1FT5A

Crystal structure of the oxidized state of cytochrome c554 from nitrosomonas europaea
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C554
publication title High-resolution structures of the oxidized and reduced states of cytochrome c554 from Nitrosomonas europaea.
pubmed doi rcsb
molecule tags Electron transport
total genus 54
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13435 Cytochrome_C554 Cytochrome c554 and c-prime
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1ft5A00
1FT6A 3BNHA 3SCEA 2B7SA 3LGQA 1JRYA 1JNIA 3OWMA 1FS9A 1QO8A 3BNGA 3FO3A 1KSUA 1D4DA 1Y0PA 1GU6A 1D4EA 1FT5A 2VR0A 1JRXA 3TORA 3UBRA 3UU9A 1OAHA 4WJYA 3RKHA 2E80A 3TTBA 3GM6A 3LG1A 1M64A 3BNJA 1E39A 1FS8A 1M1RA 2RDZA 1P2HA 3L1TA 4Q5BA 4Q17A 1M1QA 2E81A 1Q9IA 2OT4A 2B7RA 2ZO5A 4Q5CA 1BVBA 1JRZA 4L3XA 4L3YA 4Q0TA 1KSSA 1M1PA 2K3VA 1QJDA 3BNFA 3D1IA 1P2EA 4Q4UA 4Q1OA 1LJ1A 3S7WA 3SXQA 4L38A 2RF7A 3F29A 1D4CA 2J7AA 1SP3A 1QDBA 1FS7A 4L3ZA 3MMOA
chains in the Genus database with same CATH superfamily
1FT6A 3BNHA 3SCEA 2B7SA 3LGQA 1JRYA 1JNIA 3OWMA 1FS9A 1QO8A 3BNGA 3FO3A 1KSUA 1D4DA 1Y0PA 1GU6A 1D4EA 1FT5A 2VR0A 1JRXA 3TORA 3UBRA 3UU9A 1OAHA 4WJYA 3RKHA 2E80A 3TTBA 3GM6A 3LG1A 1M64A 3BNJA 1E39A 1FS8A 1M1RA 2RDZA 1P2HA 3L1TA 4Q5BA 4Q17A 1M1QA 2CZSA 1Q9IA 2E81A 2B7RA 2OT4A 2ZO5A 4Q5CA 1BVBA 1JRZA 4L3XA 4L3YA 4Q0TA 1KSSA 1M1PA 2K3VA 1QJDA 3BNFA 3D1IA 1P2EA 4Q4UA 4Q1OA 1LJ1A 3S7WA 3SXQA 4L38A 2RF7A 3F29A 1D4CA 2J7AA 1SP3A 1QDBA 1FS7A 4L3ZA 3MMOA
chains in the Genus database with same CATH topology
1FT6A 3BNHA 3SCEA 2B7SA 3LGQA 1JRYA 1JNIA 3OWMA 1FS9A 1QO8A 3BNGA 3FO3A 1KSUA 1D4DA 1Y0PA 1GU6A 1D4EA 1FT5A 2VR0A 1JRXA 3TORA 3UBRA 3UU9A 1OAHA 4WJYA 3RKHA 2E80A 3TTBA 3GM6A 3LG1A 1M64A 3BNJA 1E39A 1FS8A 1M1RA 2RDZA 1P2HA 3L1TA 4Q5BA 4Q17A 1M1QA 2E81A 1Q9IA 2OT4A 2B7RA 2ZO5A 4Q5CA 1BVBA 1JRZA 4L3XA 4L3YA 4Q0TA 1KSSA 1M1PA 2K3VA 1QJDA 3BNFA 3D1IA 1P2EA 4Q4UA 4Q1OA 1LJ1A 3S7WA 3SXQA 4L38A 2RF7A 3F29A 1D4CA 2J7AA 1SP3A 1QDBA 1FS7A 4L3ZA 3MMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT6 A;  3BNH A;  3SCE A;  2B7S A;  3LGQ A;  1JRY A;  1JNI A;  3OWM A;  1FS9 A;  1QO8 A;  3BNG A;  3FO3 A;  1KSU A;  1D4D A;  1Y0P A;  1GU6 A;  1D4E A;  1FT5 A;  2VR0 A;  1JRX A;  3TOR A;  3UBR A;  3UU9 A;  1OAH A;  4WJY A;  3RKH A;  2E80 A;  3TTB A;  3GM6 A;  3LG1 A;  1M64 A;  3BNJ A;  1E39 A;  1FS8 A;  1M1R A;  2RDZ A;  1P2H A;  3L1T A;  4Q5B A;  4Q17 A;  1M1Q A;  2E81 A;  1Q9I A;  2OT4 A;  2B7R A;  2ZO5 A;  4Q5C A;  1BVB A;  1JRZ A;  4L3X A;  4L3Y A;  4Q0T A;  1KSS A;  1M1P A;  2K3V A;  1QJD A;  3BNF A;  3D1I A;  1P2E A;  4Q4U A;  4Q1O A;  1LJ1 A;  3S7W A;  3SXQ A;  4L38 A;  2RF7 A;  3F29 A;  1D4C A;  2J7A A;  1SP3 A;  1QDB A;  1FS7 A;  4L3Z A;  3MMO A; 
#chains in the Genus database with same CATH topology
 1FT6 A;  3BNH A;  3SCE A;  2B7S A;  3LGQ A;  1JRY A;  1JNI A;  3OWM A;  1FS9 A;  1QO8 A;  3BNG A;  3FO3 A;  1KSU A;  1D4D A;  1Y0P A;  1GU6 A;  1D4E A;  1FT5 A;  2VR0 A;  1JRX A;  3TOR A;  3UBR A;  3UU9 A;  1OAH A;  4WJY A;  3RKH A;  2E80 A;  3TTB A;  3GM6 A;  3LG1 A;  1M64 A;  3BNJ A;  1E39 A;  1FS8 A;  1M1R A;  2RDZ A;  1P2H A;  3L1T A;  4Q5B A;  4Q17 A;  1M1Q A;  2CZS A;  1Q9I A;  2E81 A;  2B7R A;  2OT4 A;  2ZO5 A;  4Q5C A;  1BVB A;  1JRZ A;  4L3X A;  4L3Y A;  4Q0T A;  1KSS A;  1M1P A;  2K3V A;  1QJD A;  3BNF A;  3D1I A;  1P2E A;  4Q4U A;  4Q1O A;  1LJ1 A;  3S7W A;  3SXQ A;  4L38 A;  2RF7 A;  3F29 A;  1D4C A;  2J7A A;  1SP3 A;  1QDB A;  1FS7 A;  4L3Z A;  3MMO A; 
#chains in the Genus database with same CATH homology
 1FT6 A;  3BNH A;  3SCE A;  2B7S A;  3LGQ A;  1JRY A;  1JNI A;  3OWM A;  1FS9 A;  1QO8 A;  3BNG A;  3FO3 A;  1KSU A;  1D4D A;  1Y0P A;  1GU6 A;  1D4E A;  1FT5 A;  2VR0 A;  1JRX A;  3TOR A;  3UBR A;  3UU9 A;  1OAH A;  4WJY A;  3RKH A;  2E80 A;  3TTB A;  3GM6 A;  3LG1 A;  1M64 A;  3BNJ A;  1E39 A;  1FS8 A;  1M1R A;  2RDZ A;  1P2H A;  3L1T A;  4Q5B A;  4Q17 A;  1M1Q A;  2E81 A;  1Q9I A;  2OT4 A;  2B7R A;  2ZO5 A;  4Q5C A;  1BVB A;  1JRZ A;  4L3X A;  4L3Y A;  4Q0T A;  1KSS A;  1M1P A;  2K3V A;  1QJD A;  3BNF A;  3D1I A;  1P2E A;  4Q4U A;  4Q1O A;  1LJ1 A;  3S7W A;  3SXQ A;  4L38 A;  2RF7 A;  3F29 A;  1D4C A;  2J7A A;  1SP3 A;  1QDB A;  1FS7 A;  4L3Z A;  3MMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...