1FT5A

Crystal structure of the oxidized state of cytochrome c554 from nitrosomonas europaea
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C554
publication title High-resolution structures of the oxidized and reduced states of cytochrome c554 from Nitrosomonas europaea.
pubmed doi rcsb
total genus 54
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13435 Cytochrome_C554 Cytochrome c554 and c-prime
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1ft5A00
1FT5A 1LJ1A 1JRYA 1FS9A 4Q5BA 1M1RA 1M64A 1QJDA 4L3XA 1GU6A 3LG1A 1KSSA 1BVBA 4Q4UA 3D1IA 4L38A 4L3YA 4Q5CA 4Q0TA 1SP3A 3GM6A 3SXQA 3LGQA 3UBRA 1E39A 1Y0PA 1P2HA 3FO3A 1D4DA 3TORA 2J7AA 1Q9IA 4Q17A 1M1QA 2RDZA 1QO8A 3SCEA 1P2EA 3BNJA 1JNIA 2E80A 1QDBA 1FS7A 1D4CA 1FT6A 2K3VA 2B7RA 1D4EA 2RF7A 3BNFA 3MMOA 2ZO5A 3BNGA 1OAHA 3OWMA 4Q1OA 3F29A 2VR0A 3L1TA 3RKHA 3TTBA 3UU9A 1M1PA 2B7SA 1JRZA 2E81A 1JRXA 4L3ZA 4WJYA 1FS8A 3BNHA 2OT4A 1KSUA 3S7WA
chains in the Genus database with same CATH superfamily
1FT5A 1LJ1A 1JRYA 1FS9A 2CZSA 4Q5BA 1M1RA 1M64A 1QJDA 4L3XA 1GU6A 3LG1A 1KSSA 1BVBA 4Q4UA 3D1IA 4L38A 4L3YA 4Q5CA 4Q0TA 1SP3A 3GM6A 3SXQA 3LGQA 3UBRA 1E39A 1Y0PA 1P2HA 3FO3A 1D4DA 3TORA 2J7AA 1Q9IA 4Q17A 1M1QA 2RDZA 1QO8A 3SCEA 1P2EA 3BNJA 1JNIA 2E80A 1QDBA 1FS7A 1D4CA 1FT6A 2K3VA 2B7RA 1D4EA 2RF7A 3BNFA 3MMOA 2ZO5A 3BNGA 1OAHA 3OWMA 4Q1OA 3F29A 2VR0A 3L1TA 3RKHA 3TTBA 3UU9A 1M1PA 2B7SA 1JRZA 2E81A 1JRXA 4L3ZA 4WJYA 1FS8A 3BNHA 2OT4A 1KSUA 3S7WA
chains in the Genus database with same CATH topology
1FT5A 1LJ1A 1JRYA 1FS9A 4Q5BA 1M1RA 1M64A 1QJDA 4L3XA 1GU6A 3LG1A 1KSSA 1BVBA 4Q4UA 3D1IA 4L38A 4L3YA 4Q5CA 4Q0TA 1SP3A 3GM6A 3SXQA 3LGQA 3UBRA 1E39A 1Y0PA 1P2HA 3FO3A 1D4DA 3TORA 2J7AA 1Q9IA 4Q17A 1M1QA 2RDZA 1QO8A 3SCEA 1P2EA 3BNJA 1JNIA 2E80A 1QDBA 1FS7A 1D4CA 1FT6A 2K3VA 2B7RA 1D4EA 2RF7A 3BNFA 3MMOA 2ZO5A 3BNGA 1OAHA 3OWMA 4Q1OA 3F29A 2VR0A 3L1TA 3RKHA 3TTBA 3UU9A 1M1PA 2B7SA 1JRZA 2E81A 1JRXA 4L3ZA 4WJYA 1FS8A 3BNHA 2OT4A 1KSUA 3S7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT5 A;  1LJ1 A;  1JRY A;  1FS9 A;  4Q5B A;  1M1R A;  1M64 A;  1QJD A;  4L3X A;  1GU6 A;  3LG1 A;  1KSS A;  1BVB A;  4Q4U A;  3D1I A;  4L38 A;  4L3Y A;  4Q5C A;  4Q0T A;  1SP3 A;  3GM6 A;  3SXQ A;  3LGQ A;  3UBR A;  1E39 A;  1Y0P A;  1P2H A;  3FO3 A;  1D4D A;  3TOR A;  2J7A A;  1Q9I A;  4Q17 A;  1M1Q A;  2RDZ A;  1QO8 A;  3SCE A;  1P2E A;  3BNJ A;  1JNI A;  2E80 A;  1QDB A;  1FS7 A;  1D4C A;  1FT6 A;  2K3V A;  2B7R A;  1D4E A;  2RF7 A;  3BNF A;  3MMO A;  2ZO5 A;  3BNG A;  1OAH A;  3OWM A;  4Q1O A;  3F29 A;  2VR0 A;  3L1T A;  3RKH A;  3TTB A;  3UU9 A;  1M1P A;  2B7S A;  1JRZ A;  2E81 A;  1JRX A;  4L3Z A;  4WJY A;  1FS8 A;  3BNH A;  2OT4 A;  1KSU A;  3S7W A; 
#chains in the Genus database with same CATH topology
 1FT5 A;  1LJ1 A;  1JRY A;  1FS9 A;  2CZS A;  4Q5B A;  1M1R A;  1M64 A;  1QJD A;  4L3X A;  1GU6 A;  3LG1 A;  1KSS A;  1BVB A;  4Q4U A;  3D1I A;  4L38 A;  4L3Y A;  4Q5C A;  4Q0T A;  1SP3 A;  3GM6 A;  3SXQ A;  3LGQ A;  3UBR A;  1E39 A;  1Y0P A;  1P2H A;  3FO3 A;  1D4D A;  3TOR A;  2J7A A;  1Q9I A;  4Q17 A;  1M1Q A;  2RDZ A;  1QO8 A;  3SCE A;  1P2E A;  3BNJ A;  1JNI A;  2E80 A;  1QDB A;  1FS7 A;  1D4C A;  1FT6 A;  2K3V A;  2B7R A;  1D4E A;  2RF7 A;  3BNF A;  3MMO A;  2ZO5 A;  3BNG A;  1OAH A;  3OWM A;  4Q1O A;  3F29 A;  2VR0 A;  3L1T A;  3RKH A;  3TTB A;  3UU9 A;  1M1P A;  2B7S A;  1JRZ A;  2E81 A;  1JRX A;  4L3Z A;  4WJY A;  1FS8 A;  3BNH A;  2OT4 A;  1KSU A;  3S7W A; 
#chains in the Genus database with same CATH homology
 1FT5 A;  1LJ1 A;  1JRY A;  1FS9 A;  4Q5B A;  1M1R A;  1M64 A;  1QJD A;  4L3X A;  1GU6 A;  3LG1 A;  1KSS A;  1BVB A;  4Q4U A;  3D1I A;  4L38 A;  4L3Y A;  4Q5C A;  4Q0T A;  1SP3 A;  3GM6 A;  3SXQ A;  3LGQ A;  3UBR A;  1E39 A;  1Y0P A;  1P2H A;  3FO3 A;  1D4D A;  3TOR A;  2J7A A;  1Q9I A;  4Q17 A;  1M1Q A;  2RDZ A;  1QO8 A;  3SCE A;  1P2E A;  3BNJ A;  1JNI A;  2E80 A;  1QDB A;  1FS7 A;  1D4C A;  1FT6 A;  2K3V A;  2B7R A;  1D4E A;  2RF7 A;  3BNF A;  3MMO A;  2ZO5 A;  3BNG A;  1OAH A;  3OWM A;  4Q1O A;  3F29 A;  2VR0 A;  3L1T A;  3RKH A;  3TTB A;  3UU9 A;  1M1P A;  2B7S A;  1JRZ A;  2E81 A;  1JRX A;  4L3Z A;  4WJY A;  1FS8 A;  3BNH A;  2OT4 A;  1KSU A;  3S7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...