CUL A;  4J33 A;  5KNL A;  1QJD A;  1PJ5 A;  2XCG A;  4ZN0 A;  5KRQ A;  4K5R A;  4CRT A;  3CPI G;  4D03 A;  3EF6 A;  2Y6Q A;  3D1C A;  4WCT A;  3BNG A;  4LA1 A;  3SXQ A;  1OJC A;  4H4Q A;  4IVO B;  5BVA A;  1KFY A;  5HXI A;  1TYP A;  3AE2 A;  3P4P A;  4H4S A;  2WDV A;  2R45 A;  3G5S A;  3BNF A;  3FO3 A;  2Z5Y A;  3NK2 X;  4C3X A;  2JKC A;  2XFO A;  4GF7 A;  4H2R A;  4B69 A;  2YLW A;  2C72 A;  1ZY8 A;  3NIX A;  3P4Q A;  3ICT A;  2XDO A;  4CCR A;  1YQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...