1E39A

Flavocytochrome c3 from shewanella frigidimarina histidine 365 mutated to alanine
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAAPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of the Active Site Acid/Base Catalyst in a Bacterial Fumarate Reductase: A Kinetic and Crystallographic Study
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
total genus 196
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1e39A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1e39A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1e39A01
3Q9TA 2B7RA 1GESA 1IUXA 4J2WA 3H8LA 4C77A 3DK8A 4CNKA 3BI4A 1NHQA 4H4ZA 4K7ZA 4FDCB 3ICRA 4BK2A 2ZO5A 2YVGA 2EQ9A 3NLCA 4YTPA 3LOVA 3EF6A 2OLNA 3QSEA 1LTXR 1D7YA 1CJ3A 4DGKA 1TDEA 1FS9A 1DJNA 1H83A 1H82A 2BYBA 2VVMA 2R4JA 2APGA 3AE3A 1GRHA 2QCUA 1D4DA 1CC6A 1JU2A 2WS3A 3CTYA 3F8DA 2FBWA 3H4KA 2A89A 4LA1A 3SXQA 2YM2A 4EQWA 2YR4A 3BI5A 3SQPA 1BGJA 4WJYA 2GV8A 4N9XA 5EOWA 4L3ZA 3IC9A 4L3XA 4C5OA 4GF7A 4CCQA 1IUTA 2VQ7A 1K0IA 1PXBA 1KNRA 2VQBA 4J56A 1V59A 1PXAA 2VVLA 3S61A 1NDAA 1N4UA 3NIXA 4CY8A 1S3EA 4Z44A 2E5VA 4GCMA 1P2EA 1VDCA 2C67A 2B76A 2EQ8A 2PHHA 1ZX9A 1LPFA 3QJ4A 5FS9A 1ONFA 2B7SA 1M1QA 3QFAA 2CFYA 4AT2A 1PBBA 2R0GA 2C64A 5C2TA 1GRTA 1ZK7A 2Y6RA 4H4XA 4J57A 4YTMA 2GEWA 2WU5A 1DOEA 3B3RA 1TDOA 3UU9A 2GAHB 1CBOA 1EL5A 3NYEA 5KVIA 4L3YA 1EL9A 4H2QA 2FJBA 3ICTA 3P4SA 2EQ6A 1JNRA 4NZHA 4USQA 4Y4MA 4B66A 3IHGA 3FBSA 3FIMB 4XWZA 2YG7A 3ABVA 4ECHA 3QFBA 3NRNA 3K30A 3VRAA 1PJ6A 4Z2RA 1TYPA 2GRTA 4EMWA 1ZKQA 4TM3A 1Q1WA 2QA1A 5TR3A 4ZN0A 1PBFA 2XCGA 3DA1A 3NGCX 1IUWA 1LV0A 2FJDA 2WP5A 4OPIA 3P4RA 1H6VA 2BK3A 1BZLA 1H7XA 3L1RA 3PS9A 4EQSA 2Q0KA 3CNDA 1LQTA 3BNJA 4GUVA 4TLZA 2OALA 1SEZA 2CDUA 2TMDA 4Y4NA 2BACA 3SM8A 4CBQA 2WDVA 5CQFA 2EQ7A 3GRTA 2OLOA 3C4AA 1KDGA 4U8LA 4E0VA 4EM3A 4U8PA 1GNDA 1FL2A 2GR0A 2IVEA 2RGHA 2WU2A 4D04A 1L9DA 3AEEA 1JNIA 1K4QA 3NYFA 3RP7A 1BF3A 1H84A 1OJAA 3F8RA 1GSNA 4BJZA 3GYIA 2IVDA 1Z6LA 2WOWA 3CNJA 3GYXA 4OPCA 5KVHA 1PJ7A 2C72A 2GB0A 4I58A 1B37A 4U2SA 3GYJA 3P1WA 2J7AA 3GDPA 2ACZA 3DK9A 4B69A 4KX6A 2BS4A 3G5SA 1EL8A 2YG5A 4USRA 1JEHA 2XLTA 2BCPA 2HQMA 3IF9A 1DNCA 2H89A 2X99A 3UTGA 2YG3A 1NG4A 2XFNA 4WX1A 3SCEA 2Y6QA 3CPIG 2XFUA 1NENA 1OAHA 4JNQA 2BC0A 2RF7A 1FS8A 1PXCA 1NHSA 1YQZA 2VRLA 5L46A 1VQWA 2FJAA 4RG3A 3SFEA 2V3AA 2VOUA 4H4TA 2GQFA 1Y56B 4REKA 2V6OA 4U2TA 4C3YA 4H50A 1JRXA 4ICYA 3NT6A 3AYLA 2C76A 2YAUA 4Z24A 4Z25A 4B67A 4NTCA 4BJYA 4GDPA 3V3OA 2XFOA 1MXTA 3EAOA 2AAQA 1D4CA 4RSLA 4TLXA 4B1BA 1D4EA 3UOVA 5KRQA 1CC4A 3NTAA 4AT0A 4KPRA 1OJCA 2QA2A 2QAEA 3FG2P 3M12A 4EIQA 4LIIA 4OPTA 1O95A 2YM1A 4NEVA 1COYA 1XPQA 1NAAA 3GWFA 2YLZA 3P9UA 2VRMA 1OJTA 3BNUA 4A6NB 1FEBA 3FPZA 4BK1A 3NK0X 2YG4A 2YR5A 1QDBA 1TDNA 3AEDA 4J33A 4YT0A 3AE2A 2JK6A 1GRGA 3CNTA 1MOKA 1KF6A 3BNMA 5EB4A 3LGQA 2XDOA 2WETA 1B5QA 4DNAA 5KOXA 4PAAA 2GAGB 3COXA 1GALA 1M6IA 1PS9A 3DJJA 4K5SA 4DSHA 3BI2A 1NG3A 1IJHA 2BABA 3EANA 4MJWA 3V3NA 5BVAA 3GD3A 4BURA 3DGHA 1RYIA 2X50A 3VRDB 1IUSA 5JCNA 3SFDA 3GMCA 4XXGA 3KLJA 2WPEA 4A6NA 3LJPA 2GVCA 4A7AA 4CY6A 1SP3A 2R0PA 3UOYA 1JRZA 4AOSA 4YKFA 4O5QA 2Q7VA 3CPJG 3NTDA 2WP6A 4K8DA 2NVKX 2UZZA 4K2XA 2WQYA 5U63A 2DKIA 3QVRA 3TTBA 2BCGG 4H4WA 4IA6A 2W0HA 4X9MA 3CNSA 4H4VA 1BKWA 3DJDA 2X8GA 3DMEA 5U25A 2XFPA 2WESA 1VRQB 3RP8A 2BC1A 3BNGA 3UKHA 3UBRA 2XVEA 1PJ5A 4TM0A 2OAMA 2YLSA 3GWDA 3AEAA 1OJ9A 2BXRA 4B68A 4X9NA 2XLPA 1NHRA 1QLBA 2K3VA 2WDRA 3AE4A 4B65A 3LXDA 2C3CA 3NYCA 4A9WA 1KSSA 3D8XA 4YSHA 5BRTA 4IVOB 3NG7X 4XWRA 2R45A 3HZLA 3RHAA 1Y0PA 1H81A 5DBJA 1FEAA 3O0HA 1GETA 3ATQA 2O9ZA 3KD9A 4OPDA 1GRAA 2FJEA 2WEUA 1L0VA 3DJEA 4UP3A 1XDIA 1BVBA 5IQ4A 4EQRA 1F3PA 1YKJA 1FT6A 4H2NA 4OPLA 3VR8A 1CC2A 1QO8A 1GERA 5J60A 1XANA 3GD4A 1F8WA 3EPTA 1PN0A 1ZOYA 4JNAA 2BK4A 3ZYXA 1PBEA 1RSGA 2DKHA 3PO7A 4C3XA 2XFQA 1S2YA 3V76A 3UTHA 1EBDA 4Q1OA 4A79A 1B4VA 4NEWA 4A65A 1GT8A 3AE5A 3CGBA 2J3NA 2Z5YA 5JCKA 5GSNA 1PHHA 4Q5BA 1GU6A 1F8SA 2BS2A 3LADA 3UKQA 3UOXA 4H4YA 4YSZA 4Z2UA 3DJGX 2C73A 2GF3A 1HYUA 1E1LA 4H4PA 4IVMB 4NTEA 5HHFA 1GTHA 4K22A 4DSGA 1ZMCA 3CGCA 3UP4A 3P4PA 1FS7A 1F8RA 3D1IA 1GTEA 2XLSA 2ZZ0A 3CN8A 1ZOVA 3M0OA 3FO3A 2E1MA 4WCTA 2C65A 1GRBA 1L9CA 2R0CA 1KFYA 5C3JA 3GM6A 1GV4A 1LVLA 1ZDLA 3IHMA 2B9YA 2WP9A 1KNPA 2CVJA 3DGZA 3RP6A 2WDQA 2X8CA 3KU9A 4EQXA 5JCLA 2YR6A 3LG1A 3CPHG 3PVCA 4EMIA 3UOZA 1AOGA 3NNEA 3D1CA 4AP1A 4BV6A 1YY5A 2NPXA 5J7XA 2C75A 4I59A 2WHDA 1E1MA 2ZZBA 3AE6A 1CJCA 4HB9A 2GR3A 3UKAA 2OA1A 3UTEA 2AR8A 1E39A 3DH9A 1ZMDA 4O5UA 4M52A 3KPFA 3R9UA 1X31B 5BUKA 4IA5A 5HXIA 3AD7B 4UDRA 1JRYA 1H86A 3S7WA 1IUVA 4JY3A 3K7MX 3WE0A 1TRBA 1W4XA 4YSYA 3S5WA 3UKKA 1VG0A 4U8NA 2V3BA 1Q1RA 3NHOX 3ZDNA 2X3NA 2XVFA 3IWAA 4Z2TA 2VVLG 3KVEA 1NEKA 3NK1X 4Y4LA 1PBDA 1DOBA 4H2PA 3URHA 2XVIA 2OT4A 3AWIA 4BK3A 2E80A 4OPUA 4Q4UA 4C74A 5JCMA 5KWFA 2VR0A 2YQUA 3OWMA 2XLUA 2GR2A 3ALMA 4FK1A 4ZCCA 3UKLA 4IV9A 3T37A 5HY5A 5LV9A 3C4NA 1BWCA 4X4JA 2VZ2A 3TORA 5U1OA 3SGLA 4EMJA 4K5RA 4H4UA 1TDFA 4TM1A 3UTFA 4YSXA 1N4VA 2RDZA 3AE8A 1TYTA 3MMOA 3OZ2A 1GOSA 3JSKA 3VQRA 3LZXA 3QVPA 3AYJA 4JDRA 1REOA 1KSUA 3F8PA 1E1KA 3K7QX 1VG9A 2V5ZA 1FT5A 1FCDA 3C96A 2GQWA 4U8JA 1D5TA 1NHPA 2WPFA 3NKSA 4P9SA 3G5RA 2E4GA 2GMHA 5M0ZA 1YQ4A 1UKVG 5HYMA 2C66A 1D7LA 3CGDA 2B9WA 2WPCA 4U8IA 2V61A 5FS7A 1GEUA 3AB1A 3AE9A 4D03A 1DOCA 1FECA 3B6DA 2WOIA 1N4WA 1CJ2A 2XVHA 3M13A 1O5WA 4CCRA 4YXDA 1S2QA 3NN6X 1GPEA 2V60A 3AD9B 4APNA 1P2HA 1DODA 3E1TA 4FK1C 3KKJA 1EL7A 1TDKA 2IIDA 1RP0A 2JB3A 2X8HA 3LB8A 3L1TA 4U2LA 3NN0X 2TPRA 3H8IA 5FMHA 4AP3A 3AYIA 2YLWA 2GH5A 3GDNA 1LQUA 2JKCA 2ZBWA 3ICSA 3KA7A 2RGOA 2R4EA 5KXJA 1L9EA 1JNZA 1Y56A 2XLRA 4L38A 4H4RA 4GDEA 2XVJA 2GR1A 1K0LA 3AEFA 1PDHA 2A8XA 4J34A 1YQ3A 3AE7A 3ALJA 1M64A 1ZP0A 3GRSA 3ALLA 3AD8B 4H4SA 4GRTA 2H88A 3DK4A 3UKFA 3L8KA 2ARDA 3CGEA 3ATRA 2LFCA 3AXBA 2YVFA 3AE1A 3P4QA 1GXFA 2BA9A 2C70A 1E6EA 4GR1A 3Q6JA 5EBKA 5EB5A 3F29A 4JY2A 4ADWA 3QSSA 2PYXA 2YLRA 2Z5XA 4UDPA 4YWOA 4Q0TA 3GMBA 1JOAA 1FOHA 5FS6A 1QJDA 4UDQA 2YLTA 3ISHA 4Q17A 4EIPA 2RABA 4YTNA 2YLXA 2JBVA 2E81A 3BNFA 1GRFA 2C3DA 3AEGA 3CNPA 4B63A 2WBAA 1GREA 3UCLA 3FMWA 2A87A 3UKPA 2BXSA 5IPYA 5BULA 1OJDA 5CKUA 5KOWA 4RG4A 2JB2A 2BS3A 2BK5A 5JCIA 3CIRA 4NTDA 3GSIA 2C7GA 4OVIA 3II4A 4H4QA 3BNHA 3BHKA 4LU6A 1DJQA 3G5QA 2B9XA 1O94A 4Z43A 5FS8A 4TM4A 1CJ4A 1CL0A 3OC4A 4JN9A 4Z26A 1N1PA 1K0JA 3UP5A 3ADAB 4J31A 4U8MA 4A99A 2WOVA 1M1RA 1ELIA 1S3BA 3I3LA 4H7UA 4OPGA 1MO9A 4H2RA 4FX9A 3VR9A 2YG6A 4EM4A 3RKHA 2YWLA 3BHFA 3NH3X 5GRTA 3QSMA 1E1NA 1LJ1A 2JAEA 1Q9IA 2I0ZA 2Q0LA 3ITJA 5IQ1A 4CNJA 2GMJA 1ZY8A 1B8SA 2RGJA 4U8OA 2F5ZA 1NPXA 4OCGA 4CRTA 2AQJA 3REDA 1DXLA 1BGNA 1E7PA 2R46A 2Q6UA 4Q5CA 5ER0A 4PABA 4YKGA 2YVJA 1M1PA 1IUUA 1H7WA 2JB1A 3RNMA 3I6DA 2ZZCA 3AECA 3LZWA 4J36A 4HA6A 3NK2X 4U8KA 1CHUA 2XYOA 4ZCDA 1CF3A 1F6MA 3AEBA 4B64A 3VRBA 5M10A 1PBCA 3K7TA 1XHCA 2CULA 4A5LA 2R9ZA 4AOXA 4JQ9A
chains in the Genus database with same CATH superfamily
3Q9TA 2B7RA 1GESA 1IUXA 3HYWA 4J2WA 3H8LA 4C77A 3DK8A 4CNKA 3BI4A 1NHQA 4H4ZA 4G6HA 4K7ZA 4FDCB 3ICRA 4BK2A 2ZO5A 2YVGA 2EQ9A 3NLCA 4NWZA 4YTPA 3LOVA 3EF6A 2OLNA 3QSEA 1LTXR 1D7YA 1CJ3A 4DGKA 1TDEA 1FS9A 1DJNA 1H83A 1H82A 2BYBA 2VVMA 2R4JA 2APGA 3AE3A 1GRHA 2QCUA 1D4DA 1CC6A 1JU2A 2WS3A 3CTYA 3F8DA 2FBWA 3H4KA 2A89A 4LA1A 3SXQA 2YM2A 4EQWA 2YR4A 3BI5A 3SQPA 1BGJA 4WJYA 2GV8A 4N9XA 5EOWA 4L3ZA 3IC9A 4L3XA 4C5OA 4GF7A 4CCQA 1IUTA 2VQ7A 1K0IA 1PXBA 1KNRA 2VQBA 4J56A 1V59A 1PXAA 2VVLA 3S61A 1NDAA 1N4UA 3NIXA 4CY8A 1S3EA 4Z44A 2E5VA 4GCMA 1P2EA 1VDCA 2C67A 2B76A 2EQ8A 2PHHA 1ZX9A 4II3A 1LPFA 3QJ4A 5FS9A 1ONFA 2B7SA 2BRYA 1M1QA 3QFAA 2CFYA 4AT2A 1PBBA 2R0GA 2C64A 5C2TA 1GRTA 1ZK7A 3T14A 2Y6RA 4H4XA 4J57A 4YTMA 2GEWA 2WU5A 1DOEA 3B3RA 1TDOA 3UU9A 2GAHB 1CBOA 1EL5A 3NYEA 5KVIA 4L3YA 1EL9A 4H2QA 2FJBA 3ICTA 3P4SA 2EQ6A 1JNRA 4NZHA 2BRAA 4USQA 4Y4MA 4B66A 3IHGA 3FBSA 3FIMB 4XWZA 2YG7A 3ABVA 4ECHA 3QFBA 3NRNA 3K30A 3VRAA 1PJ6A 4Z2RA 1TYPA 2GRTA 4EMWA 1ZKQA 4TM3A 1Q1WA 2QA1A 5TR3A 4ZN0A 1PBFA 2XCGA 3DA1A 3NGCX 1IUWA 1LV0A 2FJDA 2WP5A 4OPIA 3P4RA 1H6VA 2BK3A 1BZLA 1H7XA 3L1RA 3PS9A 4EQSA 2Q0KA 3CNDA 1LQTA 3BNJA 4GUVA 4TLZA 2OALA 1SEZA 2CDUA 2TMDA 4Y4NA 2BACA 3SM8A 4CBQA 2WDVA 5CQFA 2EQ7A 4NNJA 3GRTA 2OLOA 3C4AA 1KDGA 4U8LA 3SZCA 4E0VA 4U8PA 1GNDA 4EM3A 1FL2A 2GR0A 2IVEA 2RGHA 2WU2A 4D04A 1L9DA 3AEEA 1JNIA 1K4QA 3NYFA 3RP7A 1BF3A 1H84A 1OJAA 3F8RA 1GSNA 4BJZA 3GYIA 2IVDA 1Z6LA 2WOWA 3CNJA 3SY4A 3GYXA 4OPCA 5KVHA 1PJ7A 2C72A 2GB0A 4I58A 1B37A 4U2SA 3GYJA 3P1WA 2J7AA 3GDPA 2ACZA 3DK9A 4B69A 4KX6A 2BS4A 3G5SA 1EL8A 2YG5A 4USRA 1JEHA 2XLTA 2BCPA 3SYIA 2HQMA 3IF9A 1DNCA 2H89A 2X99A 3UTGA 2YG3A 1NG4A 2XFNA 4G9KA 3SCEA 2Y6QA 3CPIG 2XFUA 1NENA 4GAPA 4WX1A 1OAHA 4JNQA 2BC0A 2RF7A 1FS8A 1PXCA 1NHSA 1YQZA 2VRLA 5L46A 1VQWA 2FJAA 4RG3A 3SFEA 2V3AA 2VOUA 4H4TA 2GQFA 1Y56B 2C4CA 2V6OA 4REKA 4U2TA 4C3YA 4H50A 1JRXA 4ICYA 3NT6A 3AYLA 2C76A 2YAUA 4Z24A 4Z25A 4B67A 4NTCA 4BJYA 4GDPA 3V3OA 2XFOA 1MXTA 3EAOA 2AAQA 1D4CA 4RSLA 4TLXA 4B1BA 1D4EA 3UOVA 5KRQA 1CC4A 3NTAA 4AT0A 4KPRA 1OJCA 2QA2A 2QAEA 3FG2P 3M12A 4EIQA 4LIIA 4OPTA 1O95A 2YM1A 4NEVA 1COYA 1XPQA 1NAAA 3GWFA 2YLZA 3P9UA 2VRMA 1OJTA 3BNUA 4A6NB 3HYXA 1FEBA 3FPZA 4BK1A 3NK0X 2YG4A 2YR5A 1QDBA 1TDNA 3AEDA 4J33A 4YT0A 3AE2A 2JK6A 1GRGA 3CNTA 1MOKA 1KF6A 3BNMA 5EB4A 3LGQA 2XDOA 2WETA 5KMRA 1B5QA 4DNAA 5KOXA 4PAAA 2GAGB 3COXA 1GALA 1M6IA 1PS9A 3DJJA 4K5SA 4DSHA 3BI2A 1NG3A 1IJHA 2BABA 3EANA 4MJWA 3T0KA 3V3NA 3GD3A 4BURA 5BVAA 3DGHA 5KNLA 1RYIA 2X50A 3VRDB 1IUSA 5JCNA 3SFDA 3GMCA 4XXGA 3KLJA 2WPEA 4A6NA 3LJPA 2GVCA 4A7AA 4CY6A 1SP3A 2R0PA 3UOYA 1JRZA 4AOSA 4YKFA 4O5QA 3T2ZA 2Q7VA 3CPJG 3NTDA 2WP6A 4K8DA 2NVKX 2UZZA 4K2XA 2WQYA 5U63A 2DKIA 3QVRA 3TTBA 2BCGG 4H4WA 4IA6A 2W0HA 4X9MA 3CNSA 4H4VA 1BKWA 3DJDA 2X8GA 3DMEA 5U25A 2XFPA 2WESA 1VRQB 3RP8A 2BC1A 3BNGA 3UKHA 3UBRA 2XVEA 1PJ5A 4TM0A 2OAMA 2YLSA 3GWDA 3AEAA 1OJ9A 2BXRA 4B68A 4X9NA 2XLPA 1NHRA 1QLBA 2K3VA 2WDRA 3AE4A 4B65A 3LXDA 2C3CA 3NYCA 4A9WA 1KSSA 3D8XA 4YSHA 5BRTA 4IVOB 3NG7X 4XWRA 2R45A 3HZLA 3RHAA 1Y0PA 1H81A 5DBJA 1FEAA 3O0HA 1GETA 3ATQA 2O9ZA 3KD9A 4OPDA 1GRAA 2FJEA 2WEUA 1L0VA 3SZFA 3DJEA 4UP3A 1XDIA 1BVBA 5IQ4A 4EQRA 1F3PA 1YKJA 1FT6A 4H2NA 4OPLA 3VR8A 1CC2A 1QO8A 1GERA 5J60A 1XANA 3GD4A 1F8WA 3EPTA 1PN0A 1ZOYA 4JNAA 2BK4A 3ZYXA 1PBEA 1RSGA 2DKHA 3PO7A 4C3XA 2XFQA 1S2YA 3V76A 3UTHA 1EBDA 4Q1OA 4A79A 1B4VA 4NEWA 4A65A 1GT8A 3AE5A 3CGBA 2J3NA 2Z5YA 5JCKA 5GSNA 1PHHA 4Q5BA 1GU6A 1F8SA 5KMSA 2BS2A 3LADA 3UKQA 3UOXA 4H4YA 4YSZA 4Z2UA 3DJGX 4GAVA 2C73A 2GF3A 1HYUA 1E1LA 4H4PA 4IVMB 4NTEA 5HHFA 1GTHA 4K22A 4DSGA 1ZMCA 3CGCA 3UP4A 3P4PA 3T2KA 1FS7A 1F8RA 3D1IA 1GTEA 2XLSA 2ZZ0A 3CN8A 1ZOVA 3M0OA 3FO3A 2E1MA 4WCTA 2C65A 1GRBA 3SXIA 1L9CA 2R0CA 1KFYA 5C3JA 3GM6A 1GV4A 1LVLA 1ZDLA 3IHMA 2B9YA 2WP9A 3T2YA 1KNPA 2CVJA 3DGZA 3RP6A 2WDQA 2X8CA 3KU9A 4EQXA 5JCLA 2YR6A 3LG1A 3CPHG 3PVCA 4EMIA 3UOZA 1AOGA 3NNEA 3D1CA 4AP1A 4BV6A 1YY5A 2NPXA 5J7XA 2C75A 4I59A 2WHDA 1E1MA 2ZZBA 3AE6A 1CJCA 4HB9A 2GR3A 3UKAA 2OA1A 3UTEA 2AR8A 1E39A 3DH9A 1ZMDA 4O5UA 4M52A 3KPFA 3R9UA 1X31B 5BUKA 4IA5A 5HXIA 3SZ0A 3AD7B 4UDRA 1JRYA 1H86A 3S7WA 1IUVA 4JY3A 3K7MX 3WE0A 1TRBA 1W4XA 4YSYA 3S5WA 3UKKA 1VG0A 4U8NA 2V3BA 1Q1RA 3NHOX 3ZDNA 2X3NA 2XVFA 3IWAA 4Z2TA 2VVLG 3KVEA 1NEKA 3NK1X 4Y4LA 1PBDA 1DOBA 4H2PA 3URHA 2XVIA 2OT4A 3SZWA 3AWIA 4BK3A 2E80A 4OPUA 4Q4UA 4C74A 5JCMA 5KWFA 2VR0A 2YQUA 3OWMA 2XLUA 2GR2A 3ALMA 4FK1A 4ZCCA 3UKLA 4IV9A 3T37A 5HY5A 5LV9A 3C4NA 1BWCA 4X4JA 2VZ2A 3TORA 5U1OA 3SGLA 4EMJA 4K5RA 4H4UA 1TDFA 4TM1A 3UTFA 4YSXA 1N4VA 2RDZA 3AE8A 1TYTA 3MMOA 3OZ2A 1GOSA 3JSKA 3VQRA 3LZXA 3KPKA 3QVPA 3AYJA 4JDRA 1REOA 1KSUA 3F8PA 5KMQA 1E1KA 3K7QX 1VG9A 2V5ZA 4G74A 1FT5A 1FCDA 3C96A 2GQWA 4U8JA 1D5TA 1NHPA 2WPFA 3NKSA 4P9SA 3G5RA 2E4GA 2GMHA 5M0ZA 1YQ4A 1UKVG 5HYMA 2C66A 1D7LA 3CGDA 2B9WA 2WPCA 4U8IA 2V61A 5FS7A 1GEUA 3AB1A 3AE9A 4D03A 1DOCA 1FECA 3B6DA 2WOIA 1N4WA 1CJ2A 2XVHA 3M13A 1O5WA 4CCRA 4YXDA 1S2QA 3NN6X 1GPEA 2V60A 3AD9B 4G73A 4APNA 1P2HA 1DODA 3E1TA 4FK1C 3KKJA 1EL7A 1TDKA 2IIDA 1RP0A 2JB3A 2X8HA 3LB8A 3L1TA 4U2LA 3NN0X 2TPRA 3H8IA 5FMHA 4AP3A 3AYIA 2YLWA 2GH5A 3GDNA 1LQUA 2JKCA 2ZBWA 3ICSA 3KA7A 2RGOA 2R4EA 5KXJA 1L9EA 1JNZA 1Y56A 2XLRA 4L38A 4H4RA 4GDEA 2XVJA 2GR1A 1K0LA 3AEFA 1PDHA 2A8XA 4J34A 1YQ3A 3AE7A 3ALJA 1M64A 1ZP0A 3GRSA 3ALLA 3AD8B 4H4SA 4GRTA 2H88A 3DK4A 3UKFA 3L8KA 2ARDA 3CGEA 3ATRA 2LFCA 3AXBA 2YVFA 3AE1A 3P4QA 1GXFA 2BA9A 2C70A 1E6EA 4GR1A 3Q6JA 5EBKA 5EB5A 3F29A 4JY2A 4ADWA 3QSSA 4G6GA 2PYXA 2YLRA 2Z5XA 4UDPA 4YWOA 4Q0TA 3GMBA 1JOAA 1FOHA 5FS6A 1QJDA 4UDQA 2YLTA 3ISHA 4II2A 4Q17A 4EIPA 2RABA 4YTNA 2YLXA 2JBVA 2E81A 3BNFA 1GRFA 2C3DA 3AEGA 3CNPA 4B63A 2WBAA 1GREA 3UCLA 3FMWA 2A87A 3CMMA 3UKPA 2BXSA 5IPYA 5BULA 1OJDA 5CKUA 5KOWA 4RG4A 2JB2A 2BS3A 2BK5A 5JCIA 3SX6A 3CIRA 4NTDA 3GSIA 2C7GA 4OVIA 3II4A 4H4QA 3BNHA 3BHKA 4LU6A 1DJQA 3G5QA 2B9XA 1O94A 4Z43A 5FS8A 4TM4A 1CJ4A 1CL0A 3OC4A 4JN9A 4Z26A 1N1PA 1K0JA 3UP5A 3ADAB 5KMPA 4J31A 4U8MA 4A99A 2WOVA 1M1RA 1ELIA 1S3BA 3I3LA 4H7UA 4OPGA 1MO9A 4H2RA 4FX9A 3T31A 3VR9A 2YG6A 4EM4A 3RKHA 2YWLA 3BHFA 3NH3X 5GRTA 3QSMA 1E1NA 1LJ1A 2JAEA 1Q9IA 2I0ZA 2Q0LA 3ITJA 5IQ1A 4CNJA 2GMJA 1ZY8A 1B8SA 2RGJA 4U8OA 2F5ZA 1NPXA 4OCGA 4CRTA 2AQJA 3REDA 2CZSA 1DXLA 1BGNA 1E7PA 2R46A 2Q6UA 4Q5CA 5ER0A 4PABA 4YKGA 2YVJA 1M1PA 1IUUA 1H7WA 2JB1A 3RNMA 3I6DA 2ZZCA 3AECA 3LZWA 4J36A 4HA6A 3NK2X 4U8KA 1CHUA 2XYOA 3HYVA 4ZCDA 1CF3A 1F6MA 3AEBA 4B64A 3VRBA 5M10A 1PBCA 3K7TA 1XHCA 2CULA 4A5LA 2R9ZA 4AOXA 4JQ9A
chains in the Genus database with same CATH topology
3Q9TA 2B7RA 1GESA 1IUXA 3HYWA 4J2WA 3H8LA 4C77A 3DK8A 4CNKA 3BI4A 1NHQA 4H4ZA 4G6HA 4K7ZA 4FDCB 3ICRA 4BK2A 2ZO5A 2YVGA 2EQ9A 3NLCA 4NWZA 4YTPA 3LOVA 3EF6A 2OLNA 3QSEA 1LTXR 1D7YA 1CJ3A 4DGKA 1TDEA 1FS9A 1DJNA 1H83A 1H82A 2BYBA 2VVMA 2R4JA 2APGA 3AE3A 1GRHA 2QCUA 1D4DA 1CC6A 1JU2A 2WS3A 3CTYA 3F8DA 2FBWA 3H4KA 2A89A 4LA1A 3SXQA 2YM2A 4EQWA 2YR4A 3BI5A 3SQPA 1BGJA 4WJYA 2GV8A 4N9XA 5EOWA 4L3ZA 3IC9A 4L3XA 4C5OA 4GF7A 4CCQA 1IUTA 2VQ7A 1K0IA 1PXBA 1KNRA 2VQBA 4J56A 1V59A 1PXAA 2VVLA 3S61A 1NDAA 1N4UA 3NIXA 4CY8A 1S3EA 4Z44A 2E5VA 4GCMA 1P2EA 1VDCA 2C67A 2B76A 2EQ8A 2PHHA 1ZX9A 4II3A 1LPFA 3QJ4A 5FS9A 1ONFA 2B7SA 2BRYA 1M1QA 3QFAA 2CFYA 4AT2A 1PBBA 2R0GA 2C64A 5C2TA 1GRTA 1ZK7A 3T14A 2Y6RA 4H4XA 4J57A 4YTMA 2GEWA 2WU5A 1DOEA 3B3RA 1TDOA 3UU9A 2GAHB 1CBOA 1EL5A 3NYEA 5KVIA 4L3YA 1EL9A 4H2QA 2FJBA 3ICTA 3P4SA 2EQ6A 1JNRA 4NZHA 2BRAA 4USQA 4Y4MA 4B66A 3IHGA 3FBSA 3FIMB 4XWZA 2YG7A 3ABVA 4ECHA 3QFBA 3NRNA 3K30A 3VRAA 1PJ6A 4Z2RA 1TYPA 2GRTA 4EMWA 1ZKQA 4TM3A 1Q1WA 2QA1A 5TR3A 4ZN0A 1PBFA 2XCGA 3DA1A 3NGCX 1IUWA 1LV0A 2FJDA 2WP5A 4OPIA 3P4RA 1H6VA 2BK3A 1BZLA 1H7XA 3L1RA 3PS9A 4EQSA 2Q0KA 3CNDA 1LQTA 3BNJA 4GUVA 4TLZA 2OALA 1SEZA 2CDUA 2TMDA 4Y4NA 2BACA 3SM8A 4CBQA 2WDVA 5CQFA 2EQ7A 4NNJA 3GRTA 2OLOA 3C4AA 1KDGA 4U8LA 3SZCA 4E0VA 4U8PA 1GNDA 4EM3A 1FL2A 2GR0A 2IVEA 2RGHA 2WU2A 4D04A 1L9DA 3AEEA 1JNIA 1K4QA 3NYFA 3RP7A 1BF3A 1H84A 1OJAA 3F8RA 1GSNA 4BJZA 3GYIA 2IVDA 1Z6LA 2WOWA 3CNJA 3SY4A 3GYXA 4OPCA 5KVHA 1PJ7A 2C72A 2GB0A 4I58A 1B37A 4U2SA 3GYJA 3P1WA 2J7AA 3GDPA 2ACZA 3DK9A 4B69A 4KX6A 2BS4A 3G5SA 1EL8A 2YG5A 4USRA 1JEHA 2XLTA 2BCPA 3SYIA 2HQMA 3IF9A 1DNCA 2H89A 2X99A 3UTGA 2YG3A 1NG4A 2XFNA 4G9KA 3SCEA 2Y6QA 3CPIG 2XFUA 1NENA 4GAPA 4WX1A 1OAHA 4JNQA 2BC0A 2RF7A 1FS8A 1PXCA 1NHSA 1YQZA 2VRLA 5L46A 1VQWA 2FJAA 4RG3A 3SFEA 2V3AA 2VOUA 4H4TA 2GQFA 1Y56B 2C4CA 2V6OA 4REKA 4U2TA 4C3YA 4H50A 1JRXA 4ICYA 3NT6A 3AYLA 2C76A 2YAUA 4Z24A 4Z25A 4B67A 4NTCA 4BJYA 4GDPA 3V3OA 2XFOA 1MXTA 3EAOA 2AAQA 1D4CA 4RSLA 4TLXA 4B1BA 1D4EA 3UOVA 5KRQA 1CC4A 3NTAA 4AT0A 4KPRA 1OJCA 2QA2A 2QAEA 3FG2P 3M12A 4EIQA 4LIIA 4OPTA 1O95A 2YM1A 4NEVA 1COYA 1XPQA 1NAAA 3GWFA 2YLZA 3P9UA 2VRMA 1OJTA 3BNUA 4A6NB 3HYXA 1FEBA 3FPZA 4BK1A 3NK0X 2YG4A 2YR5A 1QDBA 1TDNA 3AEDA 4J33A 4YT0A 3AE2A 2JK6A 1GRGA 3CNTA 1MOKA 1KF6A 3BNMA 5EB4A 3LGQA 2XDOA 2WETA 5KMRA 1B5QA 4DNAA 5KOXA 4PAAA 2GAGB 3COXA 1GALA 1M6IA 1PS9A 3DJJA 4K5SA 4DSHA 3BI2A 1NG3A 1IJHA 2BABA 3EANA 4MJWA 3T0KA 3V3NA 3GD3A 4BURA 5BVAA 3DGHA 5KNLA 1RYIA 2X50A 3VRDB 1IUSA 5JCNA 3SFDA 3GMCA 4XXGA 3KLJA 2WPEA 4A6NA 3LJPA 2GVCA 4A7AA 4CY6A 1SP3A 2R0PA 3UOYA 1JRZA 4AOSA 4YKFA 4O5QA 3T2ZA 2Q7VA 3CPJG 3NTDA 2WP6A 4K8DA 2NVKX 2UZZA 4K2XA 2WQYA 5U63A 2DKIA 3QVRA 3TTBA 2BCGG 4H4WA 4IA6A 2W0HA 4X9MA 3CNSA 4H4VA 1BKWA 3DJDA 2X8GA 3DMEA 5U25A 2XFPA 2WESA 1VRQB 3RP8A 2BC1A 3BNGA 3UKHA 3UBRA 2XVEA 1PJ5A 4TM0A 2OAMA 2YLSA 3GWDA 3AEAA 1OJ9A 2BXRA 4B68A 4X9NA 2XLPA 1NHRA 1QLBA 2K3VA 2WDRA 3AE4A 4B65A 3LXDA 2C3CA 3NYCA 4A9WA 1KSSA 3D8XA 4YSHA 5BRTA 4IVOB 3NG7X 4XWRA 2R45A 3HZLA 3RHAA 1Y0PA 1H81A 5DBJA 1FEAA 3O0HA 1GETA 3ATQA 2O9ZA 3KD9A 4OPDA 1GRAA 2FJEA 2WEUA 1L0VA 3SZFA 3DJEA 4UP3A 1XDIA 1BVBA 5IQ4A 4EQRA 1F3PA 1YKJA 1FT6A 4H2NA 4OPLA 3VR8A 1CC2A 1QO8A 1GERA 5J60A 1XANA 3GD4A 1F8WA 3EPTA 1PN0A 1ZOYA 4JNAA 2BK4A 3ZYXA 1PBEA 1RSGA 2DKHA 3PO7A 4C3XA 2XFQA 1S2YA 3V76A 3UTHA 1EBDA 4Q1OA 4A79A 1B4VA 4NEWA 4A65A 1GT8A 3AE5A 3CGBA 2J3NA 2Z5YA 5JCKA 5GSNA 1PHHA 4Q5BA 1GU6A 1F8SA 5KMSA 2BS2A 3LADA 3UKQA 3UOXA 4H4YA 4YSZA 4Z2UA 3DJGX 4GAVA 2C73A 2GF3A 1HYUA 1E1LA 4H4PA 4IVMB 4NTEA 5HHFA 1GTHA 4K22A 4DSGA 1ZMCA 3CGCA 3UP4A 3P4PA 3T2KA 1FS7A 1F8RA 3D1IA 1GTEA 2XLSA 2ZZ0A 3CN8A 1ZOVA 3M0OA 3FO3A 2E1MA 4WCTA 2C65A 1GRBA 3SXIA 1L9CA 2R0CA 1KFYA 5C3JA 3GM6A 1GV4A 1LVLA 1ZDLA 3IHMA 2B9YA 2WP9A 3T2YA 1KNPA 2CVJA 3DGZA 3RP6A 2WDQA 2X8CA 3KU9A 4EQXA 5JCLA 2YR6A 3LG1A 3CPHG 3PVCA 4EMIA 3UOZA 1AOGA 3NNEA 3D1CA 4AP1A 4BV6A 1YY5A 2NPXA 5J7XA 2C75A 4I59A 2WHDA 1E1MA 2ZZBA 3AE6A 1CJCA 4HB9A 2GR3A 3UKAA 2OA1A 3UTEA 2AR8A 1E39A 3DH9A 1ZMDA 4O5UA 4M52A 3KPFA 3R9UA 1X31B 5BUKA 4IA5A 5HXIA 3SZ0A 3AD7B 4UDRA 1JRYA 1H86A 3S7WA 1IUVA 4JY3A 3K7MX 3WE0A 1TRBA 1W4XA 4YSYA 3S5WA 3UKKA 1VG0A 4U8NA 2V3BA 1Q1RA 3NHOX 3ZDNA 2X3NA 2XVFA 3IWAA 4Z2TA 2VVLG 3KVEA 1NEKA 3NK1X 4Y4LA 1PBDA 1DOBA 4H2PA 3URHA 2XVIA 2OT4A 3SZWA 3AWIA 4BK3A 2E80A 4OPUA 4Q4UA 4C74A 5JCMA 5KWFA 2VR0A 2YQUA 3OWMA 2XLUA 2GR2A 3ALMA 4FK1A 4ZCCA 3UKLA 4IV9A 3T37A 5HY5A 5LV9A 3C4NA 1BWCA 4X4JA 2VZ2A 3TORA 5U1OA 3SGLA 4EMJA 4K5RA 4H4UA 1TDFA 4TM1A 3UTFA 4YSXA 1N4VA 2RDZA 3AE8A 1TYTA 3MMOA 3OZ2A 1GOSA 3JSKA 3VQRA 3LZXA 3KPKA 3QVPA 3AYJA 4JDRA 1REOA 1KSUA 3F8PA 5KMQA 1E1KA 3K7QX 1VG9A 2V5ZA 4G74A 1FT5A 1FCDA 3C96A 2GQWA 4U8JA 1D5TA 1NHPA 2WPFA 3NKSA 4P9SA 3G5RA 2E4GA 2GMHA 5M0ZA 1YQ4A 1UKVG 5HYMA 2C66A 1D7LA 3CGDA 2B9WA 2WPCA 4U8IA 2V61A 5FS7A 1GEUA 3AB1A 3AE9A 4D03A 1DOCA 1FECA 3B6DA 2WOIA 1N4WA 1CJ2A 2XVHA 3M13A 1O5WA 4CCRA 4YXDA 1S2QA 3NN6X 1GPEA 2V60A 3AD9B 4G73A 4APNA 1P2HA 1DODA 3E1TA 4FK1C 3KKJA 1EL7A 1TDKA 2IIDA 1RP0A 2JB3A 2X8HA 3LB8A 3L1TA 4U2LA 3NN0X 2TPRA 3H8IA 5FMHA 4AP3A 3AYIA 2YLWA 2GH5A 3GDNA 1LQUA 2JKCA 2ZBWA 3ICSA 3KA7A 2RGOA 2R4EA 5KXJA 1L9EA 1JNZA 1Y56A 2XLRA 4L38A 4H4RA 4GDEA 2XVJA 2GR1A 1K0LA 3AEFA 1PDHA 2A8XA 4J34A 1YQ3A 3AE7A 3ALJA 1M64A 1ZP0A 3GRSA 3ALLA 3AD8B 4H4SA 4GRTA 2H88A 3DK4A 3UKFA 3L8KA 2ARDA 3CGEA 3ATRA 2LFCA 3AXBA 2YVFA 3AE1A 3P4QA 1GXFA 2BA9A 2C70A 1E6EA 4GR1A 3Q6JA 5EBKA 5EB5A 3F29A 4JY2A 4ADWA 3QSSA 4G6GA 2PYXA 2YLRA 2Z5XA 4UDPA 4YWOA 4Q0TA 3GMBA 1JOAA 1FOHA 5FS6A 1QJDA 4UDQA 2YLTA 3ISHA 4II2A 4Q17A 4EIPA 2RABA 4YTNA 2YLXA 2JBVA 2E81A 3BNFA 1GRFA 2C3DA 3AEGA 3CNPA 4B63A 2WBAA 1GREA 3UCLA 3FMWA 2A87A 3CMMA 3UKPA 2BXSA 5IPYA 5BULA 1OJDA 5CKUA 5KOWA 4RG4A 2JB2A 2BS3A 2BK5A 5JCIA 3SX6A 3CIRA 4NTDA 3GSIA 2C7GA 4OVIA 3II4A 4H4QA 3BNHA 3BHKA 4LU6A 1DJQA 3G5QA 2B9XA 1O94A 4Z43A 5FS8A 4TM4A 1CJ4A 1CL0A 3OC4A 4JN9A 4Z26A 1N1PA 1K0JA 3UP5A 3ADAB 5KMPA 4J31A 4U8MA 4A99A 2WOVA 1M1RA 1ELIA 1S3BA 3I3LA 4H7UA 4OPGA 1MO9A 4H2RA 4FX9A 3T31A 3VR9A 2YG6A 4EM4A 3RKHA 2YWLA 3BHFA 3NH3X 5GRTA 3QSMA 1E1NA 1LJ1A 2JAEA 1Q9IA 2I0ZA 2Q0LA 3ITJA 5IQ1A 4CNJA 2GMJA 1ZY8A 1B8SA 2RGJA 4U8OA 2F5ZA 1NPXA 4OCGA 4CRTA 2AQJA 3REDA 1DXLA 1BGNA 1E7PA 2R46A 2Q6UA 4Q5CA 5ER0A 4PABA 4YKGA 2YVJA 1M1PA 1IUUA 1H7WA 2JB1A 3RNMA 3I6DA 2ZZCA 3AECA 3LZWA 4J36A 4HA6A 3NK2X 4U8KA 1CHUA 2XYOA 3HYVA 4ZCDA 1CF3A 1F6MA 3AEBA 4B64A 3VRBA 5M10A 1PBCA 3K7TA 1XHCA 2CULA 4A5LA 2R9ZA 4AOXA 4JQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q9T A;  2B7R A;  1GES A;  1IUX A;  4J2W A;  3H8L A;  4C77 A;  3DK8 A;  4CNK A;  3BI4 A;  1NHQ A;  4H4Z A;  4K7Z A;  4FDC B;  3ICR A;  4BK2 A;  2ZO5 A;  2YVG A;  2EQ9 A;  3NLC A;  4YTP A;  3LOV A;  3EF6 A;  2OLN A;  3QSE A;  1LTX R;  1D7Y A;  1CJ3 A;  4DGK A;  1TDE A;  1FS9 A;  1DJN A;  1H83 A;  1H82 A;  2BYB A;  2VVM A;  2R4J A;  2APG A;  3AE3 A;  1GRH A;  2QCU A;  1D4D A;  1CC6 A;  1JU2 A;  2WS3 A;  3CTY A;  3F8D A;  2FBW A;  3H4K A;  2A89 A;  4LA1 A;  3SXQ A;  2YM2 A;  4EQW A;  2YR4 A;  3BI5 A;  3SQP A;  1BGJ A;  4WJY A;  2GV8 A;  4N9X A;  5EOW A;  4L3Z A;  3IC9 A;  4L3X A;  4C5O A;  4GF7 A;  4CCQ A;  1IUT A;  2VQ7 A;  1K0I A;  1PXB A;  1KNR A;  2VQB A;  4J56 A;  1V59 A;  1PXA A;  2VVL A;  3S61 A;  1NDA A;  1N4U A;  3NIX A;  4CY8 A;  1S3E A;  4Z44 A;  2E5V A;  4GCM A;  1P2E A;  1VDC A;  2C67 A;  2B76 A;  2EQ8 A;  2PHH A;  1ZX9 A;  1LPF A;  3QJ4 A;  5FS9 A;  1ONF A;  2B7S A;  1M1Q A;  3QFA A;  2CFY A;  4AT2 A;  1PBB A;  2R0G A;  2C64 A;  5C2T A;  1GRT A;  1ZK7 A;  2Y6R A;  4H4X A;  4J57 A;  4YTM A;  2GEW A;  2WU5 A;  1DOE A;  3B3R A;  1TDO A;  3UU9 A;  2GAH B;  1CBO A;  1EL5 A;  3NYE A;  5KVI A;  4L3Y A;  1EL9 A;  4H2Q A;  2FJB A;  3ICT A;  3P4S A;  2EQ6 A;  1JNR A;  4NZH A;  4USQ A;  4Y4M A;  4B66 A;  3IHG A;  3FBS A;  3FIM B;  4XWZ A;  2YG7 A;  3ABV A;  4ECH A;  3QFB A;  3NRN A;  3K30 A;  3VRA A;  1PJ6 A;  4Z2R A;  1TYP A;  2GRT A;  4EMW A;  1ZKQ A;  4TM3 A;  1Q1W A;  2QA1 A;  5TR3 A;  4ZN0 A;  1PBF A;  2XCG A;  3DA1 A;  3NGC X;  1IUW A;  1LV0 A;  2FJD A;  2WP5 A;  4OPI A;  3P4R A;  1H6V A;  2BK3 A;  1BZL A;  1H7X A;  3L1R A;  3PS9 A;  4EQS A;  2Q0K A;  3CND A;  1LQT A;  3BNJ A;  4GUV A;  4TLZ A;  2OAL A;  1SEZ A;  2CDU A;  2TMD A;  4Y4N A;  2BAC A;  3SM8 A;  4CBQ A;  2WDV A;  5CQF A;  2EQ7 A;  3GRT A;  2OLO A;  3C4A A;  1KDG A;  4U8L A;  4E0V A;  4EM3 A;  4U8P A;  1GND A;  1FL2 A;  2GR0 A;  2IVE A;  2RGH A;  2WU2 A;  4D04 A;  1L9D A;  3AEE A;  1JNI A;  1K4Q A;  3NYF A;  3RP7 A;  1BF3 A;  1H84 A;  1OJA A;  3F8R A;  1GSN A;  4BJZ A;  3GYI A;  2IVD A;  1Z6L A;  2WOW A;  3CNJ A;  3GYX A;  4OPC A;  5KVH A;  1PJ7 A;  2C72 A;  2GB0 A;  4I58 A;  1B37 A;  4U2S A;  3GYJ A;  3P1W A;  2J7A A;  3GDP A;  2ACZ A;  3DK9 A;  4B69 A;  4KX6 A;  2BS4 A;  3G5S A;  1EL8 A;  2YG5 A;  4USR A;  1JEH A;  2XLT A;  2BCP A;  2HQM A;  3IF9 A;  1DNC A;  2H89 A;  2X99 A;  3UTG A;  2YG3 A;  1NG4 A;  2XFN A;  4WX1 A;  3SCE A;  2Y6Q A;  3CPI G;  2XFU A;  1NEN A;  1OAH A;  4JNQ A;  2BC0 A;  2RF7 A;  1FS8 A;  1PXC A;  1NHS A;  1YQZ A;  2VRL A;  5L46 A;  1VQW A;  2FJA A;  4RG3 A;  3SFE A;  2V3A A;  2VOU A;  4H4T A;  2GQF A;  1Y56 B;  4REK A;  2V6O A;  4U2T A;  4C3Y A;  4H50 A;  1JRX A;  4ICY A;  3NT6 A;  3AYL A;  2C76 A;  2YAU A;  4Z24 A;  4Z25 A;  4B67 A;  4NTC A;  4BJY A;  4GDP A;  3V3O A;  2XFO A;  1MXT A;  3EAO A;  2AAQ A;  1D4C A;  4RSL A;  4TLX A;  4B1B A;  1D4E A;  3UOV A;  5KRQ A;  1CC4 A;  3NTA A;  4AT0 A;  4KPR A;  1OJC A;  2QA2 A;  2QAE A;  3FG2 P;  3M12 A;  4EIQ A;  4LII A;  4OPT A;  1O95 A;  2YM1 A;  4NEV A;  1COY A;  1XPQ A;  1NAA A;  3GWF A;  2YLZ A;  3P9U A;  2VRM A;  1OJT A;  3BNU A;  4A6N B;  1FEB A;  3FPZ A;  4BK1 A;  3NK0 X;  2YG4 A;  2YR5 A;  1QDB A;  1TDN A;  3AED A;  4J33 A;  4YT0 A;  3AE2 A;  2JK6 A;  1GRG A;  3CNT A;  1MOK A;  1KF6 A;  3BNM A;  5EB4 A;  3LGQ A;  2XDO A;  2WET A;  1B5Q A;  4DNA A;  5KOX A;  4PAA A;  2GAG B;  3COX A;  1GAL A;  1M6I A;  1PS9 A;  3DJJ A;  4K5S A;  4DSH A;  3BI2 A;  1NG3 A;  1IJH A;  2BAB A;  3EAN A;  4MJW A;  3V3N A;  5BVA A;  3GD3 A;  4BUR A;  3DGH A;  1RYI A;  2X50 A;  3VRD B;  1IUS A;  5JCN A;  3SFD A;  3GMC A;  4XXG A;  3KLJ A;  2WPE A;  4A6N A;  3LJP A;  2GVC A;  4A7A A;  4CY6 A;  1SP3 A;  2R0P A;  3UOY A;  1JRZ A;  4AOS A;  4YKF A;  4O5Q A;  2Q7V A;  3CPJ G;  3NTD A;  2WP6 A;  4K8D A;  2NVK X;  2UZZ A;  4K2X A;  2WQY A;  5U63 A;  2DKI A;  3QVR A;  3TTB A;  2BCG G;  4H4W A;  4IA6 A;  2W0H A;  4X9M A;  3CNS A;  4H4V A;  1BKW A;  3DJD A;  2X8G A;  3DME A;  5U25 A;  2XFP A;  2WES A;  1VRQ B;  3RP8 A;  2BC1 A;  3BNG A;  3UKH A;  3UBR A;  2XVE A;  1PJ5 A;  4TM0 A;  2OAM A;  2YLS A;  3GWD A;  3AEA A;  1OJ9 A;  2BXR A;  4B68 A;  4X9N A;  2XLP A;  1NHR A;  1QLB A;  2K3V A;  2WDR A;  3AE4 A;  4B65 A;  3LXD A;  2C3C A;  3NYC A;  4A9W A;  1KSS A;  3D8X A;  4YSH A;  5BRT A;  4IVO B;  3NG7 X;  4XWR A;  2R45 A;  3HZL A;  3RHA A;  1Y0P A;  1H81 A;  5DBJ A;  1FEA A;  3O0H A;  1GET A;  3ATQ A;  2O9Z A;  3KD9 A;  4OPD A;  1GRA A;  2FJE A;  2WEU A;  1L0V A;  3DJE A;  4UP3 A;  1XDI A;  1BVB A;  5IQ4 A;  4EQR A;  1F3P A;  1YKJ A;  1FT6 A;  4H2N A;  4OPL A;  3VR8 A;  1CC2 A;  1QO8 A;  1GER A;  5J60 A;  1XAN A;  3GD4 A;  1F8W A;  3EPT A;  1PN0 A;  1ZOY A;  4JNA A;  2BK4 A;  3ZYX A;  1PBE A;  1RSG A;  2DKH A;  3PO7 A;  4C3X A;  2XFQ A;  1S2Y A;  3V76 A;  3UTH A;  1EBD A;  4Q1O A;  4A79 A;  1B4V A;  4NEW A;  4A65 A;  1GT8 A;  3AE5 A;  3CGB A;  2J3N A;  2Z5Y A;  5JCK A;  5GSN A;  1PHH A;  4Q5B A;  1GU6 A;  1F8S A;  2BS2 A;  3LAD A;  3UKQ A;  3UOX A;  4H4Y A;  4YSZ A;  4Z2U A;  3DJG X;  2C73 A;  2GF3 A;  1HYU A;  1E1L A;  4H4P A;  4IVM B;  4NTE A;  5HHF A;  1GTH A;  4K22 A;  4DSG A;  1ZMC A;  3CGC A;  3UP4 A;  3P4P A;  1FS7 A;  1F8R A;  3D1I A;  1GTE A;  2XLS A;  2ZZ0 A;  3CN8 A;  1ZOV A;  3M0O A;  3FO3 A;  2E1M A;  4WCT A;  2C65 A;  1GRB A;  1L9C A;  2R0C A;  1KFY A;  5C3J A;  3GM6 A;  1GV4 A;  1LVL A;  1ZDL A;  3IHM A;  2B9Y A;  2WP9 A;  1KNP A;  2CVJ A;  3DGZ A;  3RP6 A;  2WDQ A;  2X8C A;  3KU9 A;  4EQX A;  5JCL A;  2YR6 A;  3LG1 A;  3CPH G;  3PVC A;  4EMI A;  3UOZ A;  1AOG A;  3NNE A;  3D1C A;  4AP1 A;  4BV6 A;  1YY5 A;  2NPX A;  5J7X A;  2C75 A;  4I59 A;  2WHD A;  1E1M A;  2ZZB A;  3AE6 A;  1CJC A;  4HB9 A;  2GR3 A;  3UKA A;  2OA1 A;  3UTE A;  2AR8 A;  1E39 A;  3DH9 A;  1ZMD A;  4O5U A;  4M52 A;  3KPF A;  3R9U A;  1X31 B;  5BUK A;  4IA5 A;  5HXI A;  3AD7 B;  4UDR A;  1JRY A;  1H86 A;  3S7W A;  1IUV A;  4JY3 A;  3K7M X;  3WE0 A;  1TRB A;  1W4X A;  4YSY A;  3S5W A;  3UKK A;  1VG0 A;  4U8N A;  2V3B A;  1Q1R A;  3NHO X;  3ZDN A;  2X3N A;  2XVF A;  3IWA A;  4Z2T A;  2VVL G;  3KVE A;  1NEK A;  3NK1 X;  4Y4L A;  1PBD A;  1DOB A;  4H2P A;  3URH A;  2XVI A;  2OT4 A;  3AWI A;  4BK3 A;  2E80 A;  4OPU A;  4Q4U A;  4C74 A;  5JCM A;  5KWF A;  2VR0 A;  2YQU A;  3OWM A;  2XLU A;  2GR2 A;  3ALM A;  4FK1 A;  4ZCC A;  3UKL A;  4IV9 A;  3T37 A;  5HY5 A;  5LV9 A;  3C4N A;  1BWC A;  4X4J A;  2VZ2 A;  3TOR A;  5U1O A;  3SGL A;  4EMJ A;  4K5R A;  4H4U A;  1TDF A;  4TM1 A;  3UTF A;  4YSX A;  1N4V A;  2RDZ A;  3AE8 A;  1TYT A;  3MMO A;  3OZ2 A;  1GOS A;  3JSK A;  3VQR A;  3LZX A;  3QVP A;  3AYJ A;  4JDR A;  1REO A;  1KSU A;  3F8P A;  1E1K A;  3K7Q X;  1VG9 A;  2V5Z A;  1FT5 A;  1FCD A;  3C96 A;  2GQW A;  4U8J A;  1D5T A;  1NHP A;  2WPF A;  3NKS A;  4P9S A;  3G5R A;  2E4G A;  2GMH A;  5M0Z A;  1YQ4 A;  1UKV G;  5HYM A;  2C66 A;  1D7L A;  3CGD A;  2B9W A;  2WPC A;  4U8I A;  2V61 A;  5FS7 A;  1GEU A;  3AB1 A;  3AE9 A;  4D03 A;  1DOC A;  1FEC A;  3B6D A;  2WOI A;  1N4W A;  1CJ2 A;  2XVH A;  3M13 A;  1O5W A;  4CCR A;  4YXD A;  1S2Q A;  3NN6 X;  1GPE A;  2V60 A;  3AD9 B;  4APN A;  1P2H A;  1DOD A;  3E1T A;  4FK1 C;  3KKJ A;  1EL7 A;  1TDK A;  2IID A;  1RP0 A;  2JB3 A;  2X8H A;  3LB8 A;  3L1T A;  4U2L A;  3NN0 X;  2TPR A;  3H8I A;  5FMH A;  4AP3 A;  3AYI A;  2YLW A;  2GH5 A;  3GDN A;  1LQU A;  2JKC A;  2ZBW A;  3ICS A;  3KA7 A;  2RGO A;  2R4E A;  5KXJ A;  1L9E A;  1JNZ A;  1Y56 A;  2XLR A;  4L38 A;  4H4R A;  4GDE A;  2XVJ A;  2GR1 A;  1K0L A;  3AEF A;  1PDH A;  2A8X A;  4J34 A;  1YQ3 A;  3AE7 A;  3ALJ A;  1M64 A;  1ZP0 A;  3GRS A;  3ALL A;  3AD8 B;  4H4S A;  4GRT A;  2H88 A;  3DK4 A;  3UKF A;  3L8K A;  2ARD A;  3CGE A;  3ATR A;  2LFC A;  3AXB A;  2YVF A;  3AE1 A;  3P4Q A;  1GXF A;  2BA9 A;  2C70 A;  1E6E A;  4GR1 A;  3Q6J A;  5EBK A;  5EB5 A;  3F29 A;  4JY2 A;  4ADW A;  3QSS A;  2PYX A;  2YLR A;  2Z5X A;  4UDP A;  4YWO A;  4Q0T A;  3GMB A;  1JOA A;  1FOH A;  5FS6 A;  1QJD A;  4UDQ A;  2YLT A;  3ISH A;  4Q17 A;  4EIP A;  2RAB A;  4YTN A;  2YLX A;  2JBV A;  2E81 A;  3BNF A;  1GRF A;  2C3D A;  3AEG A;  3CNP A;  4B63 A;  2WBA A;  1GRE A;  3UCL A;  3FMW A;  2A87 A;  3UKP A;  2BXS A;  5IPY A;  5BUL A;  1OJD A;  5CKU A;  5KOW A;  4RG4 A;  2JB2 A;  2BS3 A;  2BK5 A;  5JCI A;  3CIR A;  4NTD A;  3GSI A;  2C7G A;  4OVI A;  3II4 A;  4H4Q A;  3BNH A;  3BHK A;  4LU6 A;  1DJQ A;  3G5Q A;  2B9X A;  1O94 A;  4Z43 A;  5FS8 A;  4TM4 A;  1CJ4 A;  1CL0 A;  3OC4 A;  4JN9 A;  4Z26 A;  1N1P A;  1K0J A;  3UP5 A;  3ADA B;  4J31 A;  4U8M A;  4A99 A;  2WOV A;  1M1R A;  1ELI A;  1S3B A;  3I3L A;  4H7U A;  4OPG A;  1MO9 A;  4H2R A;  4FX9 A;  3VR9 A;  2YG6 A;  4EM4 A;  3RKH A;  2YWL A;  3BHF A;  3NH3 X;  5GRT A;  3QSM A;  1E1N A;  1LJ1 A;  2JAE A;  1Q9I A;  2I0Z A;  2Q0L A;  3ITJ A;  5IQ1 A;  4CNJ A;  2GMJ A;  1ZY8 A;  1B8S A;  2RGJ A;  4U8O A;  2F5Z A;  1NPX A;  4OCG A;  4CRT A;  2AQJ A;  3RED A;  1DXL A;  1BGN A;  1E7P A;  2R46 A;  2Q6U A;  4Q5C A;  5ER0 A;  4PAB A;  4YKG A;  2YVJ A;  1M1P A;  1IUU A;  1H7W A;  2JB1 A;  3RNM A;  3I6D A;  2ZZC A;  3AEC A;  3LZW A;  4J36 A;  4HA6 A;  3NK2 X;  4U8K A;  1CHU A;  2XYO A;  4ZCD A;  1CF3 A;  1F6M A;  3AEB A;  4B64 A;  3VRB A;  5M10 A;  1PBC A;  3K7T A;  1XHC A;  2CUL A;  4A5L A;  2R9Z A;  4AOX A;  4JQ9 A; 
#chains in the Genus database with same CATH topology
 3Q9T A;  2B7R A;  1GES A;  1IUX A;  3HYW A;  4J2W A;  3H8L A;  4C77 A;  3DK8 A;  4CNK A;  3BI4 A;  1NHQ A;  4H4Z A;  4G6H A;  4K7Z A;  4FDC B;  3ICR A;  4BK2 A;  2ZO5 A;  2YVG A;  2EQ9 A;  3NLC A;  4NWZ A;  4YTP A;  3LOV A;  3EF6 A;  2OLN A;  3QSE A;  1LTX R;  1D7Y A;  1CJ3 A;  4DGK A;  1TDE A;  1FS9 A;  1DJN A;  1H83 A;  1H82 A;  2BYB A;  2VVM A;  2R4J A;  2APG A;  3AE3 A;  1GRH A;  2QCU A;  1D4D A;  1CC6 A;  1JU2 A;  2WS3 A;  3CTY A;  3F8D A;  2FBW A;  3H4K A;  2A89 A;  4LA1 A;  3SXQ A;  2YM2 A;  4EQW A;  2YR4 A;  3BI5 A;  3SQP A;  1BGJ A;  4WJY A;  2GV8 A;  4N9X A;  5EOW A;  4L3Z A;  3IC9 A;  4L3X A;  4C5O A;  4GF7 A;  4CCQ A;  1IUT A;  2VQ7 A;  1K0I A;  1PXB A;  1KNR A;  2VQB A;  4J56 A;  1V59 A;  1PXA A;  2VVL A;  3S61 A;  1NDA A;  1N4U A;  3NIX A;  4CY8 A;  1S3E A;  4Z44 A;  2E5V A;  4GCM A;  1P2E A;  1VDC A;  2C67 A;  2B76 A;  2EQ8 A;  2PHH A;  1ZX9 A;  4II3 A;  1LPF A;  3QJ4 A;  5FS9 A;  1ONF A;  2B7S A;  2BRY A;  1M1Q A;  3QFA A;  2CFY A;  4AT2 A;  1PBB A;  2R0G A;  2C64 A;  5C2T A;  1GRT A;  1ZK7 A;  3T14 A;  2Y6R A;  4H4X A;  4J57 A;  4YTM A;  2GEW A;  2WU5 A;  1DOE A;  3B3R A;  1TDO A;  3UU9 A;  2GAH B;  1CBO A;  1EL5 A;  3NYE A;  5KVI A;  4L3Y A;  1EL9 A;  4H2Q A;  2FJB A;  3ICT A;  3P4S A;  2EQ6 A;  1JNR A;  4NZH A;  2BRA A;  4USQ A;  4Y4M A;  4B66 A;  3IHG A;  3FBS A;  3FIM B;  4XWZ A;  2YG7 A;  3ABV A;  4ECH A;  3QFB A;  3NRN A;  3K30 A;  3VRA A;  1PJ6 A;  4Z2R A;  1TYP A;  2GRT A;  4EMW A;  1ZKQ A;  4TM3 A;  1Q1W A;  2QA1 A;  5TR3 A;  4ZN0 A;  1PBF A;  2XCG A;  3DA1 A;  3NGC X;  1IUW A;  1LV0 A;  2FJD A;  2WP5 A;  4OPI A;  3P4R A;  1H6V A;  2BK3 A;  1BZL A;  1H7X A;  3L1R A;  3PS9 A;  4EQS A;  2Q0K A;  3CND A;  1LQT A;  3BNJ A;  4GUV A;  4TLZ A;  2OAL A;  1SEZ A;  2CDU A;  2TMD A;  4Y4N A;  2BAC A;  3SM8 A;  4CBQ A;  2WDV A;  5CQF A;  2EQ7 A;  4NNJ A;  3GRT A;  2OLO A;  3C4A A;  1KDG A;  4U8L A;  3SZC A;  4E0V A;  4U8P A;  1GND A;  4EM3 A;  1FL2 A;  2GR0 A;  2IVE A;  2RGH A;  2WU2 A;  4D04 A;  1L9D A;  3AEE A;  1JNI A;  1K4Q A;  3NYF A;  3RP7 A;  1BF3 A;  1H84 A;  1OJA A;  3F8R A;  1GSN A;  4BJZ A;  3GYI A;  2IVD A;  1Z6L A;  2WOW A;  3CNJ A;  3SY4 A;  3GYX A;  4OPC A;  5KVH A;  1PJ7 A;  2C72 A;  2GB0 A;  4I58 A;  1B37 A;  4U2S A;  3GYJ A;  3P1W A;  2J7A A;  3GDP A;  2ACZ A;  3DK9 A;  4B69 A;  4KX6 A;  2BS4 A;  3G5S A;  1EL8 A;  2YG5 A;  4USR A;  1JEH A;  2XLT A;  2BCP A;  3SYI A;  2HQM A;  3IF9 A;  1DNC A;  2H89 A;  2X99 A;  3UTG A;  2YG3 A;  1NG4 A;  2XFN A;  4G9K A;  3SCE A;  2Y6Q A;  3CPI G;  2XFU A;  1NEN A;  4GAP A;  4WX1 A;  1OAH A;  4JNQ A;  2BC0 A;  2RF7 A;  1FS8 A;  1PXC A;  1NHS A;  1YQZ A;  2VRL A;  5L46 A;  1VQW A;  2FJA A;  4RG3 A;  3SFE A;  2V3A A;  2VOU A;  4H4T A;  2GQF A;  1Y56 B;  2C4C A;  2V6O A;  4REK A;  4U2T A;  4C3Y A;  4H50 A;  1JRX A;  4ICY A;  3NT6 A;  3AYL A;  2C76 A;  2YAU A;  4Z24 A;  4Z25 A;  4B67 A;  4NTC A;  4BJY A;  4GDP A;  3V3O A;  2XFO A;  1MXT A;  3EAO A;  2AAQ A;  1D4C A;  4RSL A;  4TLX A;  4B1B A;  1D4E A;  3UOV A;  5KRQ A;  1CC4 A;  3NTA A;  4AT0 A;  4KPR A;  1OJC A;  2QA2 A;  2QAE A;  3FG2 P;  3M12 A;  4EIQ A;  4LII A;  4OPT A;  1O95 A;  2YM1 A;  4NEV A;  1COY A;  1XPQ A;  1NAA A;  3GWF A;  2YLZ A;  3P9U A;  2VRM A;  1OJT A;  3BNU A;  4A6N B;  3HYX A;  1FEB A;  3FPZ A;  4BK1 A;  3NK0 X;  2YG4 A;  2YR5 A;  1QDB A;  1TDN A;  3AED A;  4J33 A;  4YT0 A;  3AE2 A;  2JK6 A;  1GRG A;  3CNT A;  1MOK A;  1KF6 A;  3BNM A;  5EB4 A;  3LGQ A;  2XDO A;  2WET A;  5KMR A;  1B5Q A;  4DNA A;  5KOX A;  4PAA A;  2GAG B;  3COX A;  1GAL A;  1M6I A;  1PS9 A;  3DJJ A;  4K5S A;  4DSH A;  3BI2 A;  1NG3 A;  1IJH A;  2BAB A;  3EAN A;  4MJW A;  3T0K A;  3V3N A;  3GD3 A;  4BUR A;  5BVA A;  3DGH A;  5KNL A;  1RYI A;  2X50 A;  3VRD B;  1IUS A;  5JCN A;  3SFD A;  3GMC A;  4XXG A;  3KLJ A;  2WPE A;  4A6N A;  3LJP A;  2GVC A;  4A7A A;  4CY6 A;  1SP3 A;  2R0P A;  3UOY A;  1JRZ A;  4AOS A;  4YKF A;  4O5Q A;  3T2Z A;  2Q7V A;  3CPJ G;  3NTD A;  2WP6 A;  4K8D A;  2NVK X;  2UZZ A;  4K2X A;  2WQY A;  5U63 A;  2DKI A;  3QVR A;  3TTB A;  2BCG G;  4H4W A;  4IA6 A;  2W0H A;  4X9M A;  3CNS A;  4H4V A;  1BKW A;  3DJD A;  2X8G A;  3DME A;  5U25 A;  2XFP A;  2WES A;  1VRQ B;  3RP8 A;  2BC1 A;  3BNG A;  3UKH A;  3UBR A;  2XVE A;  1PJ5 A;  4TM0 A;  2OAM A;  2YLS A;  3GWD A;  3AEA A;  1OJ9 A;  2BXR A;  4B68 A;  4X9N A;  2XLP A;  1NHR A;  1QLB A;  2K3V A;  2WDR A;  3AE4 A;  4B65 A;  3LXD A;  2C3C A;  3NYC A;  4A9W A;  1KSS A;  3D8X A;  4YSH A;  5BRT A;  4IVO B;  3NG7 X;  4XWR A;  2R45 A;  3HZL A;  3RHA A;  1Y0P A;  1H81 A;  5DBJ A;  1FEA A;  3O0H A;  1GET A;  3ATQ A;  2O9Z A;  3KD9 A;  4OPD A;  1GRA A;  2FJE A;  2WEU A;  1L0V A;  3SZF A;  3DJE A;  4UP3 A;  1XDI A;  1BVB A;  5IQ4 A;  4EQR A;  1F3P A;  1YKJ A;  1FT6 A;  4H2N A;  4OPL A;  3VR8 A;  1CC2 A;  1QO8 A;  1GER A;  5J60 A;  1XAN A;  3GD4 A;  1F8W A;  3EPT A;  1PN0 A;  1ZOY A;  4JNA A;  2BK4 A;  3ZYX A;  1PBE A;  1RSG A;  2DKH A;  3PO7 A;  4C3X A;  2XFQ A;  1S2Y A;  3V76 A;  3UTH A;  1EBD A;  4Q1O A;  4A79 A;  1B4V A;  4NEW A;  4A65 A;  1GT8 A;  3AE5 A;  3CGB A;  2J3N A;  2Z5Y A;  5JCK A;  5GSN A;  1PHH A;  4Q5B A;  1GU6 A;  1F8S A;  5KMS A;  2BS2 A;  3LAD A;  3UKQ A;  3UOX A;  4H4Y A;  4YSZ A;  4Z2U A;  3DJG X;  4GAV A;  2C73 A;  2GF3 A;  1HYU A;  1E1L A;  4H4P A;  4IVM B;  4NTE A;  5HHF A;  1GTH A;  4K22 A;  4DSG A;  1ZMC A;  3CGC A;  3UP4 A;  3P4P A;  3T2K A;  1FS7 A;  1F8R A;  3D1I A;  1GTE A;  2XLS A;  2ZZ0 A;  3CN8 A;  1ZOV A;  3M0O A;  3FO3 A;  2E1M A;  4WCT A;  2C65 A;  1GRB A;  3SXI A;  1L9C A;  2R0C A;  1KFY A;  5C3J A;  3GM6 A;  1GV4 A;  1LVL A;  1ZDL A;  3IHM A;  2B9Y A;  2WP9 A;  3T2Y A;  1KNP A;  2CVJ A;  3DGZ A;  3RP6 A;  2WDQ A;  2X8C A;  3KU9 A;  4EQX A;  5JCL A;  2YR6 A;  3LG1 A;  3CPH G;  3PVC A;  4EMI A;  3UOZ A;  1AOG A;  3NNE A;  3D1C A;  4AP1 A;  4BV6 A;  1YY5 A;  2NPX A;  5J7X A;  2C75 A;  4I59 A;  2WHD A;  1E1M A;  2ZZB A;  3AE6 A;  1CJC A;  4HB9 A;  2GR3 A;  3UKA A;  2OA1 A;  3UTE A;  2AR8 A;  1E39 A;  3DH9 A;  1ZMD A;  4O5U A;  4M52 A;  3KPF A;  3R9U A;  1X31 B;  5BUK A;  4IA5 A;  5HXI A;  3SZ0 A;  3AD7 B;  4UDR A;  1JRY A;  1H86 A;  3S7W A;  1IUV A;  4JY3 A;  3K7M X;  3WE0 A;  1TRB A;  1W4X A;  4YSY A;  3S5W A;  3UKK A;  1VG0 A;  4U8N A;  2V3B A;  1Q1R A;  3NHO X;  3ZDN A;  2X3N A;  2XVF A;  3IWA A;  4Z2T A;  2VVL G;  3KVE A;  1NEK A;  3NK1 X;  4Y4L A;  1PBD A;  1DOB A;  4H2P A;  3URH A;  2XVI A;  2OT4 A;  3SZW A;  3AWI A;  4BK3 A;  2E80 A;  4OPU A;  4Q4U A;  4C74 A;  5JCM A;  5KWF A;  2VR0 A;  2YQU A;  3OWM A;  2XLU A;  2GR2 A;  3ALM A;  4FK1 A;  4ZCC A;  3UKL A;  4IV9 A;  3T37 A;  5HY5 A;  5LV9 A;  3C4N A;  1BWC A;  4X4J A;  2VZ2 A;  3TOR A;  5U1O A;  3SGL A;  4EMJ A;  4K5R A;  4H4U A;  1TDF A;  4TM1 A;  3UTF A;  4YSX A;  1N4V A;  2RDZ A;  3AE8 A;  1TYT A;  3MMO A;  3OZ2 A;  1GOS A;  3JSK A;  3VQR A;  3LZX A;  3KPK A;  3QVP A;  3AYJ A;  4JDR A;  1REO A;  1KSU A;  3F8P A;  5KMQ A;  1E1K A;  3K7Q X;  1VG9 A;  2V5Z A;  4G74 A;  1FT5 A;  1FCD A;  3C96 A;  2GQW A;  4U8J A;  1D5T A;  1NHP A;  2WPF A;  3NKS A;  4P9S A;  3G5R A;  2E4G A;  2GMH A;  5M0Z A;  1YQ4 A;  1UKV G;  5HYM A;  2C66 A;  1D7L A;  3CGD A;  2B9W A;  2WPC A;  4U8I A;  2V61 A;  5FS7 A;  1GEU A;  3AB1 A;  3AE9 A;  4D03 A;  1DOC A;  1FEC A;  3B6D A;  2WOI A;  1N4W A;  1CJ2 A;  2XVH A;  3M13 A;  1O5W A;  4CCR A;  4YXD A;  1S2Q A;  3NN6 X;  1GPE A;  2V60 A;  3AD9 B;  4G73 A;  4APN A;  1P2H A;  1DOD A;  3E1T A;  4FK1 C;  3KKJ A;  1EL7 A;  1TDK A;  2IID A;  1RP0 A;  2JB3 A;  2X8H A;  3LB8 A;  3L1T A;  4U2L A;  3NN0 X;  2TPR A;  3H8I A;  5FMH A;  4AP3 A;  3AYI A;  2YLW A;  2GH5 A;  3GDN A;  1LQU A;  2JKC A;  2ZBW A;  3ICS A;  3KA7 A;  2RGO A;  2R4E A;  5KXJ A;  1L9E A;  1JNZ A;  1Y56 A;  2XLR A;  4L38 A;  4H4R A;  4GDE A;  2XVJ A;  2GR1 A;  1K0L A;  3AEF A;  1PDH A;  2A8X A;  4J34 A;  1YQ3 A;  3AE7 A;  3ALJ A;  1M64 A;  1ZP0 A;  3GRS A;  3ALL A;  3AD8 B;  4H4S A;  4GRT A;  2H88 A;  3DK4 A;  3UKF A;  3L8K A;  2ARD A;  3CGE A;  3ATR A;  2LFC A;  3AXB A;  2YVF A;  3AE1 A;  3P4Q A;  1GXF A;  2BA9 A;  2C70 A;  1E6E A;  4GR1 A;  3Q6J A;  5EBK A;  5EB5 A;  3F29 A;  4JY2 A;  4ADW A;  3QSS A;  4G6G A;  2PYX A;  2YLR A;  2Z5X A;  4UDP A;  4YWO A;  4Q0T A;  3GMB A;  1JOA A;  1FOH A;  5FS6 A;  1QJD A;  4UDQ A;  2YLT A;  3ISH A;  4II2 A;  4Q17 A;  4EIP A;  2RAB A;  4YTN A;  2YLX A;  2JBV A;  2E81 A;  3BNF A;  1GRF A;  2C3D A;  3AEG A;  3CNP A;  4B63 A;  2WBA A;  1GRE A;  3UCL A;  3FMW A;  2A87 A;  3CMM A;  3UKP A;  2BXS A;  5IPY A;  5BUL A;  1OJD A;  5CKU A;  5KOW A;  4RG4 A;  2JB2 A;  2BS3 A;  2BK5 A;  5JCI A;  3SX6 A;  3CIR A;  4NTD A;  3GSI A;  2C7G A;  4OVI A;  3II4 A;  4H4Q A;  3BNH A;  3BHK A;  4LU6 A;  1DJQ A;  3G5Q A;  2B9X A;  1O94 A;  4Z43 A;  5FS8 A;  4TM4 A;  1CJ4 A;  1CL0 A;  3OC4 A;  4JN9 A;  4Z26 A;  1N1P A;  1K0J A;  3UP5 A;  3ADA B;  5KMP A;  4J31 A;  4U8M A;  4A99 A;  2WOV A;  1M1R A;  1ELI A;  1S3B A;  3I3L A;  4H7U A;  4OPG A;  1MO9 A;  4H2R A;  4FX9 A;  3T31 A;  3VR9 A;  2YG6 A;  4EM4 A;  3RKH A;  2YWL A;  3BHF A;  3NH3 X;  5GRT A;  3QSM A;  1E1N A;  1LJ1 A;  2JAE A;  1Q9I A;  2I0Z A;  2Q0L A;  3ITJ A;  5IQ1 A;  4CNJ A;  2GMJ A;  1ZY8 A;  1B8S A;  2RGJ A;  4U8O A;  2F5Z A;  1NPX A;  4OCG A;  4CRT A;  2AQJ A;  3RED A;  2CZS A;  1DXL A;  1BGN A;  1E7P A;  2R46 A;  2Q6U A;  4Q5C A;  5ER0 A;  4PAB A;  4YKG A;  2YVJ A;  1M1P A;  1IUU A;  1H7W A;  2JB1 A;  3RNM A;  3I6D A;  2ZZC A;  3AEC A;  3LZW A;  4J36 A;  4HA6 A;  3NK2 X;  4U8K A;  1CHU A;  2XYO A;  3HYV A;  4ZCD A;  1CF3 A;  1F6M A;  3AEB A;  4B64 A;  3VRB A;  5M10 A;  1PBC A;  3K7T A;  1XHC A;  2CUL A;  4A5L A;  2R9Z A;  4AOX A;  4JQ9 A; 
#chains in the Genus database with same CATH homology
 3Q9T A;  2B7R A;  1GES A;  1IUX A;  3HYW A;  4J2W A;  3H8L A;  4C77 A;  3DK8 A;  4CNK A;  3BI4 A;  1NHQ A;  4H4Z A;  4G6H A;  4K7Z A;  4FDC B;  3ICR A;  4BK2 A;  2ZO5 A;  2YVG A;  2EQ9 A;  3NLC A;  4NWZ A;  4YTP A;  3LOV A;  3EF6 A;  2OLN A;  3QSE A;  1LTX R;  1D7Y A;  1CJ3 A;  4DGK A;  1TDE A;  1FS9 A;  1DJN A;  1H83 A;  1H82 A;  2BYB A;  2VVM A;  2R4J A;  2APG A;  3AE3 A;  1GRH A;  2QCU A;  1D4D A;  1CC6 A;  1JU2 A;  2WS3 A;  3CTY A;  3F8D A;  2FBW A;  3H4K A;  2A89 A;  4LA1 A;  3SXQ A;  2YM2 A;  4EQW A;  2YR4 A;  3BI5 A;  3SQP A;  1BGJ A;  4WJY A;  2GV8 A;  4N9X A;  5EOW A;  4L3Z A;  3IC9 A;  4L3X A;  4C5O A;  4GF7 A;  4CCQ A;  1IUT A;  2VQ7 A;  1K0I A;  1PXB A;  1KNR A;  2VQB A;  4J56 A;  1V59 A;  1PXA A;  2VVL A;  3S61 A;  1NDA A;  1N4U A;  3NIX A;  4CY8 A;  1S3E A;  4Z44 A;  2E5V A;  4GCM A;  1P2E A;  1VDC A;  2C67 A;  2B76 A;  2EQ8 A;  2PHH A;  1ZX9 A;  4II3 A;  1LPF A;  3QJ4 A;  5FS9 A;  1ONF A;  2B7S A;  2BRY A;  1M1Q A;  3QFA A;  2CFY A;  4AT2 A;  1PBB A;  2R0G A;  2C64 A;  5C2T A;  1GRT A;  1ZK7 A;  3T14 A;  2Y6R A;  4H4X A;  4J57 A;  4YTM A;  2GEW A;  2WU5 A;  1DOE A;  3B3R A;  1TDO A;  3UU9 A;  2GAH B;  1CBO A;  1EL5 A;  3NYE A;  5KVI A;  4L3Y A;  1EL9 A;  4H2Q A;  2FJB A;  3ICT A;  3P4S A;  2EQ6 A;  1JNR A;  4NZH A;  2BRA A;  4USQ A;  4Y4M A;  4B66 A;  3IHG A;  3FBS A;  3FIM B;  4XWZ A;  2YG7 A;  3ABV A;  4ECH A;  3QFB A;  3NRN A;  3K30 A;  3VRA A;  1PJ6 A;  4Z2R A;  1TYP A;  2GRT A;  4EMW A;  1ZKQ A;  4TM3 A;  1Q1W A;  2QA1 A;  5TR3 A;  4ZN0 A;  1PBF A;  2XCG A;  3DA1 A;  3NGC X;  1IUW A;  1LV0 A;  2FJD A;  2WP5 A;  4OPI A;  3P4R A;  1H6V A;  2BK3 A;  1BZL A;  1H7X A;  3L1R A;  3PS9 A;  4EQS A;  2Q0K A;  3CND A;  1LQT A;  3BNJ A;  4GUV A;  4TLZ A;  2OAL A;  1SEZ A;  2CDU A;  2TMD A;  4Y4N A;  2BAC A;  3SM8 A;  4CBQ A;  2WDV A;  5CQF A;  2EQ7 A;  4NNJ A;  3GRT A;  2OLO A;  3C4A A;  1KDG A;  4U8L A;  3SZC A;  4E0V A;  4U8P A;  1GND A;  4EM3 A;  1FL2 A;  2GR0 A;  2IVE A;  2RGH A;  2WU2 A;  4D04 A;  1L9D A;  3AEE A;  1JNI A;  1K4Q A;  3NYF A;  3RP7 A;  1BF3 A;  1H84 A;  1OJA A;  3F8R A;  1GSN A;  4BJZ A;  3GYI A;  2IVD A;  1Z6L A;  2WOW A;  3CNJ A;  3SY4 A;  3GYX A;  4OPC A;  5KVH A;  1PJ7 A;  2C72 A;  2GB0 A;  4I58 A;  1B37 A;  4U2S A;  3GYJ A;  3P1W A;  2J7A A;  3GDP A;  2ACZ A;  3DK9 A;  4B69 A;  4KX6 A;  2BS4 A;  3G5S A;  1EL8 A;  2YG5 A;  4USR A;  1JEH A;  2XLT A;  2BCP A;  3SYI A;  2HQM A;  3IF9 A;  1DNC A;  2H89 A;  2X99 A;  3UTG A;  2YG3 A;  1NG4 A;  2XFN A;  4G9K A;  3SCE A;  2Y6Q A;  3CPI G;  2XFU A;  1NEN A;  4GAP A;  4WX1 A;  1OAH A;  4JNQ A;  2BC0 A;  2RF7 A;  1FS8 A;  1PXC A;  1NHS A;  1YQZ A;  2VRL A;  5L46 A;  1VQW A;  2FJA A;  4RG3 A;  3SFE A;  2V3A A;  2VOU A;  4H4T A;  2GQF A;  1Y56 B;  2C4C A;  2V6O A;  4REK A;  4U2T A;  4C3Y A;  4H50 A;  1JRX A;  4ICY A;  3NT6 A;  3AYL A;  2C76 A;  2YAU A;  4Z24 A;  4Z25 A;  4B67 A;  4NTC A;  4BJY A;  4GDP A;  3V3O A;  2XFO A;  1MXT A;  3EAO A;  2AAQ A;  1D4C A;  4RSL A;  4TLX A;  4B1B A;  1D4E A;  3UOV A;  5KRQ A;  1CC4 A;  3NTA A;  4AT0 A;  4KPR A;  1OJC A;  2QA2 A;  2QAE A;  3FG2 P;  3M12 A;  4EIQ A;  4LII A;  4OPT A;  1O95 A;  2YM1 A;  4NEV A;  1COY A;  1XPQ A;  1NAA A;  3GWF A;  2YLZ A;  3P9U A;  2VRM A;  1OJT A;  3BNU A;  4A6N B;  3HYX A;  1FEB A;  3FPZ A;  4BK1 A;  3NK0 X;  2YG4 A;  2YR5 A;  1QDB A;  1TDN A;  3AED A;  4J33 A;  4YT0 A;  3AE2 A;  2JK6 A;  1GRG A;  3CNT A;  1MOK A;  1KF6 A;  3BNM A;  5EB4 A;  3LGQ A;  2XDO A;  2WET A;  5KMR A;  1B5Q A;  4DNA A;  5KOX A;  4PAA A;  2GAG B;  3COX A;  1GAL A;  1M6I A;  1PS9 A;  3DJJ A;  4K5S A;  4DSH A;  3BI2 A;  1NG3 A;  1IJH A;  2BAB A;  3EAN A;  4MJW A;  3T0K A;  3V3N A;  3GD3 A;  4BUR A;  5BVA A;  3DGH A;  5KNL A;  1RYI A;  2X50 A;  3VRD B;  1IUS A;  5JCN A;  3SFD A;  3GMC A;  4XXG A;  3KLJ A;  2WPE A;  4A6N A;  3LJP A;  2GVC A;  4A7A A;  4CY6 A;  1SP3 A;  2R0P A;  3UOY A;  1JRZ A;  4AOS A;  4YKF A;  4O5Q A;  3T2Z A;  2Q7V A;  3CPJ G;  3NTD A;  2WP6 A;  4K8D A;  2NVK X;  2UZZ A;  4K2X A;  2WQY A;  5U63 A;  2DKI A;  3QVR A;  3TTB A;  2BCG G;  4H4W A;  4IA6 A;  2W0H A;  4X9M A;  3CNS A;  4H4V A;  1BKW A;  3DJD A;  2X8G A;  3DME A;  5U25 A;  2XFP A;  2WES A;  1VRQ B;  3RP8 A;  2BC1 A;  3BNG A;  3UKH A;  3UBR A;  2XVE A;  1PJ5 A;  4TM0 A;  2OAM A;  2YLS A;  3GWD A;  3AEA A;  1OJ9 A;  2BXR A;  4B68 A;  4X9N A;  2XLP A;  1NHR A;  1QLB A;  2K3V A;  2WDR A;  3AE4 A;  4B65 A;  3LXD A;  2C3C A;  3NYC A;  4A9W A;  1KSS A;  3D8X A;  4YSH A;  5BRT A;  4IVO B;  3NG7 X;  4XWR A;  2R45 A;  3HZL A;  3RHA A;  1Y0P A;  1H81 A;  5DBJ A;  1FEA A;  3O0H A;  1GET A;  3ATQ A;  2O9Z A;  3KD9 A;  4OPD A;  1GRA A;  2FJE A;  2WEU A;  1L0V A;  3SZF A;  3DJE A;  4UP3 A;  1XDI A;  1BVB A;  5IQ4 A;  4EQR A;  1F3P A;  1YKJ A;  1FT6 A;  4H2N A;  4OPL A;  3VR8 A;  1CC2 A;  1QO8 A;  1GER A;  5J60 A;  1XAN A;  3GD4 A;  1F8W A;  3EPT A;  1PN0 A;  1ZOY A;  4JNA A;  2BK4 A;  3ZYX A;  1PBE A;  1RSG A;  2DKH A;  3PO7 A;  4C3X A;  2XFQ A;  1S2Y A;  3V76 A;  3UTH A;  1EBD A;  4Q1O A;  4A79 A;  1B4V A;  4NEW A;  4A65 A;  1GT8 A;  3AE5 A;  3CGB A;  2J3N A;  2Z5Y A;  5JCK A;  5GSN A;  1PHH A;  4Q5B A;  1GU6 A;  1F8S A;  5KMS A;  2BS2 A;  3LAD A;  3UKQ A;  3UOX A;  4H4Y A;  4YSZ A;  4Z2U A;  3DJG X;  4GAV A;  2C73 A;  2GF3 A;  1HYU A;  1E1L A;  4H4P A;  4IVM B;  4NTE A;  5HHF A;  1GTH A;  4K22 A;  4DSG A;  1ZMC A;  3CGC A;  3UP4 A;  3P4P A;  3T2K A;  1FS7 A;  1F8R A;  3D1I A;  1GTE A;  2XLS A;  2ZZ0 A;  3CN8 A;  1ZOV A;  3M0O A;  3FO3 A;  2E1M A;  4WCT A;  2C65 A;  1GRB A;  3SXI A;  1L9C A;  2R0C A;  1KFY A;  5C3J A;  3GM6 A;  1GV4 A;  1LVL A;  1ZDL A;  3IHM A;  2B9Y A;  2WP9 A;  3T2Y A;  1KNP A;  2CVJ A;  3DGZ A;  3RP6 A;  2WDQ A;  2X8C A;  3KU9 A;  4EQX A;  5JCL A;  2YR6 A;  3LG1 A;  3CPH G;  3PVC A;  4EMI A;  3UOZ A;  1AOG A;  3NNE A;  3D1C A;  4AP1 A;  4BV6 A;  1YY5 A;  2NPX A;  5J7X A;  2C75 A;  4I59 A;  2WHD A;  1E1M A;  2ZZB A;  3AE6 A;  1CJC A;  4HB9 A;  2GR3 A;  3UKA A;  2OA1 A;  3UTE A;  2AR8 A;  1E39 A;  3DH9 A;  1ZMD A;  4O5U A;  4M52 A;  3KPF A;  3R9U A;  1X31 B;  5BUK A;  4IA5 A;  5HXI A;  3SZ0 A;  3AD7 B;  4UDR A;  1JRY A;  1H86 A;  3S7W A;  1IUV A;  4JY3 A;  3K7M X;  3WE0 A;  1TRB A;  1W4X A;  4YSY A;  3S5W A;  3UKK A;  1VG0 A;  4U8N A;  2V3B A;  1Q1R A;  3NHO X;  3ZDN A;  2X3N A;  2XVF A;  3IWA A;  4Z2T A;  2VVL G;  3KVE A;  1NEK A;  3NK1 X;  4Y4L A;  1PBD A;  1DOB A;  4H2P A;  3URH A;  2XVI A;  2OT4 A;  3SZW A;  3AWI A;  4BK3 A;  2E80 A;  4OPU A;  4Q4U A;  4C74 A;  5JCM A;  5KWF A;  2VR0 A;  2YQU A;  3OWM A;  2XLU A;  2GR2 A;  3ALM A;  4FK1 A;  4ZCC A;  3UKL A;  4IV9 A;  3T37 A;  5HY5 A;  5LV9 A;  3C4N A;  1BWC A;  4X4J A;  2VZ2 A;  3TOR A;  5U1O A;  3SGL A;  4EMJ A;  4K5R A;  4H4U A;  1TDF A;  4TM1 A;  3UTF A;  4YSX A;  1N4V A;  2RDZ A;  3AE8 A;  1TYT A;  3MMO A;  3OZ2 A;  1GOS A;  3JSK A;  3VQR A;  3LZX A;  3KPK A;  3QVP A;  3AYJ A;  4JDR A;  1REO A;  1KSU A;  3F8P A;  5KMQ A;  1E1K A;  3K7Q X;  1VG9 A;  2V5Z A;  4G74 A;  1FT5 A;  1FCD A;  3C96 A;  2GQW A;  4U8J A;  1D5T A;  1NHP A;  2WPF A;  3NKS A;  4P9S A;  3G5R A;  2E4G A;  2GMH A;  5M0Z A;  1YQ4 A;  1UKV G;  5HYM A;  2C66 A;  1D7L A;  3CGD A;  2B9W A;  2WPC A;  4U8I A;  2V61 A;  5FS7 A;  1GEU A;  3AB1 A;  3AE9 A;  4D03 A;  1DOC A;  1FEC A;  3B6D A;  2WOI A;  1N4W A;  1CJ2 A;  2XVH A;  3M13 A;  1O5W A;  4CCR A;  4YXD A;  1S2Q A;  3NN6 X;  1GPE A;  2V60 A;  3AD9 B;  4G73 A;  4APN A;  1P2H A;  1DOD A;  3E1T A;  4FK1 C;  3KKJ A;  1EL7 A;  1TDK A;  2IID A;  1RP0 A;  2JB3 A;  2X8H A;  3LB8 A;  3L1T A;  4U2L A;  3NN0 X;  2TPR A;  3H8I A;  5FMH A;  4AP3 A;  3AYI A;  2YLW A;  2GH5 A;  3GDN A;  1LQU A;  2JKC A;  2ZBW A;  3ICS A;  3KA7 A;  2RGO A;  2R4E A;  5KXJ A;  1L9E A;  1JNZ A;  1Y56 A;  2XLR A;  4L38 A;  4H4R A;  4GDE A;  2XVJ A;  2GR1 A;  1K0L A;  3AEF A;  1PDH A;  2A8X A;  4J34 A;  1YQ3 A;  3AE7 A;  3ALJ A;  1M64 A;  1ZP0 A;  3GRS A;  3ALL A;  3AD8 B;  4H4S A;  4GRT A;  2H88 A;  3DK4 A;  3UKF A;  3L8K A;  2ARD A;  3CGE A;  3ATR A;  2LFC A;  3AXB A;  2YVF A;  3AE1 A;  3P4Q A;  1GXF A;  2BA9 A;  2C70 A;  1E6E A;  4GR1 A;  3Q6J A;  5EBK A;  5EB5 A;  3F29 A;  4JY2 A;  4ADW A;  3QSS A;  4G6G A;  2PYX A;  2YLR A;  2Z5X A;  4UDP A;  4YWO A;  4Q0T A;  3GMB A;  1JOA A;  1FOH A;  5FS6 A;  1QJD A;  4UDQ A;  2YLT A;  3ISH A;  4II2 A;  4Q17 A;  4EIP A;  2RAB A;  4YTN A;  2YLX A;  2JBV A;  2E81 A;  3BNF A;  1GRF A;  2C3D A;  3AEG A;  3CNP A;  4B63 A;  2WBA A;  1GRE A;  3UCL A;  3FMW A;  2A87 A;  3CMM A;  3UKP A;  2BXS A;  5IPY A;  5BUL A;  1OJD A;  5CKU A;  5KOW A;  4RG4 A;  2JB2 A;  2BS3 A;  2BK5 A;  5JCI A;  3SX6 A;  3CIR A;  4NTD A;  3GSI A;  2C7G A;  4OVI A;  3II4 A;  4H4Q A;  3BNH A;  3BHK A;  4LU6 A;  1DJQ A;  3G5Q A;  2B9X A;  1O94 A;  4Z43 A;  5FS8 A;  4TM4 A;  1CJ4 A;  1CL0 A;  3OC4 A;  4JN9 A;  4Z26 A;  1N1P A;  1K0J A;  3UP5 A;  3ADA B;  5KMP A;  4J31 A;  4U8M A;  4A99 A;  2WOV A;  1M1R A;  1ELI A;  1S3B A;  3I3L A;  4H7U A;  4OPG A;  1MO9 A;  4H2R A;  4FX9 A;  3T31 A;  3VR9 A;  2YG6 A;  4EM4 A;  3RKH A;  2YWL A;  3BHF A;  3NH3 X;  5GRT A;  3QSM A;  1E1N A;  1LJ1 A;  2JAE A;  1Q9I A;  2I0Z A;  2Q0L A;  3ITJ A;  5IQ1 A;  4CNJ A;  2GMJ A;  1ZY8 A;  1B8S A;  2RGJ A;  4U8O A;  2F5Z A;  1NPX A;  4OCG A;  4CRT A;  2AQJ A;  3RED A;  1DXL A;  1BGN A;  1E7P A;  2R46 A;  2Q6U A;  4Q5C A;  5ER0 A;  4PAB A;  4YKG A;  2YVJ A;  1M1P A;  1IUU A;  1H7W A;  2JB1 A;  3RNM A;  3I6D A;  2ZZC A;  3AEC A;  3LZW A;  4J36 A;  4HA6 A;  3NK2 X;  4U8K A;  1CHU A;  2XYO A;  3HYV A;  4ZCD A;  1CF3 A;  1F6M A;  3AEB A;  4B64 A;  3VRB A;  5M10 A;  1PBC A;  3K7T A;  1XHC A;  2CUL A;  4A5L A;  2R9Z A;  4AOX A;  4JQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...