1E39A

Flavocytochrome c3 from shewanella frigidimarina histidine 365 mutated to alanine
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAAPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
publication title Identification of the Active Site Acid/Base Catalyst in a Bacterial Fumarate Reductase: A Kinetic and Crystallographic Study
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 196
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1e39A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1e39A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1e39A01
2O9ZA 4REKA 2ZZCA 3GM6A 1NENA 3ITJA 4YSZA 3NIXA 1IUVA 4JY2A 1H7XA 2WQYA 4U8OA 5BUKA 2V61A 4P9SA 4I58A 4C3YA 2WP5A 1H84A 2YG7A 3AD8B 2B7RA 2YR5A 4XWRA 4Z25A 2GRTA 4FK1A 2E4GA 4JN9A 2CULA 5JCLA 1E7PA 3SCEA 4RSLA 1MXTA 1BGNA 4CNKA 4E0VA 5HHFA 4B68A 4IA6A 1GERA 2WPEA 2JK6A 3LB8A 2C70A 1Q9IA 4EIQA 4H4PA 2J3NA 3IHGA 1HYUA 4U8MA 5FMHA 4BV6A 2V3BA 2PHHA 1PXBA 3AEBA 3RHAA 1CJ3A 1E6EA 2H88A 1M64A 2YQUA 4NTDA 3NTAA 3RNMA 2A87A 3QVRA 1B5QA 3M0OA 1OJTA 1H83A 3VR8A 5LV9A 4A6NA 2OA1A 4DSGA 4CRTA 3R9UA 1YQ4A 1PN0A 2Z5YA 4ZCDA 1E1LA 1RP0A 3KPFA 5EOWA 3IF9A 4Z24A 3NYFA 4NEWA 4ECHA 4USRA 2X8HA 1LTXR 3UKPA 1H6VA 3ISHA 3UKFA 1PJ7A 2XDOA 2BC1A 5HXIA 3GWFA 2YR4A 2BS2A 2XFQA 1LVLA 3KU9A 3VR9A 1YKJA 2Q0KA 3KVEA 3EAOA 1XDIA 1EBDA 2XLSA 3UOZA 1QDBA 3CGBA 2BXRA 4B64A 3AE7A 4Z44A 3V3NA 4EM4A 5J60A 3QSEA 3UCLA 3P9UA 2BK5A 3Q6JA 3F8PA 3H8LA 5IQ4A 1GNDA 3FBSA 4FX9A 2OLNA 3V3OA 1TDOA 2VZ2A 3P4QA 5BULA 1BKWA 2BS4A 1COYA 1M1PA 4GCMA 1W4XA 4APNA 3DK8A 2K3VA 1CC2A 4AP1A 2GAHB 1O94A 1VRQB 4AOXA 4ADWA 1L9EA 1EL9A 1QO8A 3LZWA 4OPIA 3KD9A 1LV0A 2IVEA 3H4KA 5CKUA 1QJDA 1CC6A 2YG6A 3NK2X 1D7LA 1RSGA 1IUWA 1XPQA 4Q17A 3BHFA 2BK4A 4K2XA 4OPLA 4XWZA 3SM8A 5JCMA 4AP3A 2GF3A 3NRNA 4LIIA 1H7WA 4M52A 3ATRA 1KSUA 1L0VA 3F8RA 4JDRA 1N4WA 1TYPA 2YLRA 4A79A 4BK2A 4TLXA 4X9MA 2C66A 4NTEA 4USQA 5KVHA 1GSNA 4OPCA 1REOA 1NG3A 4Q5BA 1KNPA 1PBEA 1QLBA 3IC9A 4DSHA 4GDPA 3BNFA 3L8KA 5JCIA 4OPGA 2CVJA 2WEUA 2WOIA 3AEDA 3EF6A 4A6NB 2X8CA 1IUUA 4H4UA 3KA7A 4Q0TA 5IQ1A 2C3DA 1E1MA 3RKHA 3C4NA 1H86A 3AE6A 4EMWA 5M10A 1DNCA 2BC0A 1NHSA 4H4YA 2BXSA 2XFPA 4OPDA 3LOVA 2QA1A 1D7YA 2BCGG 1LQTA 3GYIA 1N1PA 2BK3A 1JNIA 5GRTA 4H4TA 1AOGA 5JCNA 4A99A 5KWFA 1X31B 3NG7X 4O5UA 1PHHA 3JSKA 4UDRA 4MJWA 3DH9A 4EQSA 2OALA 4N9XA 2XVHA 4YSYA 4AT0A 3H8IA 3GRSA 5BVAA 2EQ8A 3FMWA 2OLOA 2VVLA 3I6DA 2OT4A 3ZDNA 1BVBA 1CJCA 1VDCA 2E81A 2HQMA 2VRMA 2E80A 1CJ2A 2WOWA 3FG2P 3ADAB 2YVGA 5FS9A 3AB1A 3CPIG 3NYEA 2R4JA 1JNRA 2XFUA 1RYIA 3AE5A 3DA1A 1SEZA 2WDRA 2FJBA 2R46A 1TYTA 3CPHG 2AAQA 2EQ7A 2FJAA 3MMOA 3BNMA 3OZ2A 3V76A 3UOXA 3PVCA 4A5LA 2Y6QA 3EANA 2GMHA 1JOAA 2YVJA 2C72A 2E1MA 2FBWA 1CC4A 1Q1WA 2WOVA 4K7ZA 3RP8A 4NEVA 5J7XA 1PDHA 2A89A 2YG4A 1YY5A 4TM3A 1FL2A 4WJYA 4PAAA 4GF7A 3E1TA 2E5VA 5KVIA 4UDQA 1P2EA 1KNRA 4EQXA 3AEEA 4NZHA 3KKJA 1TDNA 2Q6UA 3AE3A 4JNQA 2YVFA 4D04A 4EQWA 3Q9TA 1NDAA 4U2SA 3AE2A 3P1WA 1JU2A 3S61A 4B69A 4U8JA 1FOHA 2APGA 3L1TA 3AD9B 2C3CA 3AXBA 3FIMB 3ICSA 4Q4UA 3COXA 4YTNA 3I3LA 2ZZBA 2XFNA 2XVIA 3BI5A 2AQJA 4EMIA 4H4VA 2YM2A 4H4RA 1FS9A 3NNEA 1NAAA 2R0GA 2JB2A 2V6OA 4J31A 1ZOYA 1ONFA 3QFAA 3BI4A 1ZDLA 2GR1A 5M0ZA 3VRDB 1KFYA 1PBBA 1IUTA 1FT6A 3QVPA 2GR0A 3BI2A 2WU2A 4Z2UA 1K0JA 1JRYA 4J33A 3VQRA 4ICYA 4UDPA 3NGCX 4H4QA 2GV8A 3K7MX 3NHOX 1GV4A 4FK1C 3VRAA 1GRGA 3UKKA 1D4EA 1E1NA 2AR8A 2F5ZA 4H7UA 4C77A 2X50A 2R4EA 3D1CA 3QFBA 3CPJG 3AE4A 3DGHA 4UP3A 1S3EA 4H4SA 4EM3A 2YLXA 4IA5A 3BNJA 2GQWA 4H4WA 1O95A 2FJDA 3GSIA 4L38A 3NH3X 1NG4A 2VQBA 3K30A 2XLPA 1NPXA 1B8SA 2B76A 3BHKA 5TR3A 3GD4A 1D4DA 2V3AA 5FS7A 2B7SA 1MO9A 2XLTA 1ZMDA 1ZMCA 3AE8A 3S5WA 1ZX9A 1DOEA 1OJCA 1FEBA 3NLCA 1JEHA 2QAEA 3CIRA 1L9CA 3VRBA 3ALLA 4DNAA 1SP3A 1FS7A 3GMBA 1TDFA 1DODA 3ATQA 1ZKQA 3ICTA 3L1RA 3PO7A 4GDEA 4L3ZA 3LXDA 3SGLA 4YSXA 2VOUA 3DGZA 3P4PA 4IVMB 2WU5A 4J2WA 2GR3A 2XFOA 3AYIA 5U63A 3T37A 1DOCA 2WP6A 3UU9A 2YAUA 4Y4NA 2YWLA 2GB0A 3ICRA 4AOSA 2WESA 3UTEA 1PBCA 2JB1A 5GSNA 2RGJA 3CN8A 4HB9A 3BNHA 3NYCA 4CCRA 3GRTA 3UOVA 3UTHA 4B66A 1F8WA 3UP4A 3LGQA 4YT0A 4GR1A 4TM4A 1OJ9A 3NKSA 3SFDA 2X3NA 3QJ4A 2RGHA 5FS6A 4YTPA 3LG1A 2VVLG 2C75A 3AYJA 1NEKA 4J56A 4H2RA 1B37A 3C4AA 3ABVA 2TPRA 3M13A 1DJNA 2GAGB 4J36A 3QSMA 4TM0A 4X4JA 1VG0A 1H82A 4RG3A 3D1IA 1DJQA 5KOXA 2ZZ0A 2ARDA 2VR0A 4BK3A 1DOBA 1F8SA 5HY5A 1CBOA 2XLUA 2WP9A 3IWAA 3F29A 1K0IA 3ALMA 1LPFA 4L3XA 3UBRA 2EQ9A 4LU6A 4TLZA 1LJ1A 1FECA 4B65A 4C5OA 3G5QA 4Z43A 1PXCA 1CJ4A 2YLWA 4FDCB 5U25A 1ZK7A 3AEGA 3GYJA 3LADA 1GXFA 4CNJA 3G5RA 2YR6A 4YWOA 3CGCA 1EL8A 2WHDA 2OAMA 1PBFA 2GQFA 2YLTA 1BWCA 2B9WA 3SXQA 3CNDA 2NPXA 4CCQA 1NHPA 1GU6A 3G5SA 3RP7A 3DJGX 2RGOA 3IHMA 4H2NA 2IIDA 2C65A 4H2PA 3P4SA 5FS8A 5KXJA 5ER0A 2LFCA 3CNSA 1OJAA 2YLZA 4JNAA 3AE9A 3K7QX 2CDUA 1V59A 5U1OA 4AT2A 4HA6A 4B1BA 1Y0PA 2UZZA 2NVKX 1K0LA 2XLRA 3GD3A 4Z2RA 5KRQA 1FS8A 1GALA 3AECA 3CTYA 4K22A 4X9NA 4U8LA 1LQUA 4EMJA 2R0CA 3DJJA 1IUXA 1H81A 1M1QA 2TMDA 3AE1A 4Y4LA 1Y56A 5DBJA 4Y4MA 2BYBA 3DJEA 3AD7B 4BJZA 1CHUA 2Z5XA 1N4VA 2RABA 1NHQA 2VQ7A 4U8KA 3UTGA 4EQRA 2WBAA 2J7AA 5JCKA 1GTHA 3UKLA 4BURA 3CNJA 2WS3A 1FEAA 4A9WA 1IUSA 3CNTA 4B63A 5KOWA 2B9YA 1Q1RA 1ZY8A 1IJHA 2EQ6A 1EL5A 1E39A 3ZYXA 2R0PA 1PJ6A 5EB4A 3NK0X 1EL7A 5HYMA 1GRTA 3O0HA 3SQPA 3FO3A 3DMEA 4L3YA 3UP5A 2ACZA 1JNZA 1XANA 2BS3A 2YG3A 3II4A 5EB5A 4OVIA 1GT8A 1PXAA 4C3XA 3ALJA 4I59A 3NT6A 4LA1A 4Z2TA 5L46A 3AEAA 2WDVA 2H89A 2X99A 1XHCA 2WPCA 4OPUA 5IPYA 2ZBWA 2BCPA 4DGKA 2Q0LA 4KX6A 3CGDA 2V60A 4K5SA 2C67A 3LZXA 4NTCA 1GRFA 2RF7A 3GWDA 2DKHA 1D5TA 3OC4A 2YG5A 1TDEA 1YQ3A 2GVCA 1PBDA 2GEWA 3P4RA 1PS9A 3DK4A 1FT5A 1CF3A 3BNUA 2QA2A 4YKFA 3UKHA 1UKVG 2JKCA 3BNGA 4U2LA 4IVOB 2C76A 1N4UA 4EIPA 2V5ZA 3KLJA 2R9ZA 3WE0A 3OWMA 2XYOA 3TTBA 2JB3A 4JY3A 3K7TA 3LJPA 1BZLA 3C96A 1BF3A 2YM1A 4YKGA 3REDA 4H50A 1S2YA 3DJDA 1Y56B 1OAHA 2VVMA 1BGJA 5C3JA 2GH5A 1GESA 2WDQA 4IV9A 2R45A 4CY6A 3GDPA 2A8XA 2VRLA 4K8DA 1L9DA 2BACA 2FJEA 4BJYA 4H2QA 2QCUA 2WETA 3CNPA 1NHRA 1OJDA 3DK9A 1S3BA 5C2TA 2XVJA 1F3PA 1ZOVA 1D4CA 4GUVA 2WPFA 1JRXA 1B4VA 3AYLA 1S2QA 4JQ9A 4OCGA 2X8GA 4RG4A 4KPRA 4U8IA 3FPZA 4U2TA 1F8RA 5EBKA 1E1KA 3UKQA 3NN0X 4XXGA 4U8PA 3F8DA 3GYXA 4ZCCA 4U8NA 1GEUA 2B9XA 2RDZA 4TM1A 2Q7VA 3AWIA 4A7AA 4J34A 4H4XA 1MOKA 3QSSA 1ZP0A 1TDKA 2IVDA 1GTEA 3M12A 4WCTA 1O5WA 2JBVA 2W0HA 1GRBA 3SFEA 3B6DA 5CQFA 3URHA 4C74A 1M1RA 4CY8A 4Z26A 1CL0A 3D8XA 4YSHA 2JAEA 3EPTA 3NK1X 3HZLA 3PS9A 2BABA 1GPEA 1DXLA 1TRBA 3GMCA 2GR2A 3RP6A 1GETA 4YTMA 1P2HA 2ZO5A 4J57A 1FCDA 3UOYA 1K4QA 4K5RA 3NTDA 4H4ZA 4OPTA 3UTFA 1KSSA 3B3RA 1GREA 4GRTA 2C7GA 2XVFA 2Y6RA 3UKAA 1KDGA 2DKIA 2C64A 3TORA 2GMJA 4A65A 2C73A 4Q5CA 4CBQA 4Q1OA 1GOSA 2BA9A 1PJ5A 4BK1A 3CGEA 2YLSA 3GDNA 4YXDA 2XVEA 2XCGA 4O5QA 3S7WA 4D03A 1ELIA 3NN6X 1JRZA 1GRAA 1F6MA 1KF6A 4B67A 1Z6LA 2PYXA 1VQWA 1GRHA 1YQZA 4PABA 4ZN0A 1VG9A 3AEFA 5BRTA 1M6IA 4WX1A 2CFYA 2I0ZA
chains in the Genus database with same CATH superfamily
2O9ZA 4REKA 2ZZCA 3GM6A 1NENA 3ITJA 4YSZA 3NIXA 3T31A 1IUVA 4JY2A 1H7XA 2WQYA 4U8OA 5BUKA 2V61A 4P9SA 4I58A 4C3YA 2WP5A 1H84A 2YG7A 3AD8B 2B7RA 2YR5A 4XWRA 4Z25A 2GRTA 4FK1A 2E4GA 4JN9A 2CULA 5JCLA 1E7PA 3SCEA 4RSLA 1MXTA 1BGNA 4CNKA 4E0VA 5HHFA 4B68A 4IA6A 1GERA 2WPEA 2JK6A 3LB8A 2C70A 1Q9IA 4EIQA 4H4PA 2BRAA 2J3NA 3IHGA 1HYUA 4U8MA 5FMHA 4BV6A 2V3BA 2PHHA 1PXBA 3AEBA 3RHAA 1CJ3A 1E6EA 2H88A 1M64A 2YQUA 4NTDA 3NTAA 3RNMA 2A87A 3QVRA 1B5QA 3M0OA 1OJTA 1H83A 3VR8A 5LV9A 4A6NA 2OA1A 4DSGA 4CRTA 3R9UA 1YQ4A 1PN0A 2Z5YA 4ZCDA 1E1LA 1RP0A 3KPFA 5EOWA 3IF9A 4Z24A 3NYFA 4NEWA 4ECHA 4USRA 2X8HA 1LTXR 3UKPA 1H6VA 3ISHA 3UKFA 1PJ7A 2XDOA 2BC1A 5HXIA 3GWFA 2YR4A 2BS2A 2XFQA 1LVLA 3KU9A 3VR9A 1YKJA 2Q0KA 3KVEA 3EAOA 1XDIA 1EBDA 2XLSA 3UOZA 1QDBA 3CGBA 2BXRA 4B64A 3AE7A 4Z44A 3V3NA 4EM4A 5J60A 3QSEA 3SZWA 3UCLA 3P9UA 2BK5A 3Q6JA 3F8PA 3H8LA 5IQ4A 1GNDA 3FBSA 4FX9A 2OLNA 3V3OA 1TDOA 2VZ2A 3P4QA 5BULA 1BKWA 2BS4A 1COYA 1M1PA 4GCMA 1W4XA 4APNA 3DK8A 2K3VA 1CC2A 4AP1A 2GAHB 1O94A 1VRQB 4AOXA 4ADWA 1L9EA 1EL9A 1QO8A 3LZWA 4OPIA 3KD9A 1LV0A 2IVEA 3H4KA 5CKUA 1QJDA 1CC6A 2YG6A 3NK2X 1D7LA 1RSGA 1IUWA 1XPQA 4Q17A 3BHFA 2BK4A 4K2XA 3HYWA 4OPLA 4XWZA 3SM8A 5JCMA 3SZ0A 4AP3A 2GF3A 3NRNA 4LIIA 5KMRA 1H7WA 4M52A 3ATRA 1KSUA 1L0VA 3F8RA 4JDRA 1N4WA 1TYPA 2YLRA 4A79A 4BK2A 4TLXA 4X9MA 2C66A 4NTEA 4USQA 5KVHA 1GSNA 4OPCA 1REOA 1NG3A 4Q5BA 1KNPA 4NWZA 1PBEA 1QLBA 3IC9A 4DSHA 4GDPA 3BNFA 3L8KA 5JCIA 4OPGA 2CVJA 2WEUA 2WOIA 3AEDA 3EF6A 4A6NB 2X8CA 1IUUA 4H4UA 3KA7A 4Q0TA 5IQ1A 2C3DA 1E1MA 3RKHA 3C4NA 1H86A 3AE6A 4EMWA 5M10A 1DNCA 2BC0A 1NHSA 4H4YA 2BXSA 2XFPA 4OPDA 3LOVA 2CZSA 1D7YA 2QA1A 2BCGG 1LQTA 3GYIA 1N1PA 2BK3A 1JNIA 5GRTA 4H4TA 1AOGA 5JCNA 4A99A 5KWFA 1X31B 3NG7X 4O5UA 1PHHA 3JSKA 4UDRA 4MJWA 3DH9A 4EQSA 2OALA 4N9XA 2XVHA 4YSYA 4AT0A 3H8IA 3GRSA 5BVAA 2EQ8A 3FMWA 2OLOA 2VVLA 3I6DA 2OT4A 3ZDNA 1BVBA 1CJCA 1VDCA 2E81A 2HQMA 2VRMA 2E80A 1CJ2A 2WOWA 3FG2P 3ADAB 2YVGA 5FS9A 3AB1A 3CPIG 3NYEA 2R4JA 1JNRA 2XFUA 1RYIA 3AE5A 3DA1A 1SEZA 2WDRA 2FJBA 2R46A 1TYTA 3CPHG 2AAQA 2EQ7A 2FJAA 3MMOA 3BNMA 3OZ2A 3V76A 3UOXA 3PVCA 4A5LA 2Y6QA 3EANA 2GMHA 1JOAA 2YVJA 2C72A 2E1MA 2FBWA 1CC4A 1Q1WA 2WOVA 4K7ZA 3RP8A 4NEVA 5J7XA 4G73A 1PDHA 2A89A 2YG4A 1YY5A 4TM3A 1FL2A 4WJYA 4PAAA 4GF7A 3E1TA 2E5VA 5KVIA 4UDQA 5KMQA 1P2EA 1KNRA 4EQXA 3AEEA 4NZHA 3KKJA 1TDNA 2Q6UA 3AE3A 4JNQA 2YVFA 4D04A 4EQWA 3Q9TA 1NDAA 4U2SA 3AE2A 3P1WA 1JU2A 3S61A 4B69A 4U8JA 1FOHA 2APGA 3L1TA 3AD9B 3HYXA 2C3CA 3AXBA 3FIMB 3ICSA 4Q4UA 3COXA 4YTNA 3I3LA 2ZZBA 2XFNA 2XVIA 3BI5A 2AQJA 4EMIA 5KMSA 4H4VA 2YM2A 4H4RA 1FS9A 3NNEA 1NAAA 2R0GA 4NNJA 2JB2A 2V6OA 4J31A 1ZOYA 1ONFA 3QFAA 3BI4A 1ZDLA 2GR1A 5M0ZA 3VRDB 1KFYA 1PBBA 1IUTA 1FT6A 3QVPA 2GR0A 3BI2A 2WU2A 4Z2UA 1K0JA 5KMPA 1JRYA 4J33A 3VQRA 4ICYA 4UDPA 3NGCX 4H4QA 2GV8A 3K7MX 3NHOX 1GV4A 4FK1C 3VRAA 1GRGA 3UKKA 1D4EA 1E1NA 2AR8A 2F5ZA 4H7UA 4C77A 2X50A 2R4EA 3D1CA 3QFBA 3SY4A 3CPJG 3AE4A 3DGHA 4UP3A 1S3EA 4H4SA 4EM3A 2YLXA 4IA5A 3BNJA 2GQWA 4H4WA 1O95A 3T14A 2FJDA 3GSIA 4L38A 3NH3X 1NG4A 2VQBA 3K30A 2XLPA 1NPXA 1B8SA 2B76A 3BHKA 5TR3A 3HYVA 3GD4A 1D4DA 2V3AA 3T2KA 5FS7A 2B7SA 1MO9A 2XLTA 1ZMDA 1ZMCA 3AE8A 3S5WA 1ZX9A 1DOEA 1OJCA 1FEBA 3NLCA 3SZCA 1JEHA 2QAEA 3CIRA 1L9CA 3VRBA 3ALLA 4DNAA 1SP3A 1FS7A 3GMBA 1TDFA 1DODA 3ATQA 1ZKQA 3ICTA 3L1RA 3PO7A 4GAPA 4GDEA 4L3ZA 3LXDA 3SGLA 4YSXA 2VOUA 3DGZA 3P4PA 4IVMB 2WU5A 4J2WA 2GR3A 2XFOA 3AYIA 5U63A 3T37A 1DOCA 2WP6A 3UU9A 2YAUA 4Y4NA 2YWLA 2GB0A 3ICRA 4AOSA 2WESA 3UTEA 1PBCA 2JB1A 5GSNA 2RGJA 3CN8A 4HB9A 3BNHA 3NYCA 4CCRA 3GRTA 3UOVA 3UTHA 4B66A 1F8WA 3UP4A 3LGQA 4YT0A 4GR1A 4TM4A 1OJ9A 3NKSA 3SFDA 2X3NA 3QJ4A 2RGHA 5FS6A 4YTPA 3LG1A 2VVLG 2C75A 3AYJA 1NEKA 4J56A 4H2RA 1B37A 3C4AA 3ABVA 2TPRA 3M13A 1DJNA 2GAGB 4J36A 3QSMA 4TM0A 4X4JA 1VG0A 1H82A 4RG3A 3D1IA 1DJQA 5KOXA 2ZZ0A 2ARDA 2VR0A 4BK3A 1DOBA 1F8SA 5HY5A 1CBOA 2XLUA 2WP9A 3IWAA 3F29A 1K0IA 3ALMA 1LPFA 4L3XA 3UBRA 2EQ9A 4LU6A 4TLZA 4G74A 1LJ1A 1FECA 4B65A 4C5OA 3G5QA 4Z43A 1PXCA 1CJ4A 2YLWA 4FDCB 5U25A 1ZK7A 3AEGA 3GYJA 3LADA 1GXFA 4CNJA 3G5RA 2YR6A 4YWOA 3CGCA 1EL8A 2WHDA 2OAMA 1PBFA 2GQFA 2YLTA 1BWCA 2B9WA 3SXQA 3CNDA 2NPXA 4CCQA 1NHPA 1GU6A 3G5SA 3RP7A 3DJGX 2RGOA 3IHMA 4H2NA 2IIDA 2C65A 4H2PA 3P4SA 5FS8A 5KXJA 5ER0A 2LFCA 3CNSA 1OJAA 2YLZA 4JNAA 3AE9A 3K7QX 2CDUA 1V59A 5U1OA 4AT2A 4HA6A 4B1BA 1Y0PA 2UZZA 2NVKX 1K0LA 2XLRA 3GD3A 4Z2RA 5KRQA 1FS8A 1GALA 3AECA 3CTYA 4K22A 3SX6A 4X9NA 4U8LA 1LQUA 4EMJA 2R0CA 3DJJA 1IUXA 2BRYA 3SYIA 1H81A 1M1QA 2TMDA 3AE1A 4Y4LA 1Y56A 5DBJA 4Y4MA 2BYBA 3DJEA 3AD7B 4BJZA 1CHUA 2Z5XA 1N4VA 2RABA 1NHQA 2VQ7A 4U8KA 3UTGA 4EQRA 2WBAA 2J7AA 5JCKA 1GTHA 3UKLA 4BURA 3CNJA 2WS3A 1FEAA 4A9WA 1IUSA 3CNTA 4B63A 5KOWA 2B9YA 1Q1RA 1ZY8A 1IJHA 2EQ6A 1EL5A 1E39A 3ZYXA 2R0PA 1PJ6A 5EB4A 3NK0X 1EL7A 3SZFA 5HYMA 1GRTA 3O0HA 3SQPA 3FO3A 3DMEA 4L3YA 3UP5A 2ACZA 1JNZA 1XANA 2BS3A 2YG3A 3II4A 5EB5A 5KNLA 4OVIA 1GT8A 1PXAA 4C3XA 3ALJA 4I59A 3NT6A 4LA1A 4Z2TA 5L46A 3AEAA 2WDVA 2H89A 2X99A 1XHCA 2WPCA 4OPUA 3SXIA 5IPYA 2ZBWA 2BCPA 4DGKA 2Q0LA 4II2A 4KX6A 3CGDA 2V60A 2C4CA 4K5SA 2C67A 3LZXA 4NTCA 1GRFA 2RF7A 3GWDA 2DKHA 1D5TA 3OC4A 2YG5A 1TDEA 1YQ3A 2GVCA 1PBDA 2GEWA 3P4RA 1PS9A 3DK4A 1FT5A 1CF3A 3BNUA 2QA2A 4YKFA 3UKHA 1UKVG 2JKCA 3BNGA 4U2LA 4IVOB 2C76A 1N4UA 4EIPA 2V5ZA 3KLJA 2R9ZA 3WE0A 3OWMA 4G6GA 2XYOA 3TTBA 2JB3A 4G9KA 3K7TA 3LJPA 4JY3A 1BZLA 3C96A 1BF3A 2YM1A 4YKGA 3REDA 4H50A 1S2YA 3DJDA 1Y56B 1OAHA 2VVMA 1BGJA 5C3JA 2GH5A 1GESA 2WDQA 4IV9A 2R45A 4CY6A 3GDPA 2A8XA 2VRLA 4K8DA 1L9DA 2BACA 2FJEA 4BJYA 4H2QA 2QCUA 2WETA 3CNPA 1NHRA 1OJDA 3DK9A 1S3BA 5C2TA 2XVJA 1F3PA 1ZOVA 1D4CA 4GUVA 2WPFA 3T0KA 1JRXA 1B4VA 3AYLA 1S2QA 4JQ9A 4OCGA 2X8GA 4RG4A 4KPRA 4U8IA 3FPZA 4U2TA 1F8RA 5EBKA 1E1KA 3UKQA 3NN0X 4XXGA 4U8PA 3F8DA 3GYXA 4ZCCA 4U8NA 1GEUA 2B9XA 2RDZA 4TM1A 2Q7VA 3AWIA 3T2YA 4A7AA 4J34A 4H4XA 1MOKA 3QSSA 1ZP0A 1TDKA 2IVDA 1GTEA 3M12A 4WCTA 1O5WA 2JBVA 2W0HA 1GRBA 3T2ZA 3SFEA 3B6DA 5CQFA 3URHA 4C74A 1M1RA 4CY8A 4Z26A 4G6HA 1CL0A 3D8XA 4YSHA 2JAEA 3EPTA 3NK1X 3HZLA 3PS9A 2BABA 1GPEA 1DXLA 1TRBA 3GMCA 2GR2A 3RP6A 1GETA 4YTMA 1P2HA 2ZO5A 4J57A 1FCDA 3KPKA 1K4QA 4K5RA 3NTDA 4H4ZA 4OPTA 3UOYA 1KSSA 3UTFA 3B3RA 1GREA 4GRTA 2C7GA 2XVFA 2Y6RA 3UKAA 1KDGA 2DKIA 2C64A 3TORA 2GMJA 4A65A 2C73A 4Q5CA 4CBQA 4Q1OA 1GOSA 2BA9A 1PJ5A 4BK1A 3CGEA 3CMMA 2YLSA 3GDNA 4YXDA 2XVEA 4II3A 2XCGA 4O5QA 3S7WA 4GAVA 4D03A 1ELIA 3NN6X 1JRZA 1GRAA 1F6MA 1KF6A 4B67A 1Z6LA 2PYXA 1VQWA 1GRHA 1YQZA 4PABA 4ZN0A 1VG9A 3AEFA 5BRTA 1M6IA 4WX1A 2CFYA 2I0ZA
chains in the Genus database with same CATH topology
2O9ZA 4REKA 2ZZCA 3GM6A 1NENA 3ITJA 4YSZA 3NIXA 3T31A 1IUVA 4JY2A 1H7XA 2WQYA 4U8OA 5BUKA 2V61A 4P9SA 4I58A 4C3YA 2WP5A 1H84A 2YG7A 3AD8B 2B7RA 2YR5A 4XWRA 4Z25A 2GRTA 4FK1A 2E4GA 4JN9A 2CULA 5JCLA 1E7PA 3SCEA 4RSLA 1MXTA 1BGNA 4CNKA 4E0VA 5HHFA 4B68A 4IA6A 1GERA 2WPEA 2JK6A 3LB8A 2C70A 1Q9IA 4EIQA 4H4PA 2BRAA 2J3NA 3IHGA 1HYUA 4U8MA 5FMHA 4BV6A 2V3BA 2PHHA 1PXBA 3AEBA 3RHAA 1CJ3A 1E6EA 2H88A 1M64A 2YQUA 4NTDA 3NTAA 3RNMA 2A87A 3QVRA 1B5QA 3M0OA 1OJTA 1H83A 3VR8A 5LV9A 4A6NA 2OA1A 4DSGA 4CRTA 3R9UA 1YQ4A 1PN0A 2Z5YA 4ZCDA 1E1LA 1RP0A 3KPFA 5EOWA 3IF9A 4Z24A 3NYFA 4NEWA 4ECHA 4USRA 2X8HA 1LTXR 3UKPA 1H6VA 3ISHA 3UKFA 1PJ7A 2XDOA 2BC1A 5HXIA 3GWFA 2YR4A 2BS2A 2XFQA 1LVLA 3KU9A 3VR9A 1YKJA 2Q0KA 3KVEA 3EAOA 1XDIA 1EBDA 2XLSA 3UOZA 1QDBA 3CGBA 2BXRA 4B64A 3AE7A 4Z44A 3V3NA 4EM4A 5J60A 3QSEA 3SZWA 3UCLA 3P9UA 2BK5A 3Q6JA 3F8PA 3H8LA 5IQ4A 1GNDA 3FBSA 4FX9A 2OLNA 3V3OA 1TDOA 2VZ2A 3P4QA 5BULA 1BKWA 2BS4A 1COYA 1M1PA 4GCMA 1W4XA 4APNA 3DK8A 2K3VA 1CC2A 4AP1A 2GAHB 1O94A 1VRQB 4AOXA 4ADWA 1L9EA 1EL9A 1QO8A 3LZWA 4OPIA 3KD9A 1LV0A 2IVEA 3H4KA 5CKUA 1QJDA 1CC6A 2YG6A 3NK2X 1D7LA 1RSGA 1IUWA 1XPQA 4Q17A 3BHFA 2BK4A 4K2XA 3HYWA 4OPLA 4XWZA 3SM8A 5JCMA 3SZ0A 4AP3A 2GF3A 3NRNA 4LIIA 5KMRA 1H7WA 4M52A 3ATRA 1KSUA 1L0VA 3F8RA 4JDRA 1N4WA 1TYPA 2YLRA 4A79A 4BK2A 4TLXA 4X9MA 2C66A 4NTEA 4USQA 5KVHA 1GSNA 4OPCA 1REOA 1NG3A 4Q5BA 1KNPA 4NWZA 1PBEA 1QLBA 3IC9A 4DSHA 4GDPA 3BNFA 3L8KA 5JCIA 4OPGA 2CVJA 2WEUA 2WOIA 3AEDA 3EF6A 4A6NB 2X8CA 1IUUA 4H4UA 3KA7A 4Q0TA 5IQ1A 2C3DA 1E1MA 3RKHA 3C4NA 1H86A 3AE6A 4EMWA 5M10A 1DNCA 2BC0A 1NHSA 4H4YA 2BXSA 2XFPA 4OPDA 3LOVA 2QA1A 1D7YA 2BCGG 1LQTA 3GYIA 1N1PA 2BK3A 1JNIA 5GRTA 4H4TA 1AOGA 5JCNA 4A99A 5KWFA 1X31B 3NG7X 4O5UA 1PHHA 3JSKA 4UDRA 4MJWA 3DH9A 4EQSA 2OALA 4N9XA 2XVHA 4YSYA 4AT0A 3H8IA 3GRSA 5BVAA 2EQ8A 3FMWA 2OLOA 2VVLA 3I6DA 2OT4A 3ZDNA 1BVBA 1CJCA 1VDCA 2E81A 2HQMA 2VRMA 2E80A 1CJ2A 2WOWA 3FG2P 3ADAB 2YVGA 5FS9A 3AB1A 3CPIG 3NYEA 2R4JA 1JNRA 2XFUA 1RYIA 3AE5A 3DA1A 1SEZA 2WDRA 2FJBA 2R46A 1TYTA 3CPHG 2AAQA 2EQ7A 2FJAA 3MMOA 3BNMA 3OZ2A 3V76A 3UOXA 3PVCA 4A5LA 2Y6QA 3EANA 2GMHA 1JOAA 2YVJA 2C72A 2E1MA 2FBWA 1CC4A 1Q1WA 2WOVA 4K7ZA 3RP8A 4NEVA 5J7XA 4G73A 1PDHA 2A89A 2YG4A 1YY5A 4TM3A 1FL2A 4WJYA 4PAAA 4GF7A 3E1TA 2E5VA 5KVIA 4UDQA 5KMQA 1P2EA 1KNRA 4EQXA 3AEEA 4NZHA 3KKJA 1TDNA 2Q6UA 3AE3A 4JNQA 2YVFA 4D04A 4EQWA 3Q9TA 1NDAA 4U2SA 3AE2A 3P1WA 1JU2A 3S61A 4B69A 4U8JA 1FOHA 2APGA 3L1TA 3AD9B 3HYXA 2C3CA 3AXBA 3FIMB 3ICSA 4Q4UA 3COXA 4YTNA 3I3LA 2ZZBA 2XFNA 2XVIA 3BI5A 2AQJA 4EMIA 5KMSA 4H4VA 2YM2A 4H4RA 1FS9A 3NNEA 1NAAA 2R0GA 4NNJA 2JB2A 2V6OA 4J31A 1ZOYA 1ONFA 3QFAA 3BI4A 1ZDLA 2GR1A 5M0ZA 3VRDB 1KFYA 1PBBA 1IUTA 1FT6A 3QVPA 2GR0A 3BI2A 2WU2A 4Z2UA 1K0JA 5KMPA 1JRYA 4J33A 3VQRA 4ICYA 4UDPA 3NGCX 4H4QA 2GV8A 3K7MX 3NHOX 1GV4A 4FK1C 3VRAA 1GRGA 3UKKA 1D4EA 1E1NA 2AR8A 2F5ZA 4H7UA 4C77A 2X50A 2R4EA 3D1CA 3QFBA 3SY4A 3CPJG 3AE4A 3DGHA 4UP3A 1S3EA 4H4SA 4EM3A 2YLXA 4IA5A 3BNJA 2GQWA 4H4WA 1O95A 3T14A 2FJDA 3GSIA 4L38A 3NH3X 1NG4A 2VQBA 3K30A 2XLPA 1NPXA 1B8SA 2B76A 3BHKA 5TR3A 3HYVA 3GD4A 1D4DA 2V3AA 3T2KA 5FS7A 2B7SA 1MO9A 2XLTA 1ZMDA 1ZMCA 3AE8A 3S5WA 1ZX9A 1DOEA 1OJCA 1FEBA 3NLCA 3SZCA 1JEHA 2QAEA 3CIRA 1L9CA 3VRBA 3ALLA 4DNAA 1SP3A 1FS7A 3GMBA 1TDFA 1DODA 3ATQA 1ZKQA 3ICTA 3L1RA 3PO7A 4GAPA 4GDEA 4L3ZA 3LXDA 3SGLA 4YSXA 2VOUA 3DGZA 3P4PA 4IVMB 2WU5A 4J2WA 2GR3A 2XFOA 3AYIA 5U63A 3T37A 1DOCA 2WP6A 3UU9A 2YAUA 4Y4NA 2YWLA 2GB0A 3ICRA 4AOSA 2WESA 3UTEA 1PBCA 2JB1A 5GSNA 2RGJA 3CN8A 4HB9A 3BNHA 3NYCA 4CCRA 3GRTA 3UOVA 3UTHA 4B66A 1F8WA 3UP4A 3LGQA 4YT0A 4GR1A 4TM4A 1OJ9A 3NKSA 3SFDA 2X3NA 3QJ4A 2RGHA 5FS6A 4YTPA 3LG1A 2VVLG 2C75A 3AYJA 1NEKA 4J56A 4H2RA 1B37A 3C4AA 3ABVA 2TPRA 3M13A 1DJNA 2GAGB 4J36A 3QSMA 4TM0A 4X4JA 1VG0A 1H82A 4RG3A 3D1IA 1DJQA 5KOXA 2ZZ0A 2ARDA 2VR0A 4BK3A 1DOBA 1F8SA 5HY5A 1CBOA 2XLUA 2WP9A 3IWAA 3F29A 1K0IA 3ALMA 1LPFA 4L3XA 3UBRA 2EQ9A 4LU6A 4TLZA 4G74A 1LJ1A 1FECA 4B65A 4C5OA 3G5QA 4Z43A 1PXCA 1CJ4A 2YLWA 4FDCB 5U25A 1ZK7A 3AEGA 3GYJA 3LADA 1GXFA 4CNJA 3G5RA 2YR6A 4YWOA 3CGCA 1EL8A 2WHDA 2OAMA 1PBFA 2GQFA 2YLTA 1BWCA 2B9WA 3SXQA 3CNDA 2NPXA 4CCQA 1NHPA 1GU6A 3G5SA 3RP7A 3DJGX 2RGOA 3IHMA 4H2NA 2IIDA 2C65A 4H2PA 3P4SA 5FS8A 5KXJA 5ER0A 2LFCA 3CNSA 1OJAA 2YLZA 4JNAA 3AE9A 3K7QX 2CDUA 1V59A 5U1OA 4AT2A 4HA6A 4B1BA 1Y0PA 2UZZA 2NVKX 1K0LA 2XLRA 3GD3A 4Z2RA 5KRQA 1FS8A 1GALA 3AECA 3CTYA 4K22A 3SX6A 4X9NA 4U8LA 1LQUA 4EMJA 2R0CA 3DJJA 1IUXA 2BRYA 3SYIA 1H81A 1M1QA 2TMDA 3AE1A 4Y4LA 1Y56A 5DBJA 4Y4MA 2BYBA 3DJEA 3AD7B 4BJZA 1CHUA 2Z5XA 1N4VA 2RABA 1NHQA 2VQ7A 4U8KA 3UTGA 4EQRA 2WBAA 2J7AA 5JCKA 1GTHA 3UKLA 4BURA 3CNJA 2WS3A 1FEAA 4A9WA 1IUSA 3CNTA 4B63A 5KOWA 2B9YA 1Q1RA 1ZY8A 1IJHA 2EQ6A 1EL5A 1E39A 3ZYXA 2R0PA 1PJ6A 5EB4A 3NK0X 1EL7A 3SZFA 5HYMA 1GRTA 3O0HA 3SQPA 3FO3A 3DMEA 4L3YA 3UP5A 2ACZA 1JNZA 1XANA 2BS3A 2YG3A 3II4A 5EB5A 5KNLA 4OVIA 1GT8A 1PXAA 4C3XA 3ALJA 4I59A 3NT6A 4LA1A 4Z2TA 5L46A 3AEAA 2WDVA 2H89A 2X99A 1XHCA 2WPCA 4OPUA 3SXIA 5IPYA 2ZBWA 2BCPA 4DGKA 2Q0LA 4II2A 4KX6A 3CGDA 2V60A 2C4CA 4K5SA 2C67A 3LZXA 4NTCA 1GRFA 2RF7A 3GWDA 2DKHA 1D5TA 3OC4A 2YG5A 1TDEA 1YQ3A 2GVCA 1PBDA 2GEWA 3P4RA 1PS9A 3DK4A 1FT5A 1CF3A 3BNUA 2QA2A 4YKFA 3UKHA 1UKVG 2JKCA 3BNGA 4U2LA 4IVOB 2C76A 1N4UA 4EIPA 2V5ZA 3KLJA 2R9ZA 3WE0A 3OWMA 4G6GA 2XYOA 3TTBA 2JB3A 4G9KA 3K7TA 3LJPA 4JY3A 1BZLA 3C96A 1BF3A 2YM1A 4YKGA 3REDA 4H50A 1S2YA 3DJDA 1Y56B 1OAHA 2VVMA 1BGJA 5C3JA 2GH5A 1GESA 2WDQA 4IV9A 2R45A 4CY6A 3GDPA 2A8XA 2VRLA 4K8DA 1L9DA 2BACA 2FJEA 4BJYA 4H2QA 2QCUA 2WETA 3CNPA 1NHRA 1OJDA 3DK9A 1S3BA 5C2TA 2XVJA 1F3PA 1ZOVA 1D4CA 4GUVA 2WPFA 3T0KA 1JRXA 1B4VA 3AYLA 1S2QA 4JQ9A 4OCGA 2X8GA 4RG4A 4KPRA 4U8IA 3FPZA 4U2TA 1F8RA 5EBKA 1E1KA 3UKQA 3NN0X 4XXGA 4U8PA 3F8DA 3GYXA 4ZCCA 4U8NA 1GEUA 2B9XA 2RDZA 4TM1A 2Q7VA 3AWIA 3T2YA 4A7AA 4J34A 4H4XA 1MOKA 3QSSA 1ZP0A 1TDKA 2IVDA 1GTEA 3M12A 4WCTA 1O5WA 2JBVA 2W0HA 1GRBA 3T2ZA 3SFEA 3B6DA 5CQFA 3URHA 4C74A 1M1RA 4CY8A 4Z26A 4G6HA 1CL0A 3D8XA 4YSHA 2JAEA 3EPTA 3NK1X 3HZLA 3PS9A 2BABA 1GPEA 1DXLA 1TRBA 3GMCA 2GR2A 3RP6A 1GETA 4YTMA 1P2HA 2ZO5A 4J57A 1FCDA 3KPKA 1K4QA 4K5RA 3NTDA 4H4ZA 4OPTA 3UOYA 1KSSA 3UTFA 3B3RA 1GREA 4GRTA 2C7GA 2XVFA 2Y6RA 3UKAA 1KDGA 2DKIA 2C64A 3TORA 2GMJA 4A65A 2C73A 4Q5CA 4CBQA 4Q1OA 1GOSA 2BA9A 1PJ5A 4BK1A 3CGEA 3CMMA 2YLSA 3GDNA 4YXDA 2XVEA 4II3A 2XCGA 4O5QA 3S7WA 4GAVA 4D03A 1ELIA 3NN6X 1JRZA 1GRAA 1F6MA 1KF6A 4B67A 1Z6LA 2PYXA 1VQWA 1GRHA 1YQZA 4PABA 4ZN0A 1VG9A 3AEFA 5BRTA 1M6IA 4WX1A 2CFYA 2I0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9Z A;  4REK A;  2ZZC A;  3GM6 A;  1NEN A;  3ITJ A;  4YSZ A;  3NIX A;  1IUV A;  4JY2 A;  1H7X A;  2WQY A;  4U8O A;  5BUK A;  2V61 A;  4P9S A;  4I58 A;  4C3Y A;  2WP5 A;  1H84 A;  2YG7 A;  3AD8 B;  2B7R A;  2YR5 A;  4XWR A;  4Z25 A;  2GRT A;  4FK1 A;  2E4G A;  4JN9 A;  2CUL A;  5JCL A;  1E7P A;  3SCE A;  4RSL A;  1MXT A;  1BGN A;  4CNK A;  4E0V A;  5HHF A;  4B68 A;  4IA6 A;  1GER A;  2WPE A;  2JK6 A;  3LB8 A;  2C70 A;  1Q9I A;  4EIQ A;  4H4P A;  2J3N A;  3IHG A;  1HYU A;  4U8M A;  5FMH A;  4BV6 A;  2V3B A;  2PHH A;  1PXB A;  3AEB A;  3RHA A;  1CJ3 A;  1E6E A;  2H88 A;  1M64 A;  2YQU A;  4NTD A;  3NTA A;  3RNM A;  2A87 A;  3QVR A;  1B5Q A;  3M0O A;  1OJT A;  1H83 A;  3VR8 A;  5LV9 A;  4A6N A;  2OA1 A;  4DSG A;  4CRT A;  3R9U A;  1YQ4 A;  1PN0 A;  2Z5Y A;  4ZCD A;  1E1L A;  1RP0 A;  3KPF A;  5EOW A;  3IF9 A;  4Z24 A;  3NYF A;  4NEW A;  4ECH A;  4USR A;  2X8H A;  1LTX R;  3UKP A;  1H6V A;  3ISH A;  3UKF A;  1PJ7 A;  2XDO A;  2BC1 A;  5HXI A;  3GWF A;  2YR4 A;  2BS2 A;  2XFQ A;  1LVL A;  3KU9 A;  3VR9 A;  1YKJ A;  2Q0K A;  3KVE A;  3EAO A;  1XDI A;  1EBD A;  2XLS A;  3UOZ A;  1QDB A;  3CGB A;  2BXR A;  4B64 A;  3AE7 A;  4Z44 A;  3V3N A;  4EM4 A;  5J60 A;  3QSE A;  3UCL A;  3P9U A;  2BK5 A;  3Q6J A;  3F8P A;  3H8L A;  5IQ4 A;  1GND A;  3FBS A;  4FX9 A;  2OLN A;  3V3O A;  1TDO A;  2VZ2 A;  3P4Q A;  5BUL A;  1BKW A;  2BS4 A;  1COY A;  1M1P A;  4GCM A;  1W4X A;  4APN A;  3DK8 A;  2K3V A;  1CC2 A;  4AP1 A;  2GAH B;  1O94 A;  1VRQ B;  4AOX A;  4ADW A;  1L9E A;  1EL9 A;  1QO8 A;  3LZW A;  4OPI A;  3KD9 A;  1LV0 A;  2IVE A;  3H4K A;  5CKU A;  1QJD A;  1CC6 A;  2YG6 A;  3NK2 X;  1D7L A;  1RSG A;  1IUW A;  1XPQ A;  4Q17 A;  3BHF A;  2BK4 A;  4K2X A;  4OPL A;  4XWZ A;  3SM8 A;  5JCM A;  4AP3 A;  2GF3 A;  3NRN A;  4LII A;  1H7W A;  4M52 A;  3ATR A;  1KSU A;  1L0V A;  3F8R A;  4JDR A;  1N4W A;  1TYP A;  2YLR A;  4A79 A;  4BK2 A;  4TLX A;  4X9M A;  2C66 A;  4NTE A;  4USQ A;  5KVH A;  1GSN A;  4OPC A;  1REO A;  1NG3 A;  4Q5B A;  1KNP A;  1PBE A;  1QLB A;  3IC9 A;  4DSH A;  4GDP A;  3BNF A;  3L8K A;  5JCI A;  4OPG A;  2CVJ A;  2WEU A;  2WOI A;  3AED A;  3EF6 A;  4A6N B;  2X8C A;  1IUU A;  4H4U A;  3KA7 A;  4Q0T A;  5IQ1 A;  2C3D A;  1E1M A;  3RKH A;  3C4N A;  1H86 A;  3AE6 A;  4EMW A;  5M10 A;  1DNC A;  2BC0 A;  1NHS A;  4H4Y A;  2BXS A;  2XFP A;  4OPD A;  3LOV A;  2QA1 A;  1D7Y A;  2BCG G;  1LQT A;  3GYI A;  1N1P A;  2BK3 A;  1JNI A;  5GRT A;  4H4T A;  1AOG A;  5JCN A;  4A99 A;  5KWF A;  1X31 B;  3NG7 X;  4O5U A;  1PHH A;  3JSK A;  4UDR A;  4MJW A;  3DH9 A;  4EQS A;  2OAL A;  4N9X A;  2XVH A;  4YSY A;  4AT0 A;  3H8I A;  3GRS A;  5BVA A;  2EQ8 A;  3FMW A;  2OLO A;  2VVL A;  3I6D A;  2OT4 A;  3ZDN A;  1BVB A;  1CJC A;  1VDC A;  2E81 A;  2HQM A;  2VRM A;  2E80 A;  1CJ2 A;  2WOW A;  3FG2 P;  3ADA B;  2YVG A;  5FS9 A;  3AB1 A;  3CPI G;  3NYE A;  2R4J A;  1JNR A;  2XFU A;  1RYI A;  3AE5 A;  3DA1 A;  1SEZ A;  2WDR A;  2FJB A;  2R46 A;  1TYT A;  3CPH G;  2AAQ A;  2EQ7 A;  2FJA A;  3MMO A;  3BNM A;  3OZ2 A;  3V76 A;  3UOX A;  3PVC A;  4A5L A;  2Y6Q A;  3EAN A;  2GMH A;  1JOA A;  2YVJ A;  2C72 A;  2E1M A;  2FBW A;  1CC4 A;  1Q1W A;  2WOV A;  4K7Z A;  3RP8 A;  4NEV A;  5J7X A;  1PDH A;  2A89 A;  2YG4 A;  1YY5 A;  4TM3 A;  1FL2 A;  4WJY A;  4PAA A;  4GF7 A;  3E1T A;  2E5V A;  5KVI A;  4UDQ A;  1P2E A;  1KNR A;  4EQX A;  3AEE A;  4NZH A;  3KKJ A;  1TDN A;  2Q6U A;  3AE3 A;  4JNQ A;  2YVF A;  4D04 A;  4EQW A;  3Q9T A;  1NDA A;  4U2S A;  3AE2 A;  3P1W A;  1JU2 A;  3S61 A;  4B69 A;  4U8J A;  1FOH A;  2APG A;  3L1T A;  3AD9 B;  2C3C A;  3AXB A;  3FIM B;  3ICS A;  4Q4U A;  3COX A;  4YTN A;  3I3L A;  2ZZB A;  2XFN A;  2XVI A;  3BI5 A;  2AQJ A;  4EMI A;  4H4V A;  2YM2 A;  4H4R A;  1FS9 A;  3NNE A;  1NAA A;  2R0G A;  2JB2 A;  2V6O A;  4J31 A;  1ZOY A;  1ONF A;  3QFA A;  3BI4 A;  1ZDL A;  2GR1 A;  5M0Z A;  3VRD B;  1KFY A;  1PBB A;  1IUT A;  1FT6 A;  3QVP A;  2GR0 A;  3BI2 A;  2WU2 A;  4Z2U A;  1K0J A;  1JRY A;  4J33 A;  3VQR A;  4ICY A;  4UDP A;  3NGC X;  4H4Q A;  2GV8 A;  3K7M X;  3NHO X;  1GV4 A;  4FK1 C;  3VRA A;  1GRG A;  3UKK A;  1D4E A;  1E1N A;  2AR8 A;  2F5Z A;  4H7U A;  4C77 A;  2X50 A;  2R4E A;  3D1C A;  3QFB A;  3CPJ G;  3AE4 A;  3DGH A;  4UP3 A;  1S3E A;  4H4S A;  4EM3 A;  2YLX A;  4IA5 A;  3BNJ A;  2GQW A;  4H4W A;  1O95 A;  2FJD A;  3GSI A;  4L38 A;  3NH3 X;  1NG4 A;  2VQB A;  3K30 A;  2XLP A;  1NPX A;  1B8S A;  2B76 A;  3BHK A;  5TR3 A;  3GD4 A;  1D4D A;  2V3A A;  5FS7 A;  2B7S A;  1MO9 A;  2XLT A;  1ZMD A;  1ZMC A;  3AE8 A;  3S5W A;  1ZX9 A;  1DOE A;  1OJC A;  1FEB A;  3NLC A;  1JEH A;  2QAE A;  3CIR A;  1L9C A;  3VRB A;  3ALL A;  4DNA A;  1SP3 A;  1FS7 A;  3GMB A;  1TDF A;  1DOD A;  3ATQ A;  1ZKQ A;  3ICT A;  3L1R A;  3PO7 A;  4GDE A;  4L3Z A;  3LXD A;  3SGL A;  4YSX A;  2VOU A;  3DGZ A;  3P4P A;  4IVM B;  2WU5 A;  4J2W A;  2GR3 A;  2XFO A;  3AYI A;  5U63 A;  3T37 A;  1DOC A;  2WP6 A;  3UU9 A;  2YAU A;  4Y4N A;  2YWL A;  2GB0 A;  3ICR A;  4AOS A;  2WES A;  3UTE A;  1PBC A;  2JB1 A;  5GSN A;  2RGJ A;  3CN8 A;  4HB9 A;  3BNH A;  3NYC A;  4CCR A;  3GRT A;  3UOV A;  3UTH A;  4B66 A;  1F8W A;  3UP4 A;  3LGQ A;  4YT0 A;  4GR1 A;  4TM4 A;  1OJ9 A;  3NKS A;  3SFD A;  2X3N A;  3QJ4 A;  2RGH A;  5FS6 A;  4YTP A;  3LG1 A;  2VVL G;  2C75 A;  3AYJ A;  1NEK A;  4J56 A;  4H2R A;  1B37 A;  3C4A A;  3ABV A;  2TPR A;  3M13 A;  1DJN A;  2GAG B;  4J36 A;  3QSM A;  4TM0 A;  4X4J A;  1VG0 A;  1H82 A;  4RG3 A;  3D1I A;  1DJQ A;  5KOX A;  2ZZ0 A;  2ARD A;  2VR0 A;  4BK3 A;  1DOB A;  1F8S A;  5HY5 A;  1CBO A;  2XLU A;  2WP9 A;  3IWA A;  3F29 A;  1K0I A;  3ALM A;  1LPF A;  4L3X A;  3UBR A;  2EQ9 A;  4LU6 A;  4TLZ A;  1LJ1 A;  1FEC A;  4B65 A;  4C5O A;  3G5Q A;  4Z43 A;  1PXC A;  1CJ4 A;  2YLW A;  4FDC B;  5U25 A;  1ZK7 A;  3AEG A;  3GYJ A;  3LAD A;  1GXF A;  4CNJ A;  3G5R A;  2YR6 A;  4YWO A;  3CGC A;  1EL8 A;  2WHD A;  2OAM A;  1PBF A;  2GQF A;  2YLT A;  1BWC A;  2B9W A;  3SXQ A;  3CND A;  2NPX A;  4CCQ A;  1NHP A;  1GU6 A;  3G5S A;  3RP7 A;  3DJG X;  2RGO A;  3IHM A;  4H2N A;  2IID A;  2C65 A;  4H2P A;  3P4S A;  5FS8 A;  5KXJ A;  5ER0 A;  2LFC A;  3CNS A;  1OJA A;  2YLZ A;  4JNA A;  3AE9 A;  3K7Q X;  2CDU A;  1V59 A;  5U1O A;  4AT2 A;  4HA6 A;  4B1B A;  1Y0P A;  2UZZ A;  2NVK X;  1K0L A;  2XLR A;  3GD3 A;  4Z2R A;  5KRQ A;  1FS8 A;  1GAL A;  3AEC A;  3CTY A;  4K22 A;  4X9N A;  4U8L A;  1LQU A;  4EMJ A;  2R0C A;  3DJJ A;  1IUX A;  1H81 A;  1M1Q A;  2TMD A;  3AE1 A;  4Y4L A;  1Y56 A;  5DBJ A;  4Y4M A;  2BYB A;  3DJE A;  3AD7 B;  4BJZ A;  1CHU A;  2Z5X A;  1N4V A;  2RAB A;  1NHQ A;  2VQ7 A;  4U8K A;  3UTG A;  4EQR A;  2WBA A;  2J7A A;  5JCK A;  1GTH A;  3UKL A;  4BUR A;  3CNJ A;  2WS3 A;  1FEA A;  4A9W A;  1IUS A;  3CNT A;  4B63 A;  5KOW A;  2B9Y A;  1Q1R A;  1ZY8 A;  1IJH A;  2EQ6 A;  1EL5 A;  1E39 A;  3ZYX A;  2R0P A;  1PJ6 A;  5EB4 A;  3NK0 X;  1EL7 A;  5HYM A;  1GRT A;  3O0H A;  3SQP A;  3FO3 A;  3DME A;  4L3Y A;  3UP5 A;  2ACZ A;  1JNZ A;  1XAN A;  2BS3 A;  2YG3 A;  3II4 A;  5EB5 A;  4OVI A;  1GT8 A;  1PXA A;  4C3X A;  3ALJ A;  4I59 A;  3NT6 A;  4LA1 A;  4Z2T A;  5L46 A;  3AEA A;  2WDV A;  2H89 A;  2X99 A;  1XHC A;  2WPC A;  4OPU A;  5IPY A;  2ZBW A;  2BCP A;  4DGK A;  2Q0L A;  4KX6 A;  3CGD A;  2V60 A;  4K5S A;  2C67 A;  3LZX A;  4NTC A;  1GRF A;  2RF7 A;  3GWD A;  2DKH A;  1D5T A;  3OC4 A;  2YG5 A;  1TDE A;  1YQ3 A;  2GVC A;  1PBD A;  2GEW A;  3P4R A;  1PS9 A;  3DK4 A;  1FT5 A;  1CF3 A;  3BNU A;  2QA2 A;  4YKF A;  3UKH A;  1UKV G;  2JKC A;  3BNG A;  4U2L A;  4IVO B;  2C76 A;  1N4U A;  4EIP A;  2V5Z A;  3KLJ A;  2R9Z A;  3WE0 A;  3OWM A;  2XYO A;  3TTB A;  2JB3 A;  4JY3 A;  3K7T A;  3LJP A;  1BZL A;  3C96 A;  1BF3 A;  2YM1 A;  4YKG A;  3RED A;  4H50 A;  1S2Y A;  3DJD A;  1Y56 B;  1OAH A;  2VVM A;  1BGJ A;  5C3J A;  2GH5 A;  1GES A;  2WDQ A;  4IV9 A;  2R45 A;  4CY6 A;  3GDP A;  2A8X A;  2VRL A;  4K8D A;  1L9D A;  2BAC A;  2FJE A;  4BJY A;  4H2Q A;  2QCU A;  2WET A;  3CNP A;  1NHR A;  1OJD A;  3DK9 A;  1S3B A;  5C2T A;  2XVJ A;  1F3P A;  1ZOV A;  1D4C A;  4GUV A;  2WPF A;  1JRX A;  1B4V A;  3AYL A;  1S2Q A;  4JQ9 A;  4OCG A;  2X8G A;  4RG4 A;  4KPR A;  4U8I A;  3FPZ A;  4U2T A;  1F8R A;  5EBK A;  1E1K A;  3UKQ A;  3NN0 X;  4XXG A;  4U8P A;  3F8D A;  3GYX A;  4ZCC A;  4U8N A;  1GEU A;  2B9X A;  2RDZ A;  4TM1 A;  2Q7V A;  3AWI A;  4A7A A;  4J34 A;  4H4X A;  1MOK A;  3QSS A;  1ZP0 A;  1TDK A;  2IVD A;  1GTE A;  3M12 A;  4WCT A;  1O5W A;  2JBV A;  2W0H A;  1GRB A;  3SFE A;  3B6D A;  5CQF A;  3URH A;  4C74 A;  1M1R A;  4CY8 A;  4Z26 A;  1CL0 A;  3D8X A;  4YSH A;  2JAE A;  3EPT A;  3NK1 X;  3HZL A;  3PS9 A;  2BAB A;  1GPE A;  1DXL A;  1TRB A;  3GMC A;  2GR2 A;  3RP6 A;  1GET A;  4YTM A;  1P2H A;  2ZO5 A;  4J57 A;  1FCD A;  3UOY A;  1K4Q A;  4K5R A;  3NTD A;  4H4Z A;  4OPT A;  3UTF A;  1KSS A;  3B3R A;  1GRE A;  4GRT A;  2C7G A;  2XVF A;  2Y6R A;  3UKA A;  1KDG A;  2DKI A;  2C64 A;  3TOR A;  2GMJ A;  4A65 A;  2C73 A;  4Q5C A;  4CBQ A;  4Q1O A;  1GOS A;  2BA9 A;  1PJ5 A;  4BK1 A;  3CGE A;  2YLS A;  3GDN A;  4YXD A;  2XVE A;  2XCG A;  4O5Q A;  3S7W A;  4D03 A;  1ELI A;  3NN6 X;  1JRZ A;  1GRA A;  1F6M A;  1KF6 A;  4B67 A;  1Z6L A;  2PYX A;  1VQW A;  1GRH A;  1YQZ A;  4PAB A;  4ZN0 A;  1VG9 A;  3AEF A;  5BRT A;  1M6I A;  4WX1 A;  2CFY A;  2I0Z A; 
#chains in the Genus database with same CATH topology
 2O9Z A;  4REK A;  2ZZC A;  3GM6 A;  1NEN A;  3ITJ A;  4YSZ A;  3NIX A;  3T31 A;  1IUV A;  4JY2 A;  1H7X A;  2WQY A;  4U8O A;  5BUK A;  2V61 A;  4P9S A;  4I58 A;  4C3Y A;  2WP5 A;  1H84 A;  2YG7 A;  3AD8 B;  2B7R A;  2YR5 A;  4XWR A;  4Z25 A;  2GRT A;  4FK1 A;  2E4G A;  4JN9 A;  2CUL A;  5JCL A;  1E7P A;  3SCE A;  4RSL A;  1MXT A;  1BGN A;  4CNK A;  4E0V A;  5HHF A;  4B68 A;  4IA6 A;  1GER A;  2WPE A;  2JK6 A;  3LB8 A;  2C70 A;  1Q9I A;  4EIQ A;  4H4P A;  2BRA A;  2J3N A;  3IHG A;  1HYU A;  4U8M A;  5FMH A;  4BV6 A;  2V3B A;  2PHH A;  1PXB A;  3AEB A;  3RHA A;  1CJ3 A;  1E6E A;  2H88 A;  1M64 A;  2YQU A;  4NTD A;  3NTA A;  3RNM A;  2A87 A;  3QVR A;  1B5Q A;  3M0O A;  1OJT A;  1H83 A;  3VR8 A;  5LV9 A;  4A6N A;  2OA1 A;  4DSG A;  4CRT A;  3R9U A;  1YQ4 A;  1PN0 A;  2Z5Y A;  4ZCD A;  1E1L A;  1RP0 A;  3KPF A;  5EOW A;  3IF9 A;  4Z24 A;  3NYF A;  4NEW A;  4ECH A;  4USR A;  2X8H A;  1LTX R;  3UKP A;  1H6V A;  3ISH A;  3UKF A;  1PJ7 A;  2XDO A;  2BC1 A;  5HXI A;  3GWF A;  2YR4 A;  2BS2 A;  2XFQ A;  1LVL A;  3KU9 A;  3VR9 A;  1YKJ A;  2Q0K A;  3KVE A;  3EAO A;  1XDI A;  1EBD A;  2XLS A;  3UOZ A;  1QDB A;  3CGB A;  2BXR A;  4B64 A;  3AE7 A;  4Z44 A;  3V3N A;  4EM4 A;  5J60 A;  3QSE A;  3SZW A;  3UCL A;  3P9U A;  2BK5 A;  3Q6J A;  3F8P A;  3H8L A;  5IQ4 A;  1GND A;  3FBS A;  4FX9 A;  2OLN A;  3V3O A;  1TDO A;  2VZ2 A;  3P4Q A;  5BUL A;  1BKW A;  2BS4 A;  1COY A;  1M1P A;  4GCM A;  1W4X A;  4APN A;  3DK8 A;  2K3V A;  1CC2 A;  4AP1 A;  2GAH B;  1O94 A;  1VRQ B;  4AOX A;  4ADW A;  1L9E A;  1EL9 A;  1QO8 A;  3LZW A;  4OPI A;  3KD9 A;  1LV0 A;  2IVE A;  3H4K A;  5CKU A;  1QJD A;  1CC6 A;  2YG6 A;  3NK2 X;  1D7L A;  1RSG A;  1IUW A;  1XPQ A;  4Q17 A;  3BHF A;  2BK4 A;  4K2X A;  3HYW A;  4OPL A;  4XWZ A;  3SM8 A;  5JCM A;  3SZ0 A;  4AP3 A;  2GF3 A;  3NRN A;  4LII A;  5KMR A;  1H7W A;  4M52 A;  3ATR A;  1KSU A;  1L0V A;  3F8R A;  4JDR A;  1N4W A;  1TYP A;  2YLR A;  4A79 A;  4BK2 A;  4TLX A;  4X9M A;  2C66 A;  4NTE A;  4USQ A;  5KVH A;  1GSN A;  4OPC A;  1REO A;  1NG3 A;  4Q5B A;  1KNP A;  4NWZ A;  1PBE A;  1QLB A;  3IC9 A;  4DSH A;  4GDP A;  3BNF A;  3L8K A;  5JCI A;  4OPG A;  2CVJ A;  2WEU A;  2WOI A;  3AED A;  3EF6 A;  4A6N B;  2X8C A;  1IUU A;  4H4U A;  3KA7 A;  4Q0T A;  5IQ1 A;  2C3D A;  1E1M A;  3RKH A;  3C4N A;  1H86 A;  3AE6 A;  4EMW A;  5M10 A;  1DNC A;  2BC0 A;  1NHS A;  4H4Y A;  2BXS A;  2XFP A;  4OPD A;  3LOV A;  2CZS A;  1D7Y A;  2QA1 A;  2BCG G;  1LQT A;  3GYI A;  1N1P A;  2BK3 A;  1JNI A;  5GRT A;  4H4T A;  1AOG A;  5JCN A;  4A99 A;  5KWF A;  1X31 B;  3NG7 X;  4O5U A;  1PHH A;  3JSK A;  4UDR A;  4MJW A;  3DH9 A;  4EQS A;  2OAL A;  4N9X A;  2XVH A;  4YSY A;  4AT0 A;  3H8I A;  3GRS A;  5BVA A;  2EQ8 A;  3FMW A;  2OLO A;  2VVL A;  3I6D A;  2OT4 A;  3ZDN A;  1BVB A;  1CJC A;  1VDC A;  2E81 A;  2HQM A;  2VRM A;  2E80 A;  1CJ2 A;  2WOW A;  3FG2 P;  3ADA B;  2YVG A;  5FS9 A;  3AB1 A;  3CPI G;  3NYE A;  2R4J A;  1JNR A;  2XFU A;  1RYI A;  3AE5 A;  3DA1 A;  1SEZ A;  2WDR A;  2FJB A;  2R46 A;  1TYT A;  3CPH G;  2AAQ A;  2EQ7 A;  2FJA A;  3MMO A;  3BNM A;  3OZ2 A;  3V76 A;  3UOX A;  3PVC A;  4A5L A;  2Y6Q A;  3EAN A;  2GMH A;  1JOA A;  2YVJ A;  2C72 A;  2E1M A;  2FBW A;  1CC4 A;  1Q1W A;  2WOV A;  4K7Z A;  3RP8 A;  4NEV A;  5J7X A;  4G73 A;  1PDH A;  2A89 A;  2YG4 A;  1YY5 A;  4TM3 A;  1FL2 A;  4WJY A;  4PAA A;  4GF7 A;  3E1T A;  2E5V A;  5KVI A;  4UDQ A;  5KMQ A;  1P2E A;  1KNR A;  4EQX A;  3AEE A;  4NZH A;  3KKJ A;  1TDN A;  2Q6U A;  3AE3 A;  4JNQ A;  2YVF A;  4D04 A;  4EQW A;  3Q9T A;  1NDA A;  4U2S A;  3AE2 A;  3P1W A;  1JU2 A;  3S61 A;  4B69 A;  4U8J A;  1FOH A;  2APG A;  3L1T A;  3AD9 B;  3HYX A;  2C3C A;  3AXB A;  3FIM B;  3ICS A;  4Q4U A;  3COX A;  4YTN A;  3I3L A;  2ZZB A;  2XFN A;  2XVI A;  3BI5 A;  2AQJ A;  4EMI A;  5KMS A;  4H4V A;  2YM2 A;  4H4R A;  1FS9 A;  3NNE A;  1NAA A;  2R0G A;  4NNJ A;  2JB2 A;  2V6O A;  4J31 A;  1ZOY A;  1ONF A;  3QFA A;  3BI4 A;  1ZDL A;  2GR1 A;  5M0Z A;  3VRD B;  1KFY A;  1PBB A;  1IUT A;  1FT6 A;  3QVP A;  2GR0 A;  3BI2 A;  2WU2 A;  4Z2U A;  1K0J A;  5KMP A;  1JRY A;  4J33 A;  3VQR A;  4ICY A;  4UDP A;  3NGC X;  4H4Q A;  2GV8 A;  3K7M X;  3NHO X;  1GV4 A;  4FK1 C;  3VRA A;  1GRG A;  3UKK A;  1D4E A;  1E1N A;  2AR8 A;  2F5Z A;  4H7U A;  4C77 A;  2X50 A;  2R4E A;  3D1C A;  3QFB A;  3SY4 A;  3CPJ G;  3AE4 A;  3DGH A;  4UP3 A;  1S3E A;  4H4S A;  4EM3 A;  2YLX A;  4IA5 A;  3BNJ A;  2GQW A;  4H4W A;  1O95 A;  3T14 A;  2FJD A;  3GSI A;  4L38 A;  3NH3 X;  1NG4 A;  2VQB A;  3K30 A;  2XLP A;  1NPX A;  1B8S A;  2B76 A;  3BHK A;  5TR3 A;  3HYV A;  3GD4 A;  1D4D A;  2V3A A;  3T2K A;  5FS7 A;  2B7S A;  1MO9 A;  2XLT A;  1ZMD A;  1ZMC A;  3AE8 A;  3S5W A;  1ZX9 A;  1DOE A;  1OJC A;  1FEB A;  3NLC A;  3SZC A;  1JEH A;  2QAE A;  3CIR A;  1L9C A;  3VRB A;  3ALL A;  4DNA A;  1SP3 A;  1FS7 A;  3GMB A;  1TDF A;  1DOD A;  3ATQ A;  1ZKQ A;  3ICT A;  3L1R A;  3PO7 A;  4GAP A;  4GDE A;  4L3Z A;  3LXD A;  3SGL A;  4YSX A;  2VOU A;  3DGZ A;  3P4P A;  4IVM B;  2WU5 A;  4J2W A;  2GR3 A;  2XFO A;  3AYI A;  5U63 A;  3T37 A;  1DOC A;  2WP6 A;  3UU9 A;  2YAU A;  4Y4N A;  2YWL A;  2GB0 A;  3ICR A;  4AOS A;  2WES A;  3UTE A;  1PBC A;  2JB1 A;  5GSN A;  2RGJ A;  3CN8 A;  4HB9 A;  3BNH A;  3NYC A;  4CCR A;  3GRT A;  3UOV A;  3UTH A;  4B66 A;  1F8W A;  3UP4 A;  3LGQ A;  4YT0 A;  4GR1 A;  4TM4 A;  1OJ9 A;  3NKS A;  3SFD A;  2X3N A;  3QJ4 A;  2RGH A;  5FS6 A;  4YTP A;  3LG1 A;  2VVL G;  2C75 A;  3AYJ A;  1NEK A;  4J56 A;  4H2R A;  1B37 A;  3C4A A;  3ABV A;  2TPR A;  3M13 A;  1DJN A;  2GAG B;  4J36 A;  3QSM A;  4TM0 A;  4X4J A;  1VG0 A;  1H82 A;  4RG3 A;  3D1I A;  1DJQ A;  5KOX A;  2ZZ0 A;  2ARD A;  2VR0 A;  4BK3 A;  1DOB A;  1F8S A;  5HY5 A;  1CBO A;  2XLU A;  2WP9 A;  3IWA A;  3F29 A;  1K0I A;  3ALM A;  1LPF A;  4L3X A;  3UBR A;  2EQ9 A;  4LU6 A;  4TLZ A;  4G74 A;  1LJ1 A;  1FEC A;  4B65 A;  4C5O A;  3G5Q A;  4Z43 A;  1PXC A;  1CJ4 A;  2YLW A;  4FDC B;  5U25 A;  1ZK7 A;  3AEG A;  3GYJ A;  3LAD A;  1GXF A;  4CNJ A;  3G5R A;  2YR6 A;  4YWO A;  3CGC A;  1EL8 A;  2WHD A;  2OAM A;  1PBF A;  2GQF A;  2YLT A;  1BWC A;  2B9W A;  3SXQ A;  3CND A;  2NPX A;  4CCQ A;  1NHP A;  1GU6 A;  3G5S A;  3RP7 A;  3DJG X;  2RGO A;  3IHM A;  4H2N A;  2IID A;  2C65 A;  4H2P A;  3P4S A;  5FS8 A;  5KXJ A;  5ER0 A;  2LFC A;  3CNS A;  1OJA A;  2YLZ A;  4JNA A;  3AE9 A;  3K7Q X;  2CDU A;  1V59 A;  5U1O A;  4AT2 A;  4HA6 A;  4B1B A;  1Y0P A;  2UZZ A;  2NVK X;  1K0L A;  2XLR A;  3GD3 A;  4Z2R A;  5KRQ A;  1FS8 A;  1GAL A;  3AEC A;  3CTY A;  4K22 A;  3SX6 A;  4X9N A;  4U8L A;  1LQU A;  4EMJ A;  2R0C A;  3DJJ A;  1IUX A;  2BRY A;  3SYI A;  1H81 A;  1M1Q A;  2TMD A;  3AE1 A;  4Y4L A;  1Y56 A;  5DBJ A;  4Y4M A;  2BYB A;  3DJE A;  3AD7 B;  4BJZ A;  1CHU A;  2Z5X A;  1N4V A;  2RAB A;  1NHQ A;  2VQ7 A;  4U8K A;  3UTG A;  4EQR A;  2WBA A;  2J7A A;  5JCK A;  1GTH A;  3UKL A;  4BUR A;  3CNJ A;  2WS3 A;  1FEA A;  4A9W A;  1IUS A;  3CNT A;  4B63 A;  5KOW A;  2B9Y A;  1Q1R A;  1ZY8 A;  1IJH A;  2EQ6 A;  1EL5 A;  1E39 A;  3ZYX A;  2R0P A;  1PJ6 A;  5EB4 A;  3NK0 X;  1EL7 A;  3SZF A;  5HYM A;  1GRT A;  3O0H A;  3SQP A;  3FO3 A;  3DME A;  4L3Y A;  3UP5 A;  2ACZ A;  1JNZ A;  1XAN A;  2BS3 A;  2YG3 A;  3II4 A;  5EB5 A;  5KNL A;  4OVI A;  1GT8 A;  1PXA A;  4C3X A;  3ALJ A;  4I59 A;  3NT6 A;  4LA1 A;  4Z2T A;  5L46 A;  3AEA A;  2WDV A;  2H89 A;  2X99 A;  1XHC A;  2WPC A;  4OPU A;  3SXI A;  5IPY A;  2ZBW A;  2BCP A;  4DGK A;  2Q0L A;  4II2 A;  4KX6 A;  3CGD A;  2V60 A;  2C4C A;  4K5S A;  2C67 A;  3LZX A;  4NTC A;  1GRF A;  2RF7 A;  3GWD A;  2DKH A;  1D5T A;  3OC4 A;  2YG5 A;  1TDE A;  1YQ3 A;  2GVC A;  1PBD A;  2GEW A;  3P4R A;  1PS9 A;  3DK4 A;  1FT5 A;  1CF3 A;  3BNU A;  2QA2 A;  4YKF A;  3UKH A;  1UKV G;  2JKC A;  3BNG A;  4U2L A;  4IVO B;  2C76 A;  1N4U A;  4EIP A;  2V5Z A;  3KLJ A;  2R9Z A;  3WE0 A;  3OWM A;  4G6G A;  2XYO A;  3TTB A;  2JB3 A;  4G9K A;  3K7T A;  3LJP A;  4JY3 A;  1BZL A;  3C96 A;  1BF3 A;  2YM1 A;  4YKG A;  3RED A;  4H50 A;  1S2Y A;  3DJD A;  1Y56 B;  1OAH A;  2VVM A;  1BGJ A;  5C3J A;  2GH5 A;  1GES A;  2WDQ A;  4IV9 A;  2R45 A;  4CY6 A;  3GDP A;  2A8X A;  2VRL A;  4K8D A;  1L9D A;  2BAC A;  2FJE A;  4BJY A;  4H2Q A;  2QCU A;  2WET A;  3CNP A;  1NHR A;  1OJD A;  3DK9 A;  1S3B A;  5C2T A;  2XVJ A;  1F3P A;  1ZOV A;  1D4C A;  4GUV A;  2WPF A;  3T0K A;  1JRX A;  1B4V A;  3AYL A;  1S2Q A;  4JQ9 A;  4OCG A;  2X8G A;  4RG4 A;  4KPR A;  4U8I A;  3FPZ A;  4U2T A;  1F8R A;  5EBK A;  1E1K A;  3UKQ A;  3NN0 X;  4XXG A;  4U8P A;  3F8D A;  3GYX A;  4ZCC A;  4U8N A;  1GEU A;  2B9X A;  2RDZ A;  4TM1 A;  2Q7V A;  3AWI A;  3T2Y A;  4A7A A;  4J34 A;  4H4X A;  1MOK A;  3QSS A;  1ZP0 A;  1TDK A;  2IVD A;  1GTE A;  3M12 A;  4WCT A;  1O5W A;  2JBV A;  2W0H A;  1GRB A;  3T2Z A;  3SFE A;  3B6D A;  5CQF A;  3URH A;  4C74 A;  1M1R A;  4CY8 A;  4Z26 A;  4G6H A;  1CL0 A;  3D8X A;  4YSH A;  2JAE A;  3EPT A;  3NK1 X;  3HZL A;  3PS9 A;  2BAB A;  1GPE A;  1DXL A;  1TRB A;  3GMC A;  2GR2 A;  3RP6 A;  1GET A;  4YTM A;  1P2H A;  2ZO5 A;  4J57 A;  1FCD A;  3KPK A;  1K4Q A;  4K5R A;  3NTD A;  4H4Z A;  4OPT A;  3UOY A;  1KSS A;  3UTF A;  3B3R A;  1GRE A;  4GRT A;  2C7G A;  2XVF A;  2Y6R A;  3UKA A;  1KDG A;  2DKI A;  2C64 A;  3TOR A;  2GMJ A;  4A65 A;  2C73 A;  4Q5C A;  4CBQ A;  4Q1O A;  1GOS A;  2BA9 A;  1PJ5 A;  4BK1 A;  3CGE A;  3CMM A;  2YLS A;  3GDN A;  4YXD A;  2XVE A;  4II3 A;  2XCG A;  4O5Q A;  3S7W A;  4GAV A;  4D03 A;  1ELI A;  3NN6 X;  1JRZ A;  1GRA A;  1F6M A;  1KF6 A;  4B67 A;  1Z6L A;  2PYX A;  1VQW A;  1GRH A;  1YQZ A;  4PAB A;  4ZN0 A;  1VG9 A;  3AEF A;  5BRT A;  1M6I A;  4WX1 A;  2CFY A;  2I0Z A; 
#chains in the Genus database with same CATH homology
 2O9Z A;  4REK A;  2ZZC A;  3GM6 A;  1NEN A;  3ITJ A;  4YSZ A;  3NIX A;  3T31 A;  1IUV A;  4JY2 A;  1H7X A;  2WQY A;  4U8O A;  5BUK A;  2V61 A;  4P9S A;  4I58 A;  4C3Y A;  2WP5 A;  1H84 A;  2YG7 A;  3AD8 B;  2B7R A;  2YR5 A;  4XWR A;  4Z25 A;  2GRT A;  4FK1 A;  2E4G A;  4JN9 A;  2CUL A;  5JCL A;  1E7P A;  3SCE A;  4RSL A;  1MXT A;  1BGN A;  4CNK A;  4E0V A;  5HHF A;  4B68 A;  4IA6 A;  1GER A;  2WPE A;  2JK6 A;  3LB8 A;  2C70 A;  1Q9I A;  4EIQ A;  4H4P A;  2BRA A;  2J3N A;  3IHG A;  1HYU A;  4U8M A;  5FMH A;  4BV6 A;  2V3B A;  2PHH A;  1PXB A;  3AEB A;  3RHA A;  1CJ3 A;  1E6E A;  2H88 A;  1M64 A;  2YQU A;  4NTD A;  3NTA A;  3RNM A;  2A87 A;  3QVR A;  1B5Q A;  3M0O A;  1OJT A;  1H83 A;  3VR8 A;  5LV9 A;  4A6N A;  2OA1 A;  4DSG A;  4CRT A;  3R9U A;  1YQ4 A;  1PN0 A;  2Z5Y A;  4ZCD A;  1E1L A;  1RP0 A;  3KPF A;  5EOW A;  3IF9 A;  4Z24 A;  3NYF A;  4NEW A;  4ECH A;  4USR A;  2X8H A;  1LTX R;  3UKP A;  1H6V A;  3ISH A;  3UKF A;  1PJ7 A;  2XDO A;  2BC1 A;  5HXI A;  3GWF A;  2YR4 A;  2BS2 A;  2XFQ A;  1LVL A;  3KU9 A;  3VR9 A;  1YKJ A;  2Q0K A;  3KVE A;  3EAO A;  1XDI A;  1EBD A;  2XLS A;  3UOZ A;  1QDB A;  3CGB A;  2BXR A;  4B64 A;  3AE7 A;  4Z44 A;  3V3N A;  4EM4 A;  5J60 A;  3QSE A;  3SZW A;  3UCL A;  3P9U A;  2BK5 A;  3Q6J A;  3F8P A;  3H8L A;  5IQ4 A;  1GND A;  3FBS A;  4FX9 A;  2OLN A;  3V3O A;  1TDO A;  2VZ2 A;  3P4Q A;  5BUL A;  1BKW A;  2BS4 A;  1COY A;  1M1P A;  4GCM A;  1W4X A;  4APN A;  3DK8 A;  2K3V A;  1CC2 A;  4AP1 A;  2GAH B;  1O94 A;  1VRQ B;  4AOX A;  4ADW A;  1L9E A;  1EL9 A;  1QO8 A;  3LZW A;  4OPI A;  3KD9 A;  1LV0 A;  2IVE A;  3H4K A;  5CKU A;  1QJD A;  1CC6 A;  2YG6 A;  3NK2 X;  1D7L A;  1RSG A;  1IUW A;  1XPQ A;  4Q17 A;  3BHF A;  2BK4 A;  4K2X A;  3HYW A;  4OPL A;  4XWZ A;  3SM8 A;  5JCM A;  3SZ0 A;  4AP3 A;  2GF3 A;  3NRN A;  4LII A;  5KMR A;  1H7W A;  4M52 A;  3ATR A;  1KSU A;  1L0V A;  3F8R A;  4JDR A;  1N4W A;  1TYP A;  2YLR A;  4A79 A;  4BK2 A;  4TLX A;  4X9M A;  2C66 A;  4NTE A;  4USQ A;  5KVH A;  1GSN A;  4OPC A;  1REO A;  1NG3 A;  4Q5B A;  1KNP A;  4NWZ A;  1PBE A;  1QLB A;  3IC9 A;  4DSH A;  4GDP A;  3BNF A;  3L8K A;  5JCI A;  4OPG A;  2CVJ A;  2WEU A;  2WOI A;  3AED A;  3EF6 A;  4A6N B;  2X8C A;  1IUU A;  4H4U A;  3KA7 A;  4Q0T A;  5IQ1 A;  2C3D A;  1E1M A;  3RKH A;  3C4N A;  1H86 A;  3AE6 A;  4EMW A;  5M10 A;  1DNC A;  2BC0 A;  1NHS A;  4H4Y A;  2BXS A;  2XFP A;  4OPD A;  3LOV A;  2QA1 A;  1D7Y A;  2BCG G;  1LQT A;  3GYI A;  1N1P A;  2BK3 A;  1JNI A;  5GRT A;  4H4T A;  1AOG A;  5JCN A;  4A99 A;  5KWF A;  1X31 B;  3NG7 X;  4O5U A;  1PHH A;  3JSK A;  4UDR A;  4MJW A;  3DH9 A;  4EQS A;  2OAL A;  4N9X A;  2XVH A;  4YSY A;  4AT0 A;  3H8I A;  3GRS A;  5BVA A;  2EQ8 A;  3FMW A;  2OLO A;  2VVL A;  3I6D A;  2OT4 A;  3ZDN A;  1BVB A;  1CJC A;  1VDC A;  2E81 A;  2HQM A;  2VRM A;  2E80 A;  1CJ2 A;  2WOW A;  3FG2 P;  3ADA B;  2YVG A;  5FS9 A;  3AB1 A;  3CPI G;  3NYE A;  2R4J A;  1JNR A;  2XFU A;  1RYI A;  3AE5 A;  3DA1 A;  1SEZ A;  2WDR A;  2FJB A;  2R46 A;  1TYT A;  3CPH G;  2AAQ A;  2EQ7 A;  2FJA A;  3MMO A;  3BNM A;  3OZ2 A;  3V76 A;  3UOX A;  3PVC A;  4A5L A;  2Y6Q A;  3EAN A;  2GMH A;  1JOA A;  2YVJ A;  2C72 A;  2E1M A;  2FBW A;  1CC4 A;  1Q1W A;  2WOV A;  4K7Z A;  3RP8 A;  4NEV A;  5J7X A;  4G73 A;  1PDH A;  2A89 A;  2YG4 A;  1YY5 A;  4TM3 A;  1FL2 A;  4WJY A;  4PAA A;  4GF7 A;  3E1T A;  2E5V A;  5KVI A;  4UDQ A;  5KMQ A;  1P2E A;  1KNR A;  4EQX A;  3AEE A;  4NZH A;  3KKJ A;  1TDN A;  2Q6U A;  3AE3 A;  4JNQ A;  2YVF A;  4D04 A;  4EQW A;  3Q9T A;  1NDA A;  4U2S A;  3AE2 A;  3P1W A;  1JU2 A;  3S61 A;  4B69 A;  4U8J A;  1FOH A;  2APG A;  3L1T A;  3AD9 B;  3HYX A;  2C3C A;  3AXB A;  3FIM B;  3ICS A;  4Q4U A;  3COX A;  4YTN A;  3I3L A;  2ZZB A;  2XFN A;  2XVI A;  3BI5 A;  2AQJ A;  4EMI A;  5KMS A;  4H4V A;  2YM2 A;  4H4R A;  1FS9 A;  3NNE A;  1NAA A;  2R0G A;  4NNJ A;  2JB2 A;  2V6O A;  4J31 A;  1ZOY A;  1ONF A;  3QFA A;  3BI4 A;  1ZDL A;  2GR1 A;  5M0Z A;  3VRD B;  1KFY A;  1PBB A;  1IUT A;  1FT6 A;  3QVP A;  2GR0 A;  3BI2 A;  2WU2 A;  4Z2U A;  1K0J A;  5KMP A;  1JRY A;  4J33 A;  3VQR A;  4ICY A;  4UDP A;  3NGC X;  4H4Q A;  2GV8 A;  3K7M X;  3NHO X;  1GV4 A;  4FK1 C;  3VRA A;  1GRG A;  3UKK A;  1D4E A;  1E1N A;  2AR8 A;  2F5Z A;  4H7U A;  4C77 A;  2X50 A;  2R4E A;  3D1C A;  3QFB A;  3SY4 A;  3CPJ G;  3AE4 A;  3DGH A;  4UP3 A;  1S3E A;  4H4S A;  4EM3 A;  2YLX A;  4IA5 A;  3BNJ A;  2GQW A;  4H4W A;  1O95 A;  3T14 A;  2FJD A;  3GSI A;  4L38 A;  3NH3 X;  1NG4 A;  2VQB A;  3K30 A;  2XLP A;  1NPX A;  1B8S A;  2B76 A;  3BHK A;  5TR3 A;  3HYV A;  3GD4 A;  1D4D A;  2V3A A;  3T2K A;  5FS7 A;  2B7S A;  1MO9 A;  2XLT A;  1ZMD A;  1ZMC A;  3AE8 A;  3S5W A;  1ZX9 A;  1DOE A;  1OJC A;  1FEB A;  3NLC A;  3SZC A;  1JEH A;  2QAE A;  3CIR A;  1L9C A;  3VRB A;  3ALL A;  4DNA A;  1SP3 A;  1FS7 A;  3GMB A;  1TDF A;  1DOD A;  3ATQ A;  1ZKQ A;  3ICT A;  3L1R A;  3PO7 A;  4GAP A;  4GDE A;  4L3Z A;  3LXD A;  3SGL A;  4YSX A;  2VOU A;  3DGZ A;  3P4P A;  4IVM B;  2WU5 A;  4J2W A;  2GR3 A;  2XFO A;  3AYI A;  5U63 A;  3T37 A;  1DOC A;  2WP6 A;  3UU9 A;  2YAU A;  4Y4N A;  2YWL A;  2GB0 A;  3ICR A;  4AOS A;  2WES A;  3UTE A;  1PBC A;  2JB1 A;  5GSN A;  2RGJ A;  3CN8 A;  4HB9 A;  3BNH A;  3NYC A;  4CCR A;  3GRT A;  3UOV A;  3UTH A;  4B66 A;  1F8W A;  3UP4 A;  3LGQ A;  4YT0 A;  4GR1 A;  4TM4 A;  1OJ9 A;  3NKS A;  3SFD A;  2X3N A;  3QJ4 A;  2RGH A;  5FS6 A;  4YTP A;  3LG1 A;  2VVL G;  2C75 A;  3AYJ A;  1NEK A;  4J56 A;  4H2R A;  1B37 A;  3C4A A;  3ABV A;  2TPR A;  3M13 A;  1DJN A;  2GAG B;  4J36 A;  3QSM A;  4TM0 A;  4X4J A;  1VG0 A;  1H82 A;  4RG3 A;  3D1I A;  1DJQ A;  5KOX A;  2ZZ0 A;  2ARD A;  2VR0 A;  4BK3 A;  1DOB A;  1F8S A;  5HY5 A;  1CBO A;  2XLU A;  2WP9 A;  3IWA A;  3F29 A;  1K0I A;  3ALM A;  1LPF A;  4L3X A;  3UBR A;  2EQ9 A;  4LU6 A;  4TLZ A;  4G74 A;  1LJ1 A;  1FEC A;  4B65 A;  4C5O A;  3G5Q A;  4Z43 A;  1PXC A;  1CJ4 A;  2YLW A;  4FDC B;  5U25 A;  1ZK7 A;  3AEG A;  3GYJ A;  3LAD A;  1GXF A;  4CNJ A;  3G5R A;  2YR6 A;  4YWO A;  3CGC A;  1EL8 A;  2WHD A;  2OAM A;  1PBF A;  2GQF A;  2YLT A;  1BWC A;  2B9W A;  3SXQ A;  3CND A;  2NPX A;  4CCQ A;  1NHP A;  1GU6 A;  3G5S A;  3RP7 A;  3DJG X;  2RGO A;  3IHM A;  4H2N A;  2IID A;  2C65 A;  4H2P A;  3P4S A;  5FS8 A;  5KXJ A;  5ER0 A;  2LFC A;  3CNS A;  1OJA A;  2YLZ A;  4JNA A;  3AE9 A;  3K7Q X;  2CDU A;  1V59 A;  5U1O A;  4AT2 A;  4HA6 A;  4B1B A;  1Y0P A;  2UZZ A;  2NVK X;  1K0L A;  2XLR A;  3GD3 A;  4Z2R A;  5KRQ A;  1FS8 A;  1GAL A;  3AEC A;  3CTY A;  4K22 A;  3SX6 A;  4X9N A;  4U8L A;  1LQU A;  4EMJ A;  2R0C A;  3DJJ A;  1IUX A;  2BRY A;  3SYI A;  1H81 A;  1M1Q A;  2TMD A;  3AE1 A;  4Y4L A;  1Y56 A;  5DBJ A;  4Y4M A;  2BYB A;  3DJE A;  3AD7 B;  4BJZ A;  1CHU A;  2Z5X A;  1N4V A;  2RAB A;  1NHQ A;  2VQ7 A;  4U8K A;  3UTG A;  4EQR A;  2WBA A;  2J7A A;  5JCK A;  1GTH A;  3UKL A;  4BUR A;  3CNJ A;  2WS3 A;  1FEA A;  4A9W A;  1IUS A;  3CNT A;  4B63 A;  5KOW A;  2B9Y A;  1Q1R A;  1ZY8 A;  1IJH A;  2EQ6 A;  1EL5 A;  1E39 A;  3ZYX A;  2R0P A;  1PJ6 A;  5EB4 A;  3NK0 X;  1EL7 A;  3SZF A;  5HYM A;  1GRT A;  3O0H A;  3SQP A;  3FO3 A;  3DME A;  4L3Y A;  3UP5 A;  2ACZ A;  1JNZ A;  1XAN A;  2BS3 A;  2YG3 A;  3II4 A;  5EB5 A;  5KNL A;  4OVI A;  1GT8 A;  1PXA A;  4C3X A;  3ALJ A;  4I59 A;  3NT6 A;  4LA1 A;  4Z2T A;  5L46 A;  3AEA A;  2WDV A;  2H89 A;  2X99 A;  1XHC A;  2WPC A;  4OPU A;  3SXI A;  5IPY A;  2ZBW A;  2BCP A;  4DGK A;  2Q0L A;  4II2 A;  4KX6 A;  3CGD A;  2V60 A;  2C4C A;  4K5S A;  2C67 A;  3LZX A;  4NTC A;  1GRF A;  2RF7 A;  3GWD A;  2DKH A;  1D5T A;  3OC4 A;  2YG5 A;  1TDE A;  1YQ3 A;  2GVC A;  1PBD A;  2GEW A;  3P4R A;  1PS9 A;  3DK4 A;  1FT5 A;  1CF3 A;  3BNU A;  2QA2 A;  4YKF A;  3UKH A;  1UKV G;  2JKC A;  3BNG A;  4U2L A;  4IVO B;  2C76 A;  1N4U A;  4EIP A;  2V5Z A;  3KLJ A;  2R9Z A;  3WE0 A;  3OWM A;  4G6G A;  2XYO A;  3TTB A;  2JB3 A;  4G9K A;  3K7T A;  3LJP A;  4JY3 A;  1BZL A;  3C96 A;  1BF3 A;  2YM1 A;  4YKG A;  3RED A;  4H50 A;  1S2Y A;  3DJD A;  1Y56 B;  1OAH A;  2VVM A;  1BGJ A;  5C3J A;  2GH5 A;  1GES A;  2WDQ A;  4IV9 A;  2R45 A;  4CY6 A;  3GDP A;  2A8X A;  2VRL A;  4K8D A;  1L9D A;  2BAC A;  2FJE A;  4BJY A;  4H2Q A;  2QCU A;  2WET A;  3CNP A;  1NHR A;  1OJD A;  3DK9 A;  1S3B A;  5C2T A;  2XVJ A;  1F3P A;  1ZOV A;  1D4C A;  4GUV A;  2WPF A;  3T0K A;  1JRX A;  1B4V A;  3AYL A;  1S2Q A;  4JQ9 A;  4OCG A;  2X8G A;  4RG4 A;  4KPR A;  4U8I A;  3FPZ A;  4U2T A;  1F8R A;  5EBK A;  1E1K A;  3UKQ A;  3NN0 X;  4XXG A;  4U8P A;  3F8D A;  3GYX A;  4ZCC A;  4U8N A;  1GEU A;  2B9X A;  2RDZ A;  4TM1 A;  2Q7V A;  3AWI A;  3T2Y A;  4A7A A;  4J34 A;  4H4X A;  1MOK A;  3QSS A;  1ZP0 A;  1TDK A;  2IVD A;  1GTE A;  3M12 A;  4WCT A;  1O5W A;  2JBV A;  2W0H A;  1GRB A;  3T2Z A;  3SFE A;  3B6D A;  5CQF A;  3URH A;  4C74 A;  1M1R A;  4CY8 A;  4Z26 A;  4G6H A;  1CL0 A;  3D8X A;  4YSH A;  2JAE A;  3EPT A;  3NK1 X;  3HZL A;  3PS9 A;  2BAB A;  1GPE A;  1DXL A;  1TRB A;  3GMC A;  2GR2 A;  3RP6 A;  1GET A;  4YTM A;  1P2H A;  2ZO5 A;  4J57 A;  1FCD A;  3KPK A;  1K4Q A;  4K5R A;  3NTD A;  4H4Z A;  4OPT A;  3UOY A;  1KSS A;  3UTF A;  3B3R A;  1GRE A;  4GRT A;  2C7G A;  2XVF A;  2Y6R A;  3UKA A;  1KDG A;  2DKI A;  2C64 A;  3TOR A;  2GMJ A;  4A65 A;  2C73 A;  4Q5C A;  4CBQ A;  4Q1O A;  1GOS A;  2BA9 A;  1PJ5 A;  4BK1 A;  3CGE A;  3CMM A;  2YLS A;  3GDN A;  4YXD A;  2XVE A;  4II3 A;  2XCG A;  4O5Q A;  3S7W A;  4GAV A;  4D03 A;  1ELI A;  3NN6 X;  1JRZ A;  1GRA A;  1F6M A;  1KF6 A;  4B67 A;  1Z6L A;  2PYX A;  1VQW A;  1GRH A;  1YQZ A;  4PAB A;  4ZN0 A;  1VG9 A;  3AEF A;  5BRT A;  1M6I A;  4WX1 A;  2CFY A;  2I0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...