1E39A

Flavocytochrome c3 from shewanella frigidimarina histidine 365 mutated to alanine
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAAPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of the Active Site Acid/Base Catalyst in a Bacterial Fumarate Reductase: A Kinetic and Crystallographic Study
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
total genus 196
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1e39A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1e39A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1e39A01
1EBDA 2BYBA 2IIDA 3CGCA 1JRZA 1HYUA 2C7GA 2WU2A 2GF3A 1F8SA 2V61A 4OPIA 1H7WA 4USRA 3M12A 1D5TA 1E1NA 1TRBA 3ATRA 4A79A 5IQ4A 1GOSA 3LGQA 2XLRA 2YR4A 2FJDA 3AE8A 2RGOA 2CFYA 2V5ZA 3BHFA 2B76A 3ICTA 5J7XA 3DK9A 4EQRA 1B37A 4JQ9A 2QAEA 3UOZA 2K3VA 4OPCA 1M6IA 1K4QA 3NK2X 1REOA 3UKKA 4U8MA 1X31B 4BK1A 2BK4A 2JB3A 4AP3A 1XANA 3REDA 1S3BA 4U8PA 3AEAA 4IVOB 1DODA 3SFEA 2GMJA 2TMDA 1CJ3A 4K5RA 2BXSA 1IUWA 3UOYA 1TYTA 2XDOA 1CL0A 5JCMA 1O5WA 3P4SA 2JKCA 4U8IA 3NKSA 4YWOA 3DJEA 1JEHA 4CCQA 3UKFA 1NG3A 4EQSA 3AEBA 2Q0KA 4BURA 5HYMA 2X8GA 4ZCCA 3RNMA 4EM3A 4AOXA 3L1TA 1GPEA 3BNFA 3CNSA 4HA6A 3IHGA 4OCGA 1H6VA 1SEZA 3BNJA 4Q1OA 1GERA 4O5QA 3I6DA 2GQWA 3UKLA 4J2WA 1VG0A 3NHOX 1DOEA 3DA1A 1GTHA 2H88A 3G5SA 3QVRA 5BULA 4Q4UA 3AEFA 1GRHA 2FJEA 1PBFA 4GDPA 3SCEA 1EL7A 1KF6A 3RP6A 3ALMA 1CF3A 2VQBA 4AOSA 3II4A 3LB8A 5EB4A 2WEUA 3UP5A 1FOHA 2VZ2A 2Z5YA 2BACA 5U1OA 5KRQA 4YTNA 3NIXA 3IC9A 3OWMA 2X8CA 3R9UA 2E81A 2YLZA 4A9WA 1BGJA 5KXJA 1DJNA 2BC0A 4J36A 5KWFA 3ITJA 4Z2TA 1VQWA 5GSNA 4U2SA 3CIRA 4H7UA 3NTAA 3ZDNA 1CC4A 1H82A 4Y4NA 4B1BA 4E0VA 1YQ4A 2EQ8A 2YLTA 3B6DA 3AYLA 3NLCA 4YXDA 3AEEA 1NHQA 2GAGB 4Y4MA 3ALLA 1M1RA 3ICSA 1PS9A 3QFAA 3IF9A 1E1KA 1DJQA 3S7WA 1LPFA 1DXLA 1NHSA 2YLWA 5KVIA 1GSNA 1IUXA 2GH5A 3PO7A 3UOXA 4A6NA 1PBCA 2JBVA 4ADWA 1L9EA 1ZX9A 4LA1A 1EL5A 5LV9A 1UKVG 1GALA 1VDCA 4BK3A 3D1CA 4KX6A 3CPHG 4Z2RA 4TM1A 1JNIA 4AT0A 4DSGA 4U8NA 2FJAA 3GDPA 1QDBA 2JK6A 3UTFA 2C65A 1GRFA 3AD9B 4OPLA 2XFNA 3V76A 3ZYXA 1S2YA 1B8SA 3FMWA 3NG7X 1B4VA 1CBOA 2CULA 4L3YA 2WOIA 2YG3A 3SFDA 2E5VA 1ZY8A 2J7AA 1LTXR 2R46A 2WPFA 3DMEA 2C76A 2PYXA 3C96A 4I59A 4OPUA 4YSXA 2GV8A 3COXA 4N9XA 3MMOA 1FS9A 1PHHA 2GMHA 3NT6A 2XVJA 4PAAA 3CN8A 2O9ZA 2WDRA 3AXBA 2B7SA 4GF7A 2Q0LA 1QJDA 4BJYA 2Q7VA 2JB2A 1KSSA 3BHKA 3GMCA 2R9ZA 3BNGA 1DOBA 3NGCX 1F6MA 2YVGA 1GESA 5BUKA 2Y6QA 3CGEA 1O94A 1ZP0A 3AE9A 4K7ZA 1GREA 1PN0A 1V59A 1H86A 3NN6X 4HB9A 2C72A 4LU6A 1LJ1A 1N4VA 1FS7A 1LVLA 3UP4A 1GEUA 4J33A 4C3YA 1DOCA 2E80A 1F3PA 2BK5A 3DK4A 3C4NA 3BNMA 3F8PA 4TLXA 1QO8A 2WS3A 2YAUA 5HHFA 5M10A 3NYFA 5EB5A 2YG6A 1COYA 3UKHA 2XLTA 1D7LA 4MJWA 2XVEA 4BJZA 1D4EA 1JNRA 1TDEA 1F8RA 3NRNA 4IA6A 1H83A 4Q0TA 1GRAA 4XXGA 2AR8A 3CGDA 4OPTA 4ECHA 2DKHA 1BKWA 1RP0A 2WOVA 3Q6JA 3CNDA 3DGZA 3NTDA 1NPXA 2YM1A 2V60A 4B69A 1GU6A 4Z24A 1PXBA 3E1TA 4FK1A 1BVBA 4M52A 2I0ZA 3SXQA 3VRDB 3TORA 1PBEA 4EMJA 5IPYA 1ZOYA 2AQJA 1PBBA 4Q5BA 3BNHA 3GM6A 1OJ9A 3RHAA 4U2LA 1GETA 1N4WA 2VRMA 3NN0X 4Q17A 2A87A 4C77A 4H50A 5C2TA 5BRTA 1L9CA 4EMWA 1L0VA 2JAEA 4J31A 3SGLA 4TM4A 4FK1C 1Y56B 1BF3A 1OJTA 4B64A 1YKJA 1MOKA 3UBRA 2WP6A 2C64A 4U8JA 5ER0A 5U63A 2CVJA 2XFQA 1FEAA 4Q5CA 1OJDA 5J60A 2WOWA 5BVAA 2GB0A 2VR0A 3RP8A 3VR8A 3QSEA 4IVMB 3P1WA 2DKIA 2E4GA 4EM4A 1NHRA 2C70A 1Q1RA 2VOUA 2GR1A 3P4QA 2RF7A 2A8XA 3URHA 3AYIA 1ELIA 4CRTA 2Q6UA 4REKA 3EAOA 1FT6A 3EANA 3FBSA 4J57A 2XFOA 4H2PA 4TM0A 5JCKA 1ZK7A 5U25A 2GR0A 2XLUA 2YR5A 1GTEA 3K7MX 4B67A 3AEDA 1YQ3A 5DBJA 1CJ2A 3K30A 3EPTA 4JNAA 4DGKA 3P9UA 2JB1A 2CDUA 2XFUA 3L1RA 1GV4A 4YTPA 2WP9A 1MXTA 4X4JA 1BZLA 3GRTA 4USQA 1K0LA 2V3AA 1TDKA 1H81A 1EL8A 3UOVA 3BI5A 3CGBA 2BS4A 3RP7A 3CNJA 4C5OA 3LG1A 1YY5A 4GDEA 2XLPA 5FS6A 3AE2A 3HZLA 3S61A 2WQYA 2ZZBA 2GQFA 3CTYA 4BV6A 1LQUA 3FG2P 2VRLA 4K5SA 5FS8A 4CCRA 1H84A 3K7TA 4L38A 4APNA 1O95A 2YG4A 2BS2A 4WX1A 2R0CA 4JY3A 4C3XA 2HQMA 3ATQA 3FPZA 4AT2A 4JNQA 3H4KA 4D03A 3KLJA 1KSUA 1P2HA 1PBDA 2OT4A 4H4RA 4L3XA 3ISHA 1E39A 3NH3X 4RG4A 4B66A 2WPCA 3VRBA 4NEVA 4GCMA 2GR3A 3UTGA 1MO9A 1M64A 1PXCA 3TTBA 2BS3A 3DJJA 1GRBA 4Z25A 1ZMCA 2FBWA 3BI4A 5KOWA 4BK2A 2IVDA 5FS7A 1NAAA 3P4RA 3F8DA 3DH9A 3FIMB 3KKJA 4XWRA 1TDOA 3IHMA 2C67A 2GR2A 4EIQA 2APGA 3JSKA 1Q1WA 4H4PA 3D1IA 2YLRA 2WESA 2WU5A 3ADAB 2EQ9A 4H4QA 1DNCA 4K2XA 4PABA 4YSHA 3KVEA 2LFCA 2ZBWA 2VVMA 3VRAA 3QSMA 1OJAA 3AECA 4RSLA 2YWLA 1ZKQA 3LJPA 4YKFA 1Q9IA 5L46A 1IJHA 3G5QA 4CY6A 4A65A 1JOAA 3B3RA 3QFBA 1W4XA 4YT0A 2QCUA 1FECA 5JCIA 3AB1A 3O0HA 4U2TA 5GRTA 2X3NA 2XLSA 5M0ZA 4H4TA 3DGHA 1QLBA 2YQUA 4CBQA 4UP3A 1FS8A 2OALA 3UKQA 1NDAA 3ALJA 2RDZA 4H2RA 2WETA 3VR9A 2AAQA 4LIIA 2GRTA 2WP5A 3BI2A 2C73A 4FX9A 4OPDA 4H4UA 3KA7A 3RKHA 1LQTA 2YG7A 5CKUA 1CJCA 4A6NB 2C3DA 4IA5A 1Z6LA 3OZ2A 1IUTA 3DJDA 4EQWA 4Z44A 3AE3A 1Y56A 3M13A 1VG9A 3GDNA 3UU9A 1S3EA 2VVLA 4H2QA 2E1MA 2VQ7A 2YG5A 3K7QX 3CNPA 1VRQB 1N4UA 2GEWA 3LZWA 4ICYA 1B5QA 1CJ4A 5JCLA 3AE7A 2X99A 4B63A 2B7RA 1PJ7A 4A5LA 2BABA 2NVKX 2ZZCA 2R45A 1D4CA 2EQ6A 3QSSA 2FJBA 2YM2A 4U8LA 3S5WA 2R4EA 3V3NA 2VVLG 4U8KA 5CQFA 2B9YA 3NYCA 2RGHA 5C3JA 2XVHA 4EQXA 4Z2UA 3GYJA 1F8WA 1ZOVA 4X9MA 5FMHA 3GSIA 1K0JA 3KU9A 3AE4A 5KVHA 1BWCA 3M0OA 2YVFA 2OAMA 4TM3A 2XCGA 4YSZA 1IUSA 5EOWA 4DNAA 4NEWA 3AE6A 2RGJA 3AEGA 3GWDA 1D4DA 5FS9A 2XYOA 3F8RA 4Y4LA 1JU2A 1S2QA 4NZHA 2BA9A 2X8HA 3H8LA 2B9XA 3GWFA 4H4WA 3PVCA 2OLOA 4H4SA 4UDPA 5IQ1A 1CC2A 4O5UA 4KPRA 2ZO5A 2ZZ0A 3LZXA 2WBAA 3LOVA 3NYEA 1LV0A 3NK1X 1AOGA 1NENA 1OJCA 2YR6A 1P2EA 1EL9A 3WE0A 4I58A 3BNUA 1SP3A 1TDNA 3G5RA 4H4YA 1GNDA 5EBKA 4CY8A 3Q9TA 1GRTA 3V3OA 3NNEA 4JN9A 1KNPA 3D8XA 3P4PA 2V3BA 3AE1A 3KD9A 4J56A 4RG3A 4UDRA 3KPFA 2C75A 4ZCDA 4AP1A 3T37A 4CNKA 2BC1A 4H2NA 4ZN0A 1M1PA 1OAHA 4FDCB 4GRTA 2R4JA 2W0HA 2YLXA 3DJGX 1KFYA 3F29A 4JDRA 3GMBA 4WCTA 3AD8B 2XVIA 4A7AA 4J34A 3GD3A 1ZDLA 2WPEA 2EQ7A 1FCDA 1TDFA 2OA1A 4K8DA 1ONFA 3ABVA 3GD4A 4NTCA 4WJYA 2Y6RA 1IUVA 2XFPA 4P9SA 4NTDA 3ICRA 1K0IA 1NEKA 1FEBA 2RABA 4Z43A 5HXIA 2R0GA 1GXFA 3UKAA 4UDQA 2C66A 2GVCA 3NK0X 4H4ZA 2QA1A 4OVIA 4L3ZA 4XWZA 1IUUA 3DK8A 1CHUA 1D7YA 4YTMA 4B65A 1FL2A 1JRXA 3FO3A 3SM8A 1L9DA 2A89A 4B68A 4EIPA 2R0PA 1PXAA 2Z5XA 2TPRA 2BCPA 1BGNA 3EF6A 2XVFA 3IWAA 4CNJA 3UTHA 1JRYA 1M1QA 2BCGG 2H89A 1XPQA 3AYJA 3AE5A 1PJ5A 2BXRA 2QA2A 1CC6A 2B9WA 1E6EA 3AD7B 2X50A 3CPIG 4K22A 3UTEA 1KDGA 1NG4A 3H8IA 4C74A 3LADA 3OC4A 2GAHB 3QVPA 4D04A 4DSHA 4EMIA 5KOXA 3VQRA 3GYIA 1H7XA 2WHDA 3L8KA 2PHHA 2F5ZA 4GUVA 3GYXA 2YLSA 1E1LA 2WDVA 2YVJA 2J3NA 5TR3A 3UCLA 2ACZA 2ARDA 2C3CA 1KNRA 1TYPA 4H4VA 1PDHA 1NHPA 1RYIA 4Z26A 1XDIA 2OLNA 2UZZA 1Y0PA 3CPJG 4H4XA 4NTEA 2IVEA 4GR1A 3C4AA 1N1PA 4OPGA 4U8OA 3SQPA 3GRSA 1PJ6A 3PS9A 1E1MA 4X9NA 1XHCA 3QJ4A 1E7PA 4IV9A 4JY2A 1ZMDA 2NPXA 3LXDA 5JCNA 1JNZA 5HY5A 4A99A 4YSYA 1FT5A 3UKPA 1YQZA 4YKGA 2V6OA 3CNTA 4TLZA 1RSGA 2BK3A 3AWIA 1GRGA 3I3LA 2WDQA 1GT8A
chains in the Genus database with same CATH superfamily
1EBDA 2BYBA 2IIDA 3CGCA 1JRZA 1HYUA 2C7GA 2WU2A 2GF3A 1F8SA 2V61A 4OPIA 1H7WA 4USRA 3M12A 1D5TA 1E1NA 1TRBA 3ATRA 4A79A 5IQ4A 1GOSA 3LGQA 2XLRA 2YR4A 2FJDA 3AE8A 2RGOA 2CFYA 2V5ZA 3BHFA 2B76A 3ICTA 5J7XA 2BRYA 3DK9A 4EQRA 1B37A 4JQ9A 2QAEA 3UOZA 2K3VA 3T31A 4OPCA 1M6IA 1K4QA 3NK2X 1REOA 3UKKA 4U8MA 1X31B 4BK1A 2BK4A 2JB3A 4AP3A 1XANA 3REDA 1S3BA 4U8PA 3AEAA 4IVOB 1DODA 3SFEA 2CZSA 2GMJA 2TMDA 1CJ3A 4K5RA 2BXSA 1IUWA 3UOYA 1TYTA 2XDOA 1CL0A 5JCMA 1O5WA 3P4SA 2JKCA 4U8IA 3NKSA 4YWOA 3DJEA 1JEHA 4CCQA 3UKFA 1NG3A 4EQSA 3AEBA 2Q0KA 4BURA 5HYMA 2X8GA 4ZCCA 3RNMA 4EM3A 4AOXA 3L1TA 1GPEA 3BNFA 3CNSA 4HA6A 3IHGA 4OCGA 1H6VA 3CMMA 1SEZA 3BNJA 4Q1OA 1GERA 4O5QA 3I6DA 2GQWA 3UKLA 4J2WA 1VG0A 3NHOX 3T0KA 1DOEA 3DA1A 1GTHA 2H88A 3G5SA 3QVRA 5BULA 4Q4UA 3AEFA 1GRHA 2FJEA 1PBFA 4GDPA 3SCEA 1EL7A 1KF6A 3RP6A 3ALMA 5KMSA 1CF3A 2VQBA 4AOSA 3II4A 3LB8A 5EB4A 2WEUA 3UP5A 1FOHA 2VZ2A 2Z5YA 2BACA 5U1OA 5KRQA 4YTNA 3NIXA 3IC9A 3OWMA 2X8CA 3R9UA 2E81A 2YLZA 4A9WA 1BGJA 5KXJA 1DJNA 2BC0A 4J36A 5KWFA 3ITJA 4Z2TA 1VQWA 5GSNA 4U2SA 3CIRA 4H7UA 3NTAA 3ZDNA 1CC4A 1H82A 4Y4NA 4B1BA 4E0VA 1YQ4A 2EQ8A 2YLTA 3B6DA 3AYLA 3NLCA 4YXDA 3AEEA 1NHQA 2GAGB 4Y4MA 3ALLA 1M1RA 3ICSA 1PS9A 3QFAA 3IF9A 1E1KA 1DJQA 3S7WA 1LPFA 1DXLA 1NHSA 2YLWA 5KVIA 1GSNA 1IUXA 2GH5A 3PO7A 3UOXA 4A6NA 1PBCA 2JBVA 4ADWA 1L9EA 1ZX9A 4LA1A 1EL5A 5LV9A 1UKVG 1GALA 1VDCA 4BK3A 3D1CA 4KX6A 3CPHG 4Z2RA 4TM1A 1JNIA 4AT0A 4DSGA 4U8NA 2FJAA 3GDPA 1QDBA 2JK6A 3UTFA 2C65A 1GRFA 3AD9B 4OPLA 2XFNA 3V76A 3ZYXA 1S2YA 1B8SA 3FMWA 3NG7X 1B4VA 1CBOA 2CULA 4L3YA 2WOIA 2YG3A 3SFDA 2E5VA 1ZY8A 2J7AA 1LTXR 2R46A 3HYXA 2WPFA 3DMEA 2C76A 2PYXA 3C96A 4I59A 4OPUA 4YSXA 2GV8A 3COXA 4N9XA 3MMOA 1FS9A 1PHHA 2GMHA 3NT6A 2XVJA 4PAAA 3CN8A 2O9ZA 2WDRA 3AXBA 2B7SA 4GF7A 2Q0LA 1QJDA 4BJYA 4GAPA 2Q7VA 2JB2A 1KSSA 3BHKA 3GMCA 2R9ZA 3BNGA 1DOBA 3NGCX 1F6MA 3SZFA 2YVGA 1GESA 5BUKA 2Y6QA 3CGEA 1O94A 1ZP0A 3AE9A 4K7ZA 1GREA 1PN0A 1V59A 1H86A 3NN6X 4HB9A 2C72A 4LU6A 1LJ1A 1N4VA 1FS7A 1LVLA 3UP4A 1GEUA 4J33A 4C3YA 1DOCA 2E80A 1F3PA 2BK5A 3DK4A 3C4NA 3BNMA 3F8PA 4TLXA 1QO8A 2WS3A 2YAUA 5HHFA 5M10A 3NYFA 5EB5A 2YG6A 1COYA 3UKHA 2XLTA 1D7LA 4MJWA 2XVEA 4BJZA 1D4EA 1JNRA 1TDEA 1F8RA 3NRNA 4IA6A 1H83A 4Q0TA 1GRAA 5KMQA 4XXGA 2AR8A 3CGDA 4OPTA 4ECHA 2DKHA 1BKWA 1RP0A 2WOVA 3Q6JA 3CNDA 3DGZA 3NTDA 1NPXA 2YM1A 2V60A 4B69A 1GU6A 4Z24A 1PXBA 3E1TA 4FK1A 1BVBA 4M52A 2I0ZA 3SXQA 3VRDB 3TORA 1PBEA 4EMJA 5IPYA 1ZOYA 2AQJA 1PBBA 4Q5BA 3BNHA 3GM6A 3SZCA 1OJ9A 3RHAA 4U2LA 1GETA 1N4WA 2VRMA 3NN0X 4Q17A 2A87A 4C77A 4H50A 5C2TA 5BRTA 1L9CA 4EMWA 1L0VA 2JAEA 4J31A 3SGLA 4TM4A 4FK1C 1Y56B 1BF3A 1OJTA 4B64A 1YKJA 1MOKA 3UBRA 2WP6A 2C64A 4U8JA 5ER0A 5U63A 2CVJA 2XFQA 1FEAA 4Q5CA 1OJDA 5J60A 2WOWA 5BVAA 2GB0A 3T2YA 2VR0A 3RP8A 3VR8A 3QSEA 4IVMB 3P1WA 3SZWA 2DKIA 2E4GA 4EM4A 1NHRA 2C70A 1Q1RA 3SZ0A 2VOUA 2GR1A 3P4QA 2RF7A 2A8XA 3URHA 3AYIA 1ELIA 4CRTA 2Q6UA 4REKA 3EAOA 1FT6A 3EANA 3FBSA 4J57A 2XFOA 4H2PA 4TM0A 5JCKA 1ZK7A 5U25A 2GR0A 2XLUA 2YR5A 1GTEA 3K7MX 4B67A 3AEDA 1YQ3A 5DBJA 1CJ2A 3K30A 3EPTA 4JNAA 4DGKA 3P9UA 2JB1A 2CDUA 2XFUA 3L1RA 1GV4A 4YTPA 2WP9A 1MXTA 4X4JA 1BZLA 3GRTA 4USQA 1K0LA 2V3AA 3T2ZA 1TDKA 1H81A 1EL8A 3UOVA 3BI5A 3CGBA 2BS4A 3RP7A 3CNJA 4C5OA 3LG1A 1YY5A 4GDEA 2XLPA 5FS6A 3AE2A 3HZLA 3S61A 2WQYA 2ZZBA 2GQFA 3CTYA 4BV6A 1LQUA 3FG2P 2VRLA 4K5SA 5FS8A 4CCRA 1H84A 3K7TA 4G6HA 4L38A 4APNA 1O95A 2YG4A 2BS2A 4WX1A 2R0CA 4JY3A 4C3XA 2HQMA 3ATQA 3FPZA 4AT2A 4JNQA 3H4KA 4D03A 3KLJA 1KSUA 1P2HA 1PBDA 2OT4A 4H4RA 4L3XA 3ISHA 1E39A 3NH3X 4RG4A 4B66A 2WPCA 3VRBA 4NEVA 4GCMA 2GR3A 3UTGA 1MO9A 1M64A 1PXCA 3TTBA 2BS3A 3DJJA 1GRBA 4Z25A 1ZMCA 2FBWA 3BI4A 5KOWA 4BK2A 4G74A 2IVDA 5FS7A 4GAVA 1NAAA 3P4RA 3F8DA 3DH9A 3FIMB 3KKJA 3SYIA 4XWRA 1TDOA 3IHMA 2C67A 2GR2A 4EIQA 2APGA 3JSKA 1Q1WA 4H4PA 3D1IA 2YLRA 2WESA 2WU5A 3ADAB 2EQ9A 4H4QA 1DNCA 4K2XA 4PABA 4YSHA 3KVEA 2LFCA 2ZBWA 2VVMA 3VRAA 3QSMA 1OJAA 3AECA 4RSLA 2YWLA 1ZKQA 3LJPA 4YKFA 1Q9IA 5L46A 1IJHA 3G5QA 4CY6A 4A65A 1JOAA 3B3RA 3QFBA 1W4XA 4YT0A 2QCUA 3T14A 1FECA 5JCIA 3AB1A 3O0HA 4U2TA 5GRTA 2X3NA 2XLSA 5M0ZA 4H4TA 3DGHA 1QLBA 2YQUA 4CBQA 4UP3A 1FS8A 2OALA 3UKQA 1NDAA 3ALJA 2RDZA 4H2RA 2WETA 3VR9A 2AAQA 4LIIA 2GRTA 2WP5A 3BI2A 2C73A 4FX9A 4OPDA 4H4UA 3KA7A 3RKHA 1LQTA 2YG7A 5CKUA 1CJCA 4A6NB 2C3DA 4IA5A 1Z6LA 3OZ2A 1IUTA 3DJDA 4EQWA 4II2A 3AE3A 1Y56A 3M13A 1VG9A 4Z44A 3GDNA 3UU9A 1S3EA 2VVLA 4H2QA 2E1MA 2VQ7A 2YG5A 3K7QX 3CNPA 3SY4A 1VRQB 1N4UA 2GEWA 3LZWA 4ICYA 1B5QA 1CJ4A 5JCLA 3AE7A 2X99A 4B63A 2B7RA 1PJ7A 5KNLA 4A5LA 2BABA 2NVKX 2ZZCA 4II3A 2R45A 1D4CA 2EQ6A 3QSSA 2FJBA 2YM2A 4U8LA 3S5WA 2R4EA 3V3NA 2VVLG 4U8KA 5CQFA 2B9YA 4G9KA 3NYCA 2RGHA 5C3JA 2XVHA 4EQXA 4Z2UA 3GYJA 1F8WA 1ZOVA 4X9MA 5FMHA 3GSIA 1K0JA 3KU9A 3AE4A 5KVHA 1BWCA 3M0OA 2YVFA 2OAMA 4TM3A 2XCGA 4YSZA 1IUSA 5EOWA 4DNAA 4NEWA 3AE6A 2RGJA 3AEGA 3GWDA 1D4DA 5FS9A 2XYOA 3F8RA 4Y4LA 1JU2A 1S2QA 4NZHA 3T2KA 2BA9A 2X8HA 3H8LA 3HYVA 2B9XA 3GWFA 3HYWA 3PVCA 2OLOA 4H4WA 4H4SA 4UDPA 5IQ1A 1CC2A 4O5UA 4KPRA 2ZO5A 2ZZ0A 3LZXA 2WBAA 3LOVA 3NYEA 1LV0A 3NK1X 1AOGA 1NENA 1OJCA 2YR6A 1P2EA 1EL9A 3WE0A 4I58A 4NNJA 3BNUA 1SP3A 1TDNA 5KMRA 3G5RA 4H4YA 1GNDA 5EBKA 4CY8A 3Q9TA 1GRTA 3KPKA 3V3OA 3NNEA 4JN9A 1KNPA 3D8XA 3P4PA 2V3BA 3AE1A 3KD9A 4J56A 4RG3A 4UDRA 3KPFA 2C75A 4ZCDA 4AP1A 3T37A 4CNKA 2BC1A 4H2NA 4ZN0A 1M1PA 1OAHA 4FDCB 4GRTA 2R4JA 2W0HA 2YLXA 3DJGX 1KFYA 3F29A 4JDRA 3GMBA 4WCTA 3AD8B 2XVIA 4A7AA 4J34A 3GD3A 1ZDLA 2WPEA 2EQ7A 1FCDA 1TDFA 2BRAA 2OA1A 4K8DA 1ONFA 3ABVA 3GD4A 4NTCA 4WJYA 2Y6RA 1IUVA 2XFPA 4P9SA 4NTDA 3ICRA 1K0IA 1NEKA 1FEBA 2RABA 4Z43A 5HXIA 2R0GA 1GXFA 3UKAA 4UDQA 2C66A 2GVCA 3NK0X 4H4ZA 2QA1A 4OVIA 3SX6A 4L3ZA 4XWZA 1IUUA 3DK8A 1CHUA 1D7YA 4YTMA 4B65A 1FL2A 1JRXA 3FO3A 3SM8A 1L9DA 2A89A 4B68A 4EIPA 2R0PA 1PXAA 2Z5XA 2TPRA 2BCPA 1BGNA 3EF6A 2XVFA 3IWAA 4CNJA 3UTHA 1JRYA 1M1QA 2BCGG 2H89A 1XPQA 3AYJA 3AE5A 1PJ5A 2BXRA 2QA2A 1CC6A 2B9WA 1E6EA 3AD7B 2X50A 3CPIG 4K22A 3UTEA 1KDGA 1NG4A 3H8IA 4C74A 3LADA 3OC4A 2GAHB 3SXIA 2C4CA 3QVPA 4D04A 4DSHA 4EMIA 3VQRA 3GYIA 1H7XA 5KOXA 2WHDA 3L8KA 2PHHA 2F5ZA 3GYXA 4GUVA 2YLSA 4NWZA 1E1LA 2WDVA 2YVJA 2J3NA 5TR3A 3UCLA 2ACZA 2ARDA 2C3CA 1KNRA 1TYPA 4H4VA 1PDHA 5KMPA 1NHPA 1RYIA 4Z26A 1XDIA 2OLNA 2UZZA 1Y0PA 3CPJG 4H4XA 4NTEA 2IVEA 4GR1A 3C4AA 1N1PA 4OPGA 4U8OA 3SQPA 3GRSA 1PJ6A 3PS9A 1E1MA 4G6GA 4X9NA 1XHCA 3QJ4A 1E7PA 4IV9A 4JY2A 1ZMDA 4G73A 2NPXA 3LXDA 5JCNA 1JNZA 5HY5A 4A99A 4YSYA 1FT5A 3UKPA 1YQZA 4YKGA 2V6OA 3CNTA 4TLZA 1RSGA 2BK3A 3AWIA 1GRGA 3I3LA 2WDQA 1GT8A
chains in the Genus database with same CATH topology
1EBDA 2BYBA 2IIDA 3CGCA 1JRZA 1HYUA 2C7GA 2WU2A 2GF3A 1F8SA 2V61A 4OPIA 1H7WA 4USRA 3M12A 1D5TA 1E1NA 1TRBA 3ATRA 4A79A 5IQ4A 1GOSA 3LGQA 2XLRA 2YR4A 2FJDA 3AE8A 2RGOA 2CFYA 2V5ZA 3BHFA 2B76A 3ICTA 5J7XA 2BRYA 3DK9A 4EQRA 1B37A 4JQ9A 2QAEA 3UOZA 2K3VA 3T31A 4OPCA 1M6IA 1K4QA 3NK2X 1REOA 3UKKA 4U8MA 1X31B 4BK1A 2BK4A 2JB3A 4AP3A 1XANA 3REDA 1S3BA 4U8PA 3AEAA 4IVOB 1DODA 3SFEA 2GMJA 2TMDA 1CJ3A 4K5RA 2BXSA 1IUWA 3UOYA 1TYTA 2XDOA 1CL0A 5JCMA 1O5WA 3P4SA 2JKCA 4U8IA 3NKSA 4YWOA 3DJEA 1JEHA 4CCQA 3UKFA 1NG3A 4EQSA 3AEBA 2Q0KA 4BURA 5HYMA 2X8GA 4ZCCA 3RNMA 4EM3A 4AOXA 3L1TA 1GPEA 3BNFA 3CNSA 4HA6A 3IHGA 4OCGA 1H6VA 3CMMA 1SEZA 3BNJA 4Q1OA 1GERA 4O5QA 3I6DA 2GQWA 3UKLA 4J2WA 1VG0A 3NHOX 3T0KA 1DOEA 3DA1A 1GTHA 2H88A 3G5SA 3QVRA 5BULA 4Q4UA 3AEFA 1GRHA 2FJEA 1PBFA 4GDPA 3SCEA 1EL7A 1KF6A 3RP6A 3ALMA 5KMSA 1CF3A 2VQBA 4AOSA 3II4A 3LB8A 5EB4A 2WEUA 3UP5A 1FOHA 2VZ2A 2Z5YA 2BACA 5U1OA 5KRQA 4YTNA 3NIXA 3IC9A 3OWMA 2X8CA 3R9UA 2E81A 2YLZA 4A9WA 1BGJA 5KXJA 1DJNA 2BC0A 4J36A 5KWFA 3ITJA 4Z2TA 1VQWA 5GSNA 4U2SA 3CIRA 4H7UA 3NTAA 3ZDNA 1CC4A 1H82A 4Y4NA 4B1BA 4E0VA 1YQ4A 2EQ8A 2YLTA 3B6DA 3AYLA 3NLCA 4YXDA 3AEEA 1NHQA 2GAGB 4Y4MA 3ALLA 1M1RA 3ICSA 1PS9A 3QFAA 3IF9A 1E1KA 1DJQA 3S7WA 1LPFA 1DXLA 1NHSA 2YLWA 5KVIA 1GSNA 1IUXA 2GH5A 3PO7A 3UOXA 4A6NA 1PBCA 2JBVA 4ADWA 1L9EA 1ZX9A 4LA1A 1EL5A 5LV9A 1UKVG 1GALA 1VDCA 4BK3A 3D1CA 4KX6A 3CPHG 4Z2RA 4TM1A 1JNIA 4AT0A 4DSGA 4U8NA 2FJAA 3GDPA 1QDBA 2JK6A 3UTFA 2C65A 1GRFA 3AD9B 4OPLA 2XFNA 3V76A 3ZYXA 1S2YA 1B8SA 3FMWA 3NG7X 1B4VA 1CBOA 2CULA 4L3YA 2WOIA 2YG3A 3SFDA 2E5VA 1ZY8A 2J7AA 1LTXR 2R46A 3HYXA 2WPFA 3DMEA 2C76A 2PYXA 3C96A 4I59A 4OPUA 4YSXA 2GV8A 3COXA 4N9XA 3MMOA 1FS9A 1PHHA 2GMHA 3NT6A 2XVJA 4PAAA 3CN8A 2O9ZA 2WDRA 3AXBA 2B7SA 4GF7A 2Q0LA 1QJDA 4BJYA 4GAPA 2Q7VA 2JB2A 1KSSA 3BHKA 3GMCA 2R9ZA 3BNGA 1DOBA 3NGCX 1F6MA 3SZFA 2YVGA 1GESA 5BUKA 2Y6QA 3CGEA 1O94A 1ZP0A 3AE9A 4K7ZA 1GREA 1PN0A 1V59A 1H86A 3NN6X 4HB9A 2C72A 4LU6A 1LJ1A 1N4VA 1FS7A 1LVLA 3UP4A 1GEUA 4J33A 4C3YA 1DOCA 2E80A 1F3PA 2BK5A 3DK4A 3C4NA 3BNMA 3F8PA 4TLXA 1QO8A 2WS3A 2YAUA 5HHFA 5M10A 3NYFA 5EB5A 2YG6A 1COYA 3UKHA 2XLTA 1D7LA 4MJWA 2XVEA 4BJZA 1D4EA 1JNRA 1TDEA 1F8RA 3NRNA 4IA6A 1H83A 4Q0TA 1GRAA 5KMQA 4XXGA 2AR8A 3CGDA 4OPTA 4ECHA 2DKHA 1BKWA 1RP0A 2WOVA 3Q6JA 3CNDA 3DGZA 3NTDA 1NPXA 2YM1A 2V60A 4B69A 1GU6A 4Z24A 1PXBA 3E1TA 4FK1A 1BVBA 4M52A 2I0ZA 3SXQA 3VRDB 3TORA 1PBEA 4EMJA 5IPYA 1ZOYA 2AQJA 1PBBA 4Q5BA 3BNHA 3GM6A 3SZCA 1OJ9A 3RHAA 4U2LA 1GETA 1N4WA 2VRMA 3NN0X 4Q17A 2A87A 4C77A 4H50A 5C2TA 5BRTA 1L9CA 4EMWA 1L0VA 2JAEA 4J31A 3SGLA 4TM4A 4FK1C 1Y56B 1BF3A 1OJTA 4B64A 1YKJA 1MOKA 3UBRA 2WP6A 2C64A 4U8JA 5ER0A 5U63A 2CVJA 2XFQA 1FEAA 4Q5CA 1OJDA 5J60A 2WOWA 5BVAA 2GB0A 3T2YA 2VR0A 3RP8A 3VR8A 3QSEA 4IVMB 3P1WA 3SZWA 2DKIA 2E4GA 4EM4A 1NHRA 2C70A 1Q1RA 3SZ0A 2VOUA 2GR1A 3P4QA 2RF7A 2A8XA 3URHA 3AYIA 1ELIA 4CRTA 2Q6UA 4REKA 3EAOA 1FT6A 3EANA 3FBSA 4J57A 2XFOA 4H2PA 4TM0A 5JCKA 1ZK7A 5U25A 2GR0A 2XLUA 2YR5A 1GTEA 3K7MX 4B67A 3AEDA 1YQ3A 5DBJA 1CJ2A 3K30A 3EPTA 4JNAA 4DGKA 3P9UA 2JB1A 2CDUA 2XFUA 3L1RA 1GV4A 4YTPA 2WP9A 1MXTA 4X4JA 1BZLA 3GRTA 4USQA 1K0LA 2V3AA 3T2ZA 1TDKA 1H81A 1EL8A 3UOVA 3BI5A 3CGBA 2BS4A 3RP7A 3CNJA 4C5OA 3LG1A 1YY5A 4GDEA 2XLPA 5FS6A 3AE2A 3HZLA 3S61A 2WQYA 2ZZBA 2GQFA 3CTYA 4BV6A 1LQUA 3FG2P 2VRLA 4K5SA 5FS8A 4CCRA 1H84A 3K7TA 4G6HA 4L38A 4APNA 1O95A 2YG4A 2BS2A 4WX1A 2R0CA 4JY3A 4C3XA 2HQMA 3ATQA 3FPZA 4AT2A 4JNQA 3H4KA 4D03A 3KLJA 1KSUA 1P2HA 1PBDA 2OT4A 4H4RA 4L3XA 3ISHA 1E39A 3NH3X 4RG4A 4B66A 2WPCA 3VRBA 4NEVA 4GCMA 2GR3A 3UTGA 1MO9A 1M64A 1PXCA 3TTBA 2BS3A 3DJJA 1GRBA 4Z25A 1ZMCA 2FBWA 3BI4A 5KOWA 4BK2A 4G74A 2IVDA 5FS7A 4GAVA 1NAAA 3P4RA 3F8DA 3DH9A 3FIMB 3KKJA 3SYIA 4XWRA 1TDOA 3IHMA 2C67A 2GR2A 4EIQA 2APGA 3JSKA 1Q1WA 4H4PA 3D1IA 2YLRA 2WESA 2WU5A 3ADAB 2EQ9A 4H4QA 1DNCA 4K2XA 4PABA 4YSHA 3KVEA 2LFCA 2ZBWA 2VVMA 3VRAA 3QSMA 1OJAA 3AECA 4RSLA 2YWLA 1ZKQA 3LJPA 4YKFA 1Q9IA 5L46A 1IJHA 3G5QA 4CY6A 4A65A 1JOAA 3B3RA 3QFBA 1W4XA 4YT0A 2QCUA 3T14A 1FECA 5JCIA 3AB1A 3O0HA 4U2TA 5GRTA 2X3NA 2XLSA 5M0ZA 4H4TA 3DGHA 1QLBA 2YQUA 4CBQA 4UP3A 1FS8A 2OALA 3UKQA 1NDAA 3ALJA 2RDZA 4H2RA 2WETA 3VR9A 2AAQA 4LIIA 2GRTA 2WP5A 3BI2A 2C73A 4FX9A 4OPDA 4H4UA 3KA7A 3RKHA 1LQTA 2YG7A 5CKUA 1CJCA 4A6NB 2C3DA 4IA5A 1Z6LA 3OZ2A 1IUTA 3DJDA 4EQWA 4II2A 3AE3A 1Y56A 3M13A 1VG9A 4Z44A 3GDNA 3UU9A 1S3EA 2VVLA 4H2QA 2E1MA 2VQ7A 2YG5A 3K7QX 3CNPA 3SY4A 1VRQB 1N4UA 2GEWA 3LZWA 4ICYA 1B5QA 1CJ4A 5JCLA 3AE7A 2X99A 4B63A 2B7RA 1PJ7A 5KNLA 4A5LA 2BABA 2NVKX 2ZZCA 4II3A 2R45A 1D4CA 2EQ6A 3QSSA 2FJBA 2YM2A 4U8LA 3S5WA 2R4EA 3V3NA 2VVLG 4U8KA 5CQFA 2B9YA 4G9KA 3NYCA 2RGHA 5C3JA 2XVHA 4EQXA 4Z2UA 3GYJA 1F8WA 1ZOVA 4X9MA 5FMHA 3GSIA 1K0JA 3KU9A 3AE4A 5KVHA 1BWCA 3M0OA 2YVFA 2OAMA 4TM3A 2XCGA 4YSZA 1IUSA 5EOWA 4DNAA 4NEWA 3AE6A 2RGJA 3AEGA 3GWDA 1D4DA 5FS9A 2XYOA 3F8RA 4Y4LA 1JU2A 1S2QA 4NZHA 3T2KA 2BA9A 2X8HA 3H8LA 3HYVA 2B9XA 3GWFA 3HYWA 3PVCA 2OLOA 4H4WA 4H4SA 4UDPA 5IQ1A 1CC2A 4O5UA 4KPRA 2ZO5A 2ZZ0A 3LZXA 2WBAA 3LOVA 3NYEA 1LV0A 3NK1X 1AOGA 1NENA 1OJCA 2YR6A 1P2EA 1EL9A 3WE0A 4I58A 4NNJA 3BNUA 1SP3A 1TDNA 5KMRA 3G5RA 4H4YA 1GNDA 5EBKA 4CY8A 3Q9TA 1GRTA 3KPKA 3V3OA 3NNEA 4JN9A 1KNPA 3D8XA 3P4PA 2V3BA 3AE1A 3KD9A 4J56A 4RG3A 4UDRA 3KPFA 2C75A 4ZCDA 4AP1A 3T37A 4CNKA 2BC1A 4H2NA 4ZN0A 1M1PA 1OAHA 4FDCB 4GRTA 2R4JA 2W0HA 2YLXA 3DJGX 1KFYA 3F29A 4JDRA 3GMBA 4WCTA 3AD8B 2XVIA 4A7AA 4J34A 3GD3A 1ZDLA 2WPEA 2EQ7A 1FCDA 1TDFA 2BRAA 2OA1A 4K8DA 1ONFA 3ABVA 3GD4A 4NTCA 4WJYA 2Y6RA 1IUVA 2XFPA 4P9SA 4NTDA 3ICRA 1K0IA 1NEKA 1FEBA 2RABA 4Z43A 5HXIA 2R0GA 1GXFA 3UKAA 4UDQA 2C66A 2GVCA 3NK0X 4H4ZA 2QA1A 4OVIA 3SX6A 4L3ZA 4XWZA 1IUUA 3DK8A 1CHUA 1D7YA 4YTMA 4B65A 1FL2A 1JRXA 3FO3A 3SM8A 1L9DA 2A89A 4B68A 4EIPA 2R0PA 1PXAA 2Z5XA 2TPRA 2BCPA 1BGNA 3EF6A 2XVFA 3IWAA 4CNJA 3UTHA 1JRYA 1M1QA 2BCGG 2H89A 1XPQA 3AYJA 3AE5A 1PJ5A 2BXRA 2QA2A 1CC6A 2B9WA 1E6EA 3AD7B 2X50A 3CPIG 4K22A 3UTEA 1KDGA 1NG4A 3H8IA 4C74A 3LADA 3OC4A 2GAHB 3SXIA 2C4CA 3QVPA 4D04A 4DSHA 4EMIA 3VQRA 3GYIA 1H7XA 5KOXA 2WHDA 3L8KA 2PHHA 2F5ZA 3GYXA 4GUVA 2YLSA 4NWZA 1E1LA 2WDVA 2YVJA 2J3NA 5TR3A 3UCLA 2ACZA 2ARDA 2C3CA 1KNRA 1TYPA 4H4VA 1PDHA 5KMPA 1NHPA 1RYIA 4Z26A 1XDIA 2OLNA 2UZZA 1Y0PA 3CPJG 4H4XA 4NTEA 2IVEA 4GR1A 3C4AA 1N1PA 4OPGA 4U8OA 3SQPA 3GRSA 1PJ6A 3PS9A 1E1MA 4G6GA 4X9NA 1XHCA 3QJ4A 1E7PA 4IV9A 4JY2A 1ZMDA 4G73A 2NPXA 3LXDA 5JCNA 1JNZA 5HY5A 4A99A 4YSYA 1FT5A 3UKPA 1YQZA 4YKGA 2V6OA 3CNTA 4TLZA 1RSGA 2BK3A 3AWIA 1GRGA 3I3LA 2WDQA 1GT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EBD A;  2BYB A;  2IID A;  3CGC A;  1JRZ A;  1HYU A;  2C7G A;  2WU2 A;  2GF3 A;  1F8S A;  2V61 A;  4OPI A;  1H7W A;  4USR A;  3M12 A;  1D5T A;  1E1N A;  1TRB A;  3ATR A;  4A79 A;  5IQ4 A;  1GOS A;  3LGQ A;  2XLR A;  2YR4 A;  2FJD A;  3AE8 A;  2RGO A;  2CFY A;  2V5Z A;  3BHF A;  2B76 A;  3ICT A;  5J7X A;  3DK9 A;  4EQR A;  1B37 A;  4JQ9 A;  2QAE A;  3UOZ A;  2K3V A;  4OPC A;  1M6I A;  1K4Q A;  3NK2 X;  1REO A;  3UKK A;  4U8M A;  1X31 B;  4BK1 A;  2BK4 A;  2JB3 A;  4AP3 A;  1XAN A;  3RED A;  1S3B A;  4U8P A;  3AEA A;  4IVO B;  1DOD A;  3SFE A;  2GMJ A;  2TMD A;  1CJ3 A;  4K5R A;  2BXS A;  1IUW A;  3UOY A;  1TYT A;  2XDO A;  1CL0 A;  5JCM A;  1O5W A;  3P4S A;  2JKC A;  4U8I A;  3NKS A;  4YWO A;  3DJE A;  1JEH A;  4CCQ A;  3UKF A;  1NG3 A;  4EQS A;  3AEB A;  2Q0K A;  4BUR A;  5HYM A;  2X8G A;  4ZCC A;  3RNM A;  4EM3 A;  4AOX A;  3L1T A;  1GPE A;  3BNF A;  3CNS A;  4HA6 A;  3IHG A;  4OCG A;  1H6V A;  1SEZ A;  3BNJ A;  4Q1O A;  1GER A;  4O5Q A;  3I6D A;  2GQW A;  3UKL A;  4J2W A;  1VG0 A;  3NHO X;  1DOE A;  3DA1 A;  1GTH A;  2H88 A;  3G5S A;  3QVR A;  5BUL A;  4Q4U A;  3AEF A;  1GRH A;  2FJE A;  1PBF A;  4GDP A;  3SCE A;  1EL7 A;  1KF6 A;  3RP6 A;  3ALM A;  1CF3 A;  2VQB A;  4AOS A;  3II4 A;  3LB8 A;  5EB4 A;  2WEU A;  3UP5 A;  1FOH A;  2VZ2 A;  2Z5Y A;  2BAC A;  5U1O A;  5KRQ A;  4YTN A;  3NIX A;  3IC9 A;  3OWM A;  2X8C A;  3R9U A;  2E81 A;  2YLZ A;  4A9W A;  1BGJ A;  5KXJ A;  1DJN A;  2BC0 A;  4J36 A;  5KWF A;  3ITJ A;  4Z2T A;  1VQW A;  5GSN A;  4U2S A;  3CIR A;  4H7U A;  3NTA A;  3ZDN A;  1CC4 A;  1H82 A;  4Y4N A;  4B1B A;  4E0V A;  1YQ4 A;  2EQ8 A;  2YLT A;  3B6D A;  3AYL A;  3NLC A;  4YXD A;  3AEE A;  1NHQ A;  2GAG B;  4Y4M A;  3ALL A;  1M1R A;  3ICS A;  1PS9 A;  3QFA A;  3IF9 A;  1E1K A;  1DJQ A;  3S7W A;  1LPF A;  1DXL A;  1NHS A;  2YLW A;  5KVI A;  1GSN A;  1IUX A;  2GH5 A;  3PO7 A;  3UOX A;  4A6N A;  1PBC A;  2JBV A;  4ADW A;  1L9E A;  1ZX9 A;  4LA1 A;  1EL5 A;  5LV9 A;  1UKV G;  1GAL A;  1VDC A;  4BK3 A;  3D1C A;  4KX6 A;  3CPH G;  4Z2R A;  4TM1 A;  1JNI A;  4AT0 A;  4DSG A;  4U8N A;  2FJA A;  3GDP A;  1QDB A;  2JK6 A;  3UTF A;  2C65 A;  1GRF A;  3AD9 B;  4OPL A;  2XFN A;  3V76 A;  3ZYX A;  1S2Y A;  1B8S A;  3FMW A;  3NG7 X;  1B4V A;  1CBO A;  2CUL A;  4L3Y A;  2WOI A;  2YG3 A;  3SFD A;  2E5V A;  1ZY8 A;  2J7A A;  1LTX R;  2R46 A;  2WPF A;  3DME A;  2C76 A;  2PYX A;  3C96 A;  4I59 A;  4OPU A;  4YSX A;  2GV8 A;  3COX A;  4N9X A;  3MMO A;  1FS9 A;  1PHH A;  2GMH A;  3NT6 A;  2XVJ A;  4PAA A;  3CN8 A;  2O9Z A;  2WDR A;  3AXB A;  2B7S A;  4GF7 A;  2Q0L A;  1QJD A;  4BJY A;  2Q7V A;  2JB2 A;  1KSS A;  3BHK A;  3GMC A;  2R9Z A;  3BNG A;  1DOB A;  3NGC X;  1F6M A;  2YVG A;  1GES A;  5BUK A;  2Y6Q A;  3CGE A;  1O94 A;  1ZP0 A;  3AE9 A;  4K7Z A;  1GRE A;  1PN0 A;  1V59 A;  1H86 A;  3NN6 X;  4HB9 A;  2C72 A;  4LU6 A;  1LJ1 A;  1N4V A;  1FS7 A;  1LVL A;  3UP4 A;  1GEU A;  4J33 A;  4C3Y A;  1DOC A;  2E80 A;  1F3P A;  2BK5 A;  3DK4 A;  3C4N A;  3BNM A;  3F8P A;  4TLX A;  1QO8 A;  2WS3 A;  2YAU A;  5HHF A;  5M10 A;  3NYF A;  5EB5 A;  2YG6 A;  1COY A;  3UKH A;  2XLT A;  1D7L A;  4MJW A;  2XVE A;  4BJZ A;  1D4E A;  1JNR A;  1TDE A;  1F8R A;  3NRN A;  4IA6 A;  1H83 A;  4Q0T A;  1GRA A;  4XXG A;  2AR8 A;  3CGD A;  4OPT A;  4ECH A;  2DKH A;  1BKW A;  1RP0 A;  2WOV A;  3Q6J A;  3CND A;  3DGZ A;  3NTD A;  1NPX A;  2YM1 A;  2V60 A;  4B69 A;  1GU6 A;  4Z24 A;  1PXB A;  3E1T A;  4FK1 A;  1BVB A;  4M52 A;  2I0Z A;  3SXQ A;  3VRD B;  3TOR A;  1PBE A;  4EMJ A;  5IPY A;  1ZOY A;  2AQJ A;  1PBB A;  4Q5B A;  3BNH A;  3GM6 A;  1OJ9 A;  3RHA A;  4U2L A;  1GET A;  1N4W A;  2VRM A;  3NN0 X;  4Q17 A;  2A87 A;  4C77 A;  4H50 A;  5C2T A;  5BRT A;  1L9C A;  4EMW A;  1L0V A;  2JAE A;  4J31 A;  3SGL A;  4TM4 A;  4FK1 C;  1Y56 B;  1BF3 A;  1OJT A;  4B64 A;  1YKJ A;  1MOK A;  3UBR A;  2WP6 A;  2C64 A;  4U8J A;  5ER0 A;  5U63 A;  2CVJ A;  2XFQ A;  1FEA A;  4Q5C A;  1OJD A;  5J60 A;  2WOW A;  5BVA A;  2GB0 A;  2VR0 A;  3RP8 A;  3VR8 A;  3QSE A;  4IVM B;  3P1W A;  2DKI A;  2E4G A;  4EM4 A;  1NHR A;  2C70 A;  1Q1R A;  2VOU A;  2GR1 A;  3P4Q A;  2RF7 A;  2A8X A;  3URH A;  3AYI A;  1ELI A;  4CRT A;  2Q6U A;  4REK A;  3EAO A;  1FT6 A;  3EAN A;  3FBS A;  4J57 A;  2XFO A;  4H2P A;  4TM0 A;  5JCK A;  1ZK7 A;  5U25 A;  2GR0 A;  2XLU A;  2YR5 A;  1GTE A;  3K7M X;  4B67 A;  3AED A;  1YQ3 A;  5DBJ A;  1CJ2 A;  3K30 A;  3EPT A;  4JNA A;  4DGK A;  3P9U A;  2JB1 A;  2CDU A;  2XFU A;  3L1R A;  1GV4 A;  4YTP A;  2WP9 A;  1MXT A;  4X4J A;  1BZL A;  3GRT A;  4USQ A;  1K0L A;  2V3A A;  1TDK A;  1H81 A;  1EL8 A;  3UOV A;  3BI5 A;  3CGB A;  2BS4 A;  3RP7 A;  3CNJ A;  4C5O A;  3LG1 A;  1YY5 A;  4GDE A;  2XLP A;  5FS6 A;  3AE2 A;  3HZL A;  3S61 A;  2WQY A;  2ZZB A;  2GQF A;  3CTY A;  4BV6 A;  1LQU A;  3FG2 P;  2VRL A;  4K5S A;  5FS8 A;  4CCR A;  1H84 A;  3K7T A;  4L38 A;  4APN A;  1O95 A;  2YG4 A;  2BS2 A;  4WX1 A;  2R0C A;  4JY3 A;  4C3X A;  2HQM A;  3ATQ A;  3FPZ A;  4AT2 A;  4JNQ A;  3H4K A;  4D03 A;  3KLJ A;  1KSU A;  1P2H A;  1PBD A;  2OT4 A;  4H4R A;  4L3X A;  3ISH A;  1E39 A;  3NH3 X;  4RG4 A;  4B66 A;  2WPC A;  3VRB A;  4NEV A;  4GCM A;  2GR3 A;  3UTG A;  1MO9 A;  1M64 A;  1PXC A;  3TTB A;  2BS3 A;  3DJJ A;  1GRB A;  4Z25 A;  1ZMC A;  2FBW A;  3BI4 A;  5KOW A;  4BK2 A;  2IVD A;  5FS7 A;  1NAA A;  3P4R A;  3F8D A;  3DH9 A;  3FIM B;  3KKJ A;  4XWR A;  1TDO A;  3IHM A;  2C67 A;  2GR2 A;  4EIQ A;  2APG A;  3JSK A;  1Q1W A;  4H4P A;  3D1I A;  2YLR A;  2WES A;  2WU5 A;  3ADA B;  2EQ9 A;  4H4Q A;  1DNC A;  4K2X A;  4PAB A;  4YSH A;  3KVE A;  2LFC A;  2ZBW A;  2VVM A;  3VRA A;  3QSM A;  1OJA A;  3AEC A;  4RSL A;  2YWL A;  1ZKQ A;  3LJP A;  4YKF A;  1Q9I A;  5L46 A;  1IJH A;  3G5Q A;  4CY6 A;  4A65 A;  1JOA A;  3B3R A;  3QFB A;  1W4X A;  4YT0 A;  2QCU A;  1FEC A;  5JCI A;  3AB1 A;  3O0H A;  4U2T A;  5GRT A;  2X3N A;  2XLS A;  5M0Z A;  4H4T A;  3DGH A;  1QLB A;  2YQU A;  4CBQ A;  4UP3 A;  1FS8 A;  2OAL A;  3UKQ A;  1NDA A;  3ALJ A;  2RDZ A;  4H2R A;  2WET A;  3VR9 A;  2AAQ A;  4LII A;  2GRT A;  2WP5 A;  3BI2 A;  2C73 A;  4FX9 A;  4OPD A;  4H4U A;  3KA7 A;  3RKH A;  1LQT A;  2YG7 A;  5CKU A;  1CJC A;  4A6N B;  2C3D A;  4IA5 A;  1Z6L A;  3OZ2 A;  1IUT A;  3DJD A;  4EQW A;  4Z44 A;  3AE3 A;  1Y56 A;  3M13 A;  1VG9 A;  3GDN A;  3UU9 A;  1S3E A;  2VVL A;  4H2Q A;  2E1M A;  2VQ7 A;  2YG5 A;  3K7Q X;  3CNP A;  1VRQ B;  1N4U A;  2GEW A;  3LZW A;  4ICY A;  1B5Q A;  1CJ4 A;  5JCL A;  3AE7 A;  2X99 A;  4B63 A;  2B7R A;  1PJ7 A;  4A5L A;  2BAB A;  2NVK X;  2ZZC A;  2R45 A;  1D4C A;  2EQ6 A;  3QSS A;  2FJB A;  2YM2 A;  4U8L A;  3S5W A;  2R4E A;  3V3N A;  2VVL G;  4U8K A;  5CQF A;  2B9Y A;  3NYC A;  2RGH A;  5C3J A;  2XVH A;  4EQX A;  4Z2U A;  3GYJ A;  1F8W A;  1ZOV A;  4X9M A;  5FMH A;  3GSI A;  1K0J A;  3KU9 A;  3AE4 A;  5KVH A;  1BWC A;  3M0O A;  2YVF A;  2OAM A;  4TM3 A;  2XCG A;  4YSZ A;  1IUS A;  5EOW A;  4DNA A;  4NEW A;  3AE6 A;  2RGJ A;  3AEG A;  3GWD A;  1D4D A;  5FS9 A;  2XYO A;  3F8R A;  4Y4L A;  1JU2 A;  1S2Q A;  4NZH A;  2BA9 A;  2X8H A;  3H8L A;  2B9X A;  3GWF A;  4H4W A;  3PVC A;  2OLO A;  4H4S A;  4UDP A;  5IQ1 A;  1CC2 A;  4O5U A;  4KPR A;  2ZO5 A;  2ZZ0 A;  3LZX A;  2WBA A;  3LOV A;  3NYE A;  1LV0 A;  3NK1 X;  1AOG A;  1NEN A;  1OJC A;  2YR6 A;  1P2E A;  1EL9 A;  3WE0 A;  4I58 A;  3BNU A;  1SP3 A;  1TDN A;  3G5R A;  4H4Y A;  1GND A;  5EBK A;  4CY8 A;  3Q9T A;  1GRT A;  3V3O A;  3NNE A;  4JN9 A;  1KNP A;  3D8X A;  3P4P A;  2V3B A;  3AE1 A;  3KD9 A;  4J56 A;  4RG3 A;  4UDR A;  3KPF A;  2C75 A;  4ZCD A;  4AP1 A;  3T37 A;  4CNK A;  2BC1 A;  4H2N A;  4ZN0 A;  1M1P A;  1OAH A;  4FDC B;  4GRT A;  2R4J A;  2W0H A;  2YLX A;  3DJG X;  1KFY A;  3F29 A;  4JDR A;  3GMB A;  4WCT A;  3AD8 B;  2XVI A;  4A7A A;  4J34 A;  3GD3 A;  1ZDL A;  2WPE A;  2EQ7 A;  1FCD A;  1TDF A;  2OA1 A;  4K8D A;  1ONF A;  3ABV A;  3GD4 A;  4NTC A;  4WJY A;  2Y6R A;  1IUV A;  2XFP A;  4P9S A;  4NTD A;  3ICR A;  1K0I A;  1NEK A;  1FEB A;  2RAB A;  4Z43 A;  5HXI A;  2R0G A;  1GXF A;  3UKA A;  4UDQ A;  2C66 A;  2GVC A;  3NK0 X;  4H4Z A;  2QA1 A;  4OVI A;  4L3Z A;  4XWZ A;  1IUU A;  3DK8 A;  1CHU A;  1D7Y A;  4YTM A;  4B65 A;  1FL2 A;  1JRX A;  3FO3 A;  3SM8 A;  1L9D A;  2A89 A;  4B68 A;  4EIP A;  2R0P A;  1PXA A;  2Z5X A;  2TPR A;  2BCP A;  1BGN A;  3EF6 A;  2XVF A;  3IWA A;  4CNJ A;  3UTH A;  1JRY A;  1M1Q A;  2BCG G;  2H89 A;  1XPQ A;  3AYJ A;  3AE5 A;  1PJ5 A;  2BXR A;  2QA2 A;  1CC6 A;  2B9W A;  1E6E A;  3AD7 B;  2X50 A;  3CPI G;  4K22 A;  3UTE A;  1KDG A;  1NG4 A;  3H8I A;  4C74 A;  3LAD A;  3OC4 A;  2GAH B;  3QVP A;  4D04 A;  4DSH A;  4EMI A;  5KOX A;  3VQR A;  3GYI A;  1H7X A;  2WHD A;  3L8K A;  2PHH A;  2F5Z A;  4GUV A;  3GYX A;  2YLS A;  1E1L A;  2WDV A;  2YVJ A;  2J3N A;  5TR3 A;  3UCL A;  2ACZ A;  2ARD A;  2C3C A;  1KNR A;  1TYP A;  4H4V A;  1PDH A;  1NHP A;  1RYI A;  4Z26 A;  1XDI A;  2OLN A;  2UZZ A;  1Y0P A;  3CPJ G;  4H4X A;  4NTE A;  2IVE A;  4GR1 A;  3C4A A;  1N1P A;  4OPG A;  4U8O A;  3SQP A;  3GRS A;  1PJ6 A;  3PS9 A;  1E1M A;  4X9N A;  1XHC A;  3QJ4 A;  1E7P A;  4IV9 A;  4JY2 A;  1ZMD A;  2NPX A;  3LXD A;  5JCN A;  1JNZ A;  5HY5 A;  4A99 A;  4YSY A;  1FT5 A;  3UKP A;  1YQZ A;  4YKG A;  2V6O A;  3CNT A;  4TLZ A;  1RSG A;  2BK3 A;  3AWI A;  1GRG A;  3I3L A;  2WDQ A;  1GT8 A; 
#chains in the Genus database with same CATH topology
 1EBD A;  2BYB A;  2IID A;  3CGC A;  1JRZ A;  1HYU A;  2C7G A;  2WU2 A;  2GF3 A;  1F8S A;  2V61 A;  4OPI A;  1H7W A;  4USR A;  3M12 A;  1D5T A;  1E1N A;  1TRB A;  3ATR A;  4A79 A;  5IQ4 A;  1GOS A;  3LGQ A;  2XLR A;  2YR4 A;  2FJD A;  3AE8 A;  2RGO A;  2CFY A;  2V5Z A;  3BHF A;  2B76 A;  3ICT A;  5J7X A;  2BRY A;  3DK9 A;  4EQR A;  1B37 A;  4JQ9 A;  2QAE A;  3UOZ A;  2K3V A;  3T31 A;  4OPC A;  1M6I A;  1K4Q A;  3NK2 X;  1REO A;  3UKK A;  4U8M A;  1X31 B;  4BK1 A;  2BK4 A;  2JB3 A;  4AP3 A;  1XAN A;  3RED A;  1S3B A;  4U8P A;  3AEA A;  4IVO B;  1DOD A;  3SFE A;  2CZS A;  2GMJ A;  2TMD A;  1CJ3 A;  4K5R A;  2BXS A;  1IUW A;  3UOY A;  1TYT A;  2XDO A;  1CL0 A;  5JCM A;  1O5W A;  3P4S A;  2JKC A;  4U8I A;  3NKS A;  4YWO A;  3DJE A;  1JEH A;  4CCQ A;  3UKF A;  1NG3 A;  4EQS A;  3AEB A;  2Q0K A;  4BUR A;  5HYM A;  2X8G A;  4ZCC A;  3RNM A;  4EM3 A;  4AOX A;  3L1T A;  1GPE A;  3BNF A;  3CNS A;  4HA6 A;  3IHG A;  4OCG A;  1H6V A;  3CMM A;  1SEZ A;  3BNJ A;  4Q1O A;  1GER A;  4O5Q A;  3I6D A;  2GQW A;  3UKL A;  4J2W A;  1VG0 A;  3NHO X;  3T0K A;  1DOE A;  3DA1 A;  1GTH A;  2H88 A;  3G5S A;  3QVR A;  5BUL A;  4Q4U A;  3AEF A;  1GRH A;  2FJE A;  1PBF A;  4GDP A;  3SCE A;  1EL7 A;  1KF6 A;  3RP6 A;  3ALM A;  5KMS A;  1CF3 A;  2VQB A;  4AOS A;  3II4 A;  3LB8 A;  5EB4 A;  2WEU A;  3UP5 A;  1FOH A;  2VZ2 A;  2Z5Y A;  2BAC A;  5U1O A;  5KRQ A;  4YTN A;  3NIX A;  3IC9 A;  3OWM A;  2X8C A;  3R9U A;  2E81 A;  2YLZ A;  4A9W A;  1BGJ A;  5KXJ A;  1DJN A;  2BC0 A;  4J36 A;  5KWF A;  3ITJ A;  4Z2T A;  1VQW A;  5GSN A;  4U2S A;  3CIR A;  4H7U A;  3NTA A;  3ZDN A;  1CC4 A;  1H82 A;  4Y4N A;  4B1B A;  4E0V A;  1YQ4 A;  2EQ8 A;  2YLT A;  3B6D A;  3AYL A;  3NLC A;  4YXD A;  3AEE A;  1NHQ A;  2GAG B;  4Y4M A;  3ALL A;  1M1R A;  3ICS A;  1PS9 A;  3QFA A;  3IF9 A;  1E1K A;  1DJQ A;  3S7W A;  1LPF A;  1DXL A;  1NHS A;  2YLW A;  5KVI A;  1GSN A;  1IUX A;  2GH5 A;  3PO7 A;  3UOX A;  4A6N A;  1PBC A;  2JBV A;  4ADW A;  1L9E A;  1ZX9 A;  4LA1 A;  1EL5 A;  5LV9 A;  1UKV G;  1GAL A;  1VDC A;  4BK3 A;  3D1C A;  4KX6 A;  3CPH G;  4Z2R A;  4TM1 A;  1JNI A;  4AT0 A;  4DSG A;  4U8N A;  2FJA A;  3GDP A;  1QDB A;  2JK6 A;  3UTF A;  2C65 A;  1GRF A;  3AD9 B;  4OPL A;  2XFN A;  3V76 A;  3ZYX A;  1S2Y A;  1B8S A;  3FMW A;  3NG7 X;  1B4V A;  1CBO A;  2CUL A;  4L3Y A;  2WOI A;  2YG3 A;  3SFD A;  2E5V A;  1ZY8 A;  2J7A A;  1LTX R;  2R46 A;  3HYX A;  2WPF A;  3DME A;  2C76 A;  2PYX A;  3C96 A;  4I59 A;  4OPU A;  4YSX A;  2GV8 A;  3COX A;  4N9X A;  3MMO A;  1FS9 A;  1PHH A;  2GMH A;  3NT6 A;  2XVJ A;  4PAA A;  3CN8 A;  2O9Z A;  2WDR A;  3AXB A;  2B7S A;  4GF7 A;  2Q0L A;  1QJD A;  4BJY A;  4GAP A;  2Q7V A;  2JB2 A;  1KSS A;  3BHK A;  3GMC A;  2R9Z A;  3BNG A;  1DOB A;  3NGC X;  1F6M A;  3SZF A;  2YVG A;  1GES A;  5BUK A;  2Y6Q A;  3CGE A;  1O94 A;  1ZP0 A;  3AE9 A;  4K7Z A;  1GRE A;  1PN0 A;  1V59 A;  1H86 A;  3NN6 X;  4HB9 A;  2C72 A;  4LU6 A;  1LJ1 A;  1N4V A;  1FS7 A;  1LVL A;  3UP4 A;  1GEU A;  4J33 A;  4C3Y A;  1DOC A;  2E80 A;  1F3P A;  2BK5 A;  3DK4 A;  3C4N A;  3BNM A;  3F8P A;  4TLX A;  1QO8 A;  2WS3 A;  2YAU A;  5HHF A;  5M10 A;  3NYF A;  5EB5 A;  2YG6 A;  1COY A;  3UKH A;  2XLT A;  1D7L A;  4MJW A;  2XVE A;  4BJZ A;  1D4E A;  1JNR A;  1TDE A;  1F8R A;  3NRN A;  4IA6 A;  1H83 A;  4Q0T A;  1GRA A;  5KMQ A;  4XXG A;  2AR8 A;  3CGD A;  4OPT A;  4ECH A;  2DKH A;  1BKW A;  1RP0 A;  2WOV A;  3Q6J A;  3CND A;  3DGZ A;  3NTD A;  1NPX A;  2YM1 A;  2V60 A;  4B69 A;  1GU6 A;  4Z24 A;  1PXB A;  3E1T A;  4FK1 A;  1BVB A;  4M52 A;  2I0Z A;  3SXQ A;  3VRD B;  3TOR A;  1PBE A;  4EMJ A;  5IPY A;  1ZOY A;  2AQJ A;  1PBB A;  4Q5B A;  3BNH A;  3GM6 A;  3SZC A;  1OJ9 A;  3RHA A;  4U2L A;  1GET A;  1N4W A;  2VRM A;  3NN0 X;  4Q17 A;  2A87 A;  4C77 A;  4H50 A;  5C2T A;  5BRT A;  1L9C A;  4EMW A;  1L0V A;  2JAE A;  4J31 A;  3SGL A;  4TM4 A;  4FK1 C;  1Y56 B;  1BF3 A;  1OJT A;  4B64 A;  1YKJ A;  1MOK A;  3UBR A;  2WP6 A;  2C64 A;  4U8J A;  5ER0 A;  5U63 A;  2CVJ A;  2XFQ A;  1FEA A;  4Q5C A;  1OJD A;  5J60 A;  2WOW A;  5BVA A;  2GB0 A;  3T2Y A;  2VR0 A;  3RP8 A;  3VR8 A;  3QSE A;  4IVM B;  3P1W A;  3SZW A;  2DKI A;  2E4G A;  4EM4 A;  1NHR A;  2C70 A;  1Q1R A;  3SZ0 A;  2VOU A;  2GR1 A;  3P4Q A;  2RF7 A;  2A8X A;  3URH A;  3AYI A;  1ELI A;  4CRT A;  2Q6U A;  4REK A;  3EAO A;  1FT6 A;  3EAN A;  3FBS A;  4J57 A;  2XFO A;  4H2P A;  4TM0 A;  5JCK A;  1ZK7 A;  5U25 A;  2GR0 A;  2XLU A;  2YR5 A;  1GTE A;  3K7M X;  4B67 A;  3AED A;  1YQ3 A;  5DBJ A;  1CJ2 A;  3K30 A;  3EPT A;  4JNA A;  4DGK A;  3P9U A;  2JB1 A;  2CDU A;  2XFU A;  3L1R A;  1GV4 A;  4YTP A;  2WP9 A;  1MXT A;  4X4J A;  1BZL A;  3GRT A;  4USQ A;  1K0L A;  2V3A A;  3T2Z A;  1TDK A;  1H81 A;  1EL8 A;  3UOV A;  3BI5 A;  3CGB A;  2BS4 A;  3RP7 A;  3CNJ A;  4C5O A;  3LG1 A;  1YY5 A;  4GDE A;  2XLP A;  5FS6 A;  3AE2 A;  3HZL A;  3S61 A;  2WQY A;  2ZZB A;  2GQF A;  3CTY A;  4BV6 A;  1LQU A;  3FG2 P;  2VRL A;  4K5S A;  5FS8 A;  4CCR A;  1H84 A;  3K7T A;  4G6H A;  4L38 A;  4APN A;  1O95 A;  2YG4 A;  2BS2 A;  4WX1 A;  2R0C A;  4JY3 A;  4C3X A;  2HQM A;  3ATQ A;  3FPZ A;  4AT2 A;  4JNQ A;  3H4K A;  4D03 A;  3KLJ A;  1KSU A;  1P2H A;  1PBD A;  2OT4 A;  4H4R A;  4L3X A;  3ISH A;  1E39 A;  3NH3 X;  4RG4 A;  4B66 A;  2WPC A;  3VRB A;  4NEV A;  4GCM A;  2GR3 A;  3UTG A;  1MO9 A;  1M64 A;  1PXC A;  3TTB A;  2BS3 A;  3DJJ A;  1GRB A;  4Z25 A;  1ZMC A;  2FBW A;  3BI4 A;  5KOW A;  4BK2 A;  4G74 A;  2IVD A;  5FS7 A;  4GAV A;  1NAA A;  3P4R A;  3F8D A;  3DH9 A;  3FIM B;  3KKJ A;  3SYI A;  4XWR A;  1TDO A;  3IHM A;  2C67 A;  2GR2 A;  4EIQ A;  2APG A;  3JSK A;  1Q1W A;  4H4P A;  3D1I A;  2YLR A;  2WES A;  2WU5 A;  3ADA B;  2EQ9 A;  4H4Q A;  1DNC A;  4K2X A;  4PAB A;  4YSH A;  3KVE A;  2LFC A;  2ZBW A;  2VVM A;  3VRA A;  3QSM A;  1OJA A;  3AEC A;  4RSL A;  2YWL A;  1ZKQ A;  3LJP A;  4YKF A;  1Q9I A;  5L46 A;  1IJH A;  3G5Q A;  4CY6 A;  4A65 A;  1JOA A;  3B3R A;  3QFB A;  1W4X A;  4YT0 A;  2QCU A;  3T14 A;  1FEC A;  5JCI A;  3AB1 A;  3O0H A;  4U2T A;  5GRT A;  2X3N A;  2XLS A;  5M0Z A;  4H4T A;  3DGH A;  1QLB A;  2YQU A;  4CBQ A;  4UP3 A;  1FS8 A;  2OAL A;  3UKQ A;  1NDA A;  3ALJ A;  2RDZ A;  4H2R A;  2WET A;  3VR9 A;  2AAQ A;  4LII A;  2GRT A;  2WP5 A;  3BI2 A;  2C73 A;  4FX9 A;  4OPD A;  4H4U A;  3KA7 A;  3RKH A;  1LQT A;  2YG7 A;  5CKU A;  1CJC A;  4A6N B;  2C3D A;  4IA5 A;  1Z6L A;  3OZ2 A;  1IUT A;  3DJD A;  4EQW A;  4II2 A;  3AE3 A;  1Y56 A;  3M13 A;  1VG9 A;  4Z44 A;  3GDN A;  3UU9 A;  1S3E A;  2VVL A;  4H2Q A;  2E1M A;  2VQ7 A;  2YG5 A;  3K7Q X;  3CNP A;  3SY4 A;  1VRQ B;  1N4U A;  2GEW A;  3LZW A;  4ICY A;  1B5Q A;  1CJ4 A;  5JCL A;  3AE7 A;  2X99 A;  4B63 A;  2B7R A;  1PJ7 A;  5KNL A;  4A5L A;  2BAB A;  2NVK X;  2ZZC A;  4II3 A;  2R45 A;  1D4C A;  2EQ6 A;  3QSS A;  2FJB A;  2YM2 A;  4U8L A;  3S5W A;  2R4E A;  3V3N A;  2VVL G;  4U8K A;  5CQF A;  2B9Y A;  4G9K A;  3NYC A;  2RGH A;  5C3J A;  2XVH A;  4EQX A;  4Z2U A;  3GYJ A;  1F8W A;  1ZOV A;  4X9M A;  5FMH A;  3GSI A;  1K0J A;  3KU9 A;  3AE4 A;  5KVH A;  1BWC A;  3M0O A;  2YVF A;  2OAM A;  4TM3 A;  2XCG A;  4YSZ A;  1IUS A;  5EOW A;  4DNA A;  4NEW A;  3AE6 A;  2RGJ A;  3AEG A;  3GWD A;  1D4D A;  5FS9 A;  2XYO A;  3F8R A;  4Y4L A;  1JU2 A;  1S2Q A;  4NZH A;  3T2K A;  2BA9 A;  2X8H A;  3H8L A;  3HYV A;  2B9X A;  3GWF A;  3HYW A;  3PVC A;  2OLO A;  4H4W A;  4H4S A;  4UDP A;  5IQ1 A;  1CC2 A;  4O5U A;  4KPR A;  2ZO5 A;  2ZZ0 A;  3LZX A;  2WBA A;  3LOV A;  3NYE A;  1LV0 A;  3NK1 X;  1AOG A;  1NEN A;  1OJC A;  2YR6 A;  1P2E A;  1EL9 A;  3WE0 A;  4I58 A;  4NNJ A;  3BNU A;  1SP3 A;  1TDN A;  5KMR A;  3G5R A;  4H4Y A;  1GND A;  5EBK A;  4CY8 A;  3Q9T A;  1GRT A;  3KPK A;  3V3O A;  3NNE A;  4JN9 A;  1KNP A;  3D8X A;  3P4P A;  2V3B A;  3AE1 A;  3KD9 A;  4J56 A;  4RG3 A;  4UDR A;  3KPF A;  2C75 A;  4ZCD A;  4AP1 A;  3T37 A;  4CNK A;  2BC1 A;  4H2N A;  4ZN0 A;  1M1P A;  1OAH A;  4FDC B;  4GRT A;  2R4J A;  2W0H A;  2YLX A;  3DJG X;  1KFY A;  3F29 A;  4JDR A;  3GMB A;  4WCT A;  3AD8 B;  2XVI A;  4A7A A;  4J34 A;  3GD3 A;  1ZDL A;  2WPE A;  2EQ7 A;  1FCD A;  1TDF A;  2BRA A;  2OA1 A;  4K8D A;  1ONF A;  3ABV A;  3GD4 A;  4NTC A;  4WJY A;  2Y6R A;  1IUV A;  2XFP A;  4P9S A;  4NTD A;  3ICR A;  1K0I A;  1NEK A;  1FEB A;  2RAB A;  4Z43 A;  5HXI A;  2R0G A;  1GXF A;  3UKA A;  4UDQ A;  2C66 A;  2GVC A;  3NK0 X;  4H4Z A;  2QA1 A;  4OVI A;  3SX6 A;  4L3Z A;  4XWZ A;  1IUU A;  3DK8 A;  1CHU A;  1D7Y A;  4YTM A;  4B65 A;  1FL2 A;  1JRX A;  3FO3 A;  3SM8 A;  1L9D A;  2A89 A;  4B68 A;  4EIP A;  2R0P A;  1PXA A;  2Z5X A;  2TPR A;  2BCP A;  1BGN A;  3EF6 A;  2XVF A;  3IWA A;  4CNJ A;  3UTH A;  1JRY A;  1M1Q A;  2BCG G;  2H89 A;  1XPQ A;  3AYJ A;  3AE5 A;  1PJ5 A;  2BXR A;  2QA2 A;  1CC6 A;  2B9W A;  1E6E A;  3AD7 B;  2X50 A;  3CPI G;  4K22 A;  3UTE A;  1KDG A;  1NG4 A;  3H8I A;  4C74 A;  3LAD A;  3OC4 A;  2GAH B;  3SXI A;  2C4C A;  3QVP A;  4D04 A;  4DSH A;  4EMI A;  3VQR A;  3GYI A;  1H7X A;  5KOX A;  2WHD A;  3L8K A;  2PHH A;  2F5Z A;  3GYX A;  4GUV A;  2YLS A;  4NWZ A;  1E1L A;  2WDV A;  2YVJ A;  2J3N A;  5TR3 A;  3UCL A;  2ACZ A;  2ARD A;  2C3C A;  1KNR A;  1TYP A;  4H4V A;  1PDH A;  5KMP A;  1NHP A;  1RYI A;  4Z26 A;  1XDI A;  2OLN A;  2UZZ A;  1Y0P A;  3CPJ G;  4H4X A;  4NTE A;  2IVE A;  4GR1 A;  3C4A A;  1N1P A;  4OPG A;  4U8O A;  3SQP A;  3GRS A;  1PJ6 A;  3PS9 A;  1E1M A;  4G6G A;  4X9N A;  1XHC A;  3QJ4 A;  1E7P A;  4IV9 A;  4JY2 A;  1ZMD A;  4G73 A;  2NPX A;  3LXD A;  5JCN A;  1JNZ A;  5HY5 A;  4A99 A;  4YSY A;  1FT5 A;  3UKP A;  1YQZ A;  4YKG A;  2V6O A;  3CNT A;  4TLZ A;  1RSG A;  2BK3 A;  3AWI A;  1GRG A;  3I3L A;  2WDQ A;  1GT8 A; 
#chains in the Genus database with same CATH homology
 1EBD A;  2BYB A;  2IID A;  3CGC A;  1JRZ A;  1HYU A;  2C7G A;  2WU2 A;  2GF3 A;  1F8S A;  2V61 A;  4OPI A;  1H7W A;  4USR A;  3M12 A;  1D5T A;  1E1N A;  1TRB A;  3ATR A;  4A79 A;  5IQ4 A;  1GOS A;  3LGQ A;  2XLR A;  2YR4 A;  2FJD A;  3AE8 A;  2RGO A;  2CFY A;  2V5Z A;  3BHF A;  2B76 A;  3ICT A;  5J7X A;  2BRY A;  3DK9 A;  4EQR A;  1B37 A;  4JQ9 A;  2QAE A;  3UOZ A;  2K3V A;  3T31 A;  4OPC A;  1M6I A;  1K4Q A;  3NK2 X;  1REO A;  3UKK A;  4U8M A;  1X31 B;  4BK1 A;  2BK4 A;  2JB3 A;  4AP3 A;  1XAN A;  3RED A;  1S3B A;  4U8P A;  3AEA A;  4IVO B;  1DOD A;  3SFE A;  2GMJ A;  2TMD A;  1CJ3 A;  4K5R A;  2BXS A;  1IUW A;  3UOY A;  1TYT A;  2XDO A;  1CL0 A;  5JCM A;  1O5W A;  3P4S A;  2JKC A;  4U8I A;  3NKS A;  4YWO A;  3DJE A;  1JEH A;  4CCQ A;  3UKF A;  1NG3 A;  4EQS A;  3AEB A;  2Q0K A;  4BUR A;  5HYM A;  2X8G A;  4ZCC A;  3RNM A;  4EM3 A;  4AOX A;  3L1T A;  1GPE A;  3BNF A;  3CNS A;  4HA6 A;  3IHG A;  4OCG A;  1H6V A;  3CMM A;  1SEZ A;  3BNJ A;  4Q1O A;  1GER A;  4O5Q A;  3I6D A;  2GQW A;  3UKL A;  4J2W A;  1VG0 A;  3NHO X;  3T0K A;  1DOE A;  3DA1 A;  1GTH A;  2H88 A;  3G5S A;  3QVR A;  5BUL A;  4Q4U A;  3AEF A;  1GRH A;  2FJE A;  1PBF A;  4GDP A;  3SCE A;  1EL7 A;  1KF6 A;  3RP6 A;  3ALM A;  5KMS A;  1CF3 A;  2VQB A;  4AOS A;  3II4 A;  3LB8 A;  5EB4 A;  2WEU A;  3UP5 A;  1FOH A;  2VZ2 A;  2Z5Y A;  2BAC A;  5U1O A;  5KRQ A;  4YTN A;  3NIX A;  3IC9 A;  3OWM A;  2X8C A;  3R9U A;  2E81 A;  2YLZ A;  4A9W A;  1BGJ A;  5KXJ A;  1DJN A;  2BC0 A;  4J36 A;  5KWF A;  3ITJ A;  4Z2T A;  1VQW A;  5GSN A;  4U2S A;  3CIR A;  4H7U A;  3NTA A;  3ZDN A;  1CC4 A;  1H82 A;  4Y4N A;  4B1B A;  4E0V A;  1YQ4 A;  2EQ8 A;  2YLT A;  3B6D A;  3AYL A;  3NLC A;  4YXD A;  3AEE A;  1NHQ A;  2GAG B;  4Y4M A;  3ALL A;  1M1R A;  3ICS A;  1PS9 A;  3QFA A;  3IF9 A;  1E1K A;  1DJQ A;  3S7W A;  1LPF A;  1DXL A;  1NHS A;  2YLW A;  5KVI A;  1GSN A;  1IUX A;  2GH5 A;  3PO7 A;  3UOX A;  4A6N A;  1PBC A;  2JBV A;  4ADW A;  1L9E A;  1ZX9 A;  4LA1 A;  1EL5 A;  5LV9 A;  1UKV G;  1GAL A;  1VDC A;  4BK3 A;  3D1C A;  4KX6 A;  3CPH G;  4Z2R A;  4TM1 A;  1JNI A;  4AT0 A;  4DSG A;  4U8N A;  2FJA A;  3GDP A;  1QDB A;  2JK6 A;  3UTF A;  2C65 A;  1GRF A;  3AD9 B;  4OPL A;  2XFN A;  3V76 A;  3ZYX A;  1S2Y A;  1B8S A;  3FMW A;  3NG7 X;  1B4V A;  1CBO A;  2CUL A;  4L3Y A;  2WOI A;  2YG3 A;  3SFD A;  2E5V A;  1ZY8 A;  2J7A A;  1LTX R;  2R46 A;  3HYX A;  2WPF A;  3DME A;  2C76 A;  2PYX A;  3C96 A;  4I59 A;  4OPU A;  4YSX A;  2GV8 A;  3COX A;  4N9X A;  3MMO A;  1FS9 A;  1PHH A;  2GMH A;  3NT6 A;  2XVJ A;  4PAA A;  3CN8 A;  2O9Z A;  2WDR A;  3AXB A;  2B7S A;  4GF7 A;  2Q0L A;  1QJD A;  4BJY A;  4GAP A;  2Q7V A;  2JB2 A;  1KSS A;  3BHK A;  3GMC A;  2R9Z A;  3BNG A;  1DOB A;  3NGC X;  1F6M A;  3SZF A;  2YVG A;  1GES A;  5BUK A;  2Y6Q A;  3CGE A;  1O94 A;  1ZP0 A;  3AE9 A;  4K7Z A;  1GRE A;  1PN0 A;  1V59 A;  1H86 A;  3NN6 X;  4HB9 A;  2C72 A;  4LU6 A;  1LJ1 A;  1N4V A;  1FS7 A;  1LVL A;  3UP4 A;  1GEU A;  4J33 A;  4C3Y A;  1DOC A;  2E80 A;  1F3P A;  2BK5 A;  3DK4 A;  3C4N A;  3BNM A;  3F8P A;  4TLX A;  1QO8 A;  2WS3 A;  2YAU A;  5HHF A;  5M10 A;  3NYF A;  5EB5 A;  2YG6 A;  1COY A;  3UKH A;  2XLT A;  1D7L A;  4MJW A;  2XVE A;  4BJZ A;  1D4E A;  1JNR A;  1TDE A;  1F8R A;  3NRN A;  4IA6 A;  1H83 A;  4Q0T A;  1GRA A;  5KMQ A;  4XXG A;  2AR8 A;  3CGD A;  4OPT A;  4ECH A;  2DKH A;  1BKW A;  1RP0 A;  2WOV A;  3Q6J A;  3CND A;  3DGZ A;  3NTD A;  1NPX A;  2YM1 A;  2V60 A;  4B69 A;  1GU6 A;  4Z24 A;  1PXB A;  3E1T A;  4FK1 A;  1BVB A;  4M52 A;  2I0Z A;  3SXQ A;  3VRD B;  3TOR A;  1PBE A;  4EMJ A;  5IPY A;  1ZOY A;  2AQJ A;  1PBB A;  4Q5B A;  3BNH A;  3GM6 A;  3SZC A;  1OJ9 A;  3RHA A;  4U2L A;  1GET A;  1N4W A;  2VRM A;  3NN0 X;  4Q17 A;  2A87 A;  4C77 A;  4H50 A;  5C2T A;  5BRT A;  1L9C A;  4EMW A;  1L0V A;  2JAE A;  4J31 A;  3SGL A;  4TM4 A;  4FK1 C;  1Y56 B;  1BF3 A;  1OJT A;  4B64 A;  1YKJ A;  1MOK A;  3UBR A;  2WP6 A;  2C64 A;  4U8J A;  5ER0 A;  5U63 A;  2CVJ A;  2XFQ A;  1FEA A;  4Q5C A;  1OJD A;  5J60 A;  2WOW A;  5BVA A;  2GB0 A;  3T2Y A;  2VR0 A;  3RP8 A;  3VR8 A;  3QSE A;  4IVM B;  3P1W A;  3SZW A;  2DKI A;  2E4G A;  4EM4 A;  1NHR A;  2C70 A;  1Q1R A;  3SZ0 A;  2VOU A;  2GR1 A;  3P4Q A;  2RF7 A;  2A8X A;  3URH A;  3AYI A;  1ELI A;  4CRT A;  2Q6U A;  4REK A;  3EAO A;  1FT6 A;  3EAN A;  3FBS A;  4J57 A;  2XFO A;  4H2P A;  4TM0 A;  5JCK A;  1ZK7 A;  5U25 A;  2GR0 A;  2XLU A;  2YR5 A;  1GTE A;  3K7M X;  4B67 A;  3AED A;  1YQ3 A;  5DBJ A;  1CJ2 A;  3K30 A;  3EPT A;  4JNA A;  4DGK A;  3P9U A;  2JB1 A;  2CDU A;  2XFU A;  3L1R A;  1GV4 A;  4YTP A;  2WP9 A;  1MXT A;  4X4J A;  1BZL A;  3GRT A;  4USQ A;  1K0L A;  2V3A A;  3T2Z A;  1TDK A;  1H81 A;  1EL8 A;  3UOV A;  3BI5 A;  3CGB A;  2BS4 A;  3RP7 A;  3CNJ A;  4C5O A;  3LG1 A;  1YY5 A;  4GDE A;  2XLP A;  5FS6 A;  3AE2 A;  3HZL A;  3S61 A;  2WQY A;  2ZZB A;  2GQF A;  3CTY A;  4BV6 A;  1LQU A;  3FG2 P;  2VRL A;  4K5S A;  5FS8 A;  4CCR A;  1H84 A;  3K7T A;  4G6H A;  4L38 A;  4APN A;  1O95 A;  2YG4 A;  2BS2 A;  4WX1 A;  2R0C A;  4JY3 A;  4C3X A;  2HQM A;  3ATQ A;  3FPZ A;  4AT2 A;  4JNQ A;  3H4K A;  4D03 A;  3KLJ A;  1KSU A;  1P2H A;  1PBD A;  2OT4 A;  4H4R A;  4L3X A;  3ISH A;  1E39 A;  3NH3 X;  4RG4 A;  4B66 A;  2WPC A;  3VRB A;  4NEV A;  4GCM A;  2GR3 A;  3UTG A;  1MO9 A;  1M64 A;  1PXC A;  3TTB A;  2BS3 A;  3DJJ A;  1GRB A;  4Z25 A;  1ZMC A;  2FBW A;  3BI4 A;  5KOW A;  4BK2 A;  4G74 A;  2IVD A;  5FS7 A;  4GAV A;  1NAA A;  3P4R A;  3F8D A;  3DH9 A;  3FIM B;  3KKJ A;  3SYI A;  4XWR A;  1TDO A;  3IHM A;  2C67 A;  2GR2 A;  4EIQ A;  2APG A;  3JSK A;  1Q1W A;  4H4P A;  3D1I A;  2YLR A;  2WES A;  2WU5 A;  3ADA B;  2EQ9 A;  4H4Q A;  1DNC A;  4K2X A;  4PAB A;  4YSH A;  3KVE A;  2LFC A;  2ZBW A;  2VVM A;  3VRA A;  3QSM A;  1OJA A;  3AEC A;  4RSL A;  2YWL A;  1ZKQ A;  3LJP A;  4YKF A;  1Q9I A;  5L46 A;  1IJH A;  3G5Q A;  4CY6 A;  4A65 A;  1JOA A;  3B3R A;  3QFB A;  1W4X A;  4YT0 A;  2QCU A;  3T14 A;  1FEC A;  5JCI A;  3AB1 A;  3O0H A;  4U2T A;  5GRT A;  2X3N A;  2XLS A;  5M0Z A;  4H4T A;  3DGH A;  1QLB A;  2YQU A;  4CBQ A;  4UP3 A;  1FS8 A;  2OAL A;  3UKQ A;  1NDA A;  3ALJ A;  2RDZ A;  4H2R A;  2WET A;  3VR9 A;  2AAQ A;  4LII A;  2GRT A;  2WP5 A;  3BI2 A;  2C73 A;  4FX9 A;  4OPD A;  4H4U A;  3KA7 A;  3RKH A;  1LQT A;  2YG7 A;  5CKU A;  1CJC A;  4A6N B;  2C3D A;  4IA5 A;  1Z6L A;  3OZ2 A;  1IUT A;  3DJD A;  4EQW A;  4II2 A;  3AE3 A;  1Y56 A;  3M13 A;  1VG9 A;  4Z44 A;  3GDN A;  3UU9 A;  1S3E A;  2VVL A;  4H2Q A;  2E1M A;  2VQ7 A;  2YG5 A;  3K7Q X;  3CNP A;  3SY4 A;  1VRQ B;  1N4U A;  2GEW A;  3LZW A;  4ICY A;  1B5Q A;  1CJ4 A;  5JCL A;  3AE7 A;  2X99 A;  4B63 A;  2B7R A;  1PJ7 A;  5KNL A;  4A5L A;  2BAB A;  2NVK X;  2ZZC A;  4II3 A;  2R45 A;  1D4C A;  2EQ6 A;  3QSS A;  2FJB A;  2YM2 A;  4U8L A;  3S5W A;  2R4E A;  3V3N A;  2VVL G;  4U8K A;  5CQF A;  2B9Y A;  4G9K A;  3NYC A;  2RGH A;  5C3J A;  2XVH A;  4EQX A;  4Z2U A;  3GYJ A;  1F8W A;  1ZOV A;  4X9M A;  5FMH A;  3GSI A;  1K0J A;  3KU9 A;  3AE4 A;  5KVH A;  1BWC A;  3M0O A;  2YVF A;  2OAM A;  4TM3 A;  2XCG A;  4YSZ A;  1IUS A;  5EOW A;  4DNA A;  4NEW A;  3AE6 A;  2RGJ A;  3AEG A;  3GWD A;  1D4D A;  5FS9 A;  2XYO A;  3F8R A;  4Y4L A;  1JU2 A;  1S2Q A;  4NZH A;  3T2K A;  2BA9 A;  2X8H A;  3H8L A;  3HYV A;  2B9X A;  3GWF A;  3HYW A;  3PVC A;  2OLO A;  4H4W A;  4H4S A;  4UDP A;  5IQ1 A;  1CC2 A;  4O5U A;  4KPR A;  2ZO5 A;  2ZZ0 A;  3LZX A;  2WBA A;  3LOV A;  3NYE A;  1LV0 A;  3NK1 X;  1AOG A;  1NEN A;  1OJC A;  2YR6 A;  1P2E A;  1EL9 A;  3WE0 A;  4I58 A;  4NNJ A;  3BNU A;  1SP3 A;  1TDN A;  5KMR A;  3G5R A;  4H4Y A;  1GND A;  5EBK A;  4CY8 A;  3Q9T A;  1GRT A;  3KPK A;  3V3O A;  3NNE A;  4JN9 A;  1KNP A;  3D8X A;  3P4P A;  2V3B A;  3AE1 A;  3KD9 A;  4J56 A;  4RG3 A;  4UDR A;  3KPF A;  2C75 A;  4ZCD A;  4AP1 A;  3T37 A;  4CNK A;  2BC1 A;  4H2N A;  4ZN0 A;  1M1P A;  1OAH A;  4FDC B;  4GRT A;  2R4J A;  2W0H A;  2YLX A;  3DJG X;  1KFY A;  3F29 A;  4JDR A;  3GMB A;  4WCT A;  3AD8 B;  2XVI A;  4A7A A;  4J34 A;  3GD3 A;  1ZDL A;  2WPE A;  2EQ7 A;  1FCD A;  1TDF A;  2BRA A;  2OA1 A;  4K8D A;  1ONF A;  3ABV A;  3GD4 A;  4NTC A;  4WJY A;  2Y6R A;  1IUV A;  2XFP A;  4P9S A;  4NTD A;  3ICR A;  1K0I A;  1NEK A;  1FEB A;  2RAB A;  4Z43 A;  5HXI A;  2R0G A;  1GXF A;  3UKA A;  4UDQ A;  2C66 A;  2GVC A;  3NK0 X;  4H4Z A;  2QA1 A;  4OVI A;  3SX6 A;  4L3Z A;  4XWZ A;  1IUU A;  3DK8 A;  1CHU A;  1D7Y A;  4YTM A;  4B65 A;  1FL2 A;  1JRX A;  3FO3 A;  3SM8 A;  1L9D A;  2A89 A;  4B68 A;  4EIP A;  2R0P A;  1PXA A;  2Z5X A;  2TPR A;  2BCP A;  1BGN A;  3EF6 A;  2XVF A;  3IWA A;  4CNJ A;  3UTH A;  1JRY A;  1M1Q A;  2BCG G;  2H89 A;  1XPQ A;  3AYJ A;  3AE5 A;  1PJ5 A;  2BXR A;  2QA2 A;  1CC6 A;  2B9W A;  1E6E A;  3AD7 B;  2X50 A;  3CPI G;  4K22 A;  3UTE A;  1KDG A;  1NG4 A;  3H8I A;  4C74 A;  3LAD A;  3OC4 A;  2GAH B;  3SXI A;  2C4C A;  3QVP A;  4D04 A;  4DSH A;  4EMI A;  3VQR A;  3GYI A;  1H7X A;  5KOX A;  2WHD A;  3L8K A;  2PHH A;  2F5Z A;  3GYX A;  4GUV A;  2YLS A;  4NWZ A;  1E1L A;  2WDV A;  2YVJ A;  2J3N A;  5TR3 A;  3UCL A;  2ACZ A;  2ARD A;  2C3C A;  1KNR A;  1TYP A;  4H4V A;  1PDH A;  5KMP A;  1NHP A;  1RYI A;  4Z26 A;  1XDI A;  2OLN A;  2UZZ A;  1Y0P A;  3CPJ G;  4H4X A;  4NTE A;  2IVE A;  4GR1 A;  3C4A A;  1N1P A;  4OPG A;  4U8O A;  3SQP A;  3GRS A;  1PJ6 A;  3PS9 A;  1E1M A;  4G6G A;  4X9N A;  1XHC A;  3QJ4 A;  1E7P A;  4IV9 A;  4JY2 A;  1ZMD A;  4G73 A;  2NPX A;  3LXD A;  5JCN A;  1JNZ A;  5HY5 A;  4A99 A;  4YSY A;  1FT5 A;  3UKP A;  1YQZ A;  4YKG A;  2V6O A;  3CNT A;  4TLZ A;  1RSG A;  2BK3 A;  3AWI A;  1GRG A;  3I3L A;  2WDQ A;  1GT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...