1JNIA

Structure of the napb subunit of the periplasmic nitrate reductase from haemophilus influenzae.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
62
Chain Sequence
QPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVPRRYFCLQCHVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHEME CYTOCHROME C NAPB
publication title The 1.25 A resolution structure of the diheme NapB subunit of soluble nitrate reductase reveals a novel cytochrome c fold with a stacked heme arrangement.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 13
structure length 62
sequence length 67
ec nomenclature
pdb deposition date 2001-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jniA00
3RKHA 3FO3A 1FS9A 1M1RA 3SCEA 3LG1A 3GM6A 1Y0PA 1JNIA 4Q17A 1QJDA 1M1PA 1Q9IA 1KSUA 1SP3A 1JRXA 1QDBA 1QO8A 2RDZA 3BNHA 3LGQA 1P2EA 4L3ZA 4WJYA 3SXQA 3F29A 4Q1OA 1P2HA 3BNFA 1D4DA 1D4EA 4Q0TA 1OAHA 2E80A 1KSSA 1M64A 4Q5BA 1JRZA 3TTBA 3TORA 3OWMA 1FT6A 4L38A 3L1TA 2B7SA 1GU6A 3BNGA 3MMOA 2E81A 1D4CA 4Q4UA 2RF7A 2ZO5A 3UU9A 1LJ1A 3D1IA 1FS7A 4L3YA 4Q5CA 3BNJA 3UBRA 2B7RA 4L3XA 1JRYA 2K3VA 2OT4A 1FS8A 1E39A 3S7WA 2J7AA 1BVBA 1M1QA 1FT5A 2VR0A
chains in the Genus database with same CATH superfamily
3RKHA 3FO3A 1FS9A 1M1RA 3SCEA 3LG1A 3GM6A 1Y0PA 1JNIA 4Q17A 1QJDA 1M1PA 1Q9IA 1KSUA 1SP3A 1JRXA 1QDBA 1QO8A 2RDZA 3BNHA 3LGQA 1P2EA 4L3ZA 4WJYA 3SXQA 3F29A 4Q1OA 1P2HA 3BNFA 1D4DA 1D4EA 4Q0TA 1OAHA 2E80A 1KSSA 1M64A 4Q5BA 1JRZA 3TTBA 3TORA 3OWMA 2CZSA 1FT6A 4L38A 3L1TA 2B7SA 1GU6A 3BNGA 3MMOA 2E81A 1D4CA 4Q4UA 2RF7A 2ZO5A 3UU9A 1LJ1A 3D1IA 1FS7A 4L3YA 4Q5CA 3BNJA 3UBRA 2B7RA 4L3XA 1JRYA 2K3VA 2OT4A 1FS8A 1E39A 3S7WA 2J7AA 1BVBA 1M1QA 1FT5A 2VR0A
chains in the Genus database with same CATH topology
3RKHA 3FO3A 1FS9A 1M1RA 3SCEA 3LG1A 3GM6A 1Y0PA 1JNIA 4Q17A 1QJDA 1M1PA 1Q9IA 1KSUA 1SP3A 1JRXA 1QDBA 1QO8A 2RDZA 3BNHA 3LGQA 1P2EA 4L3ZA 4WJYA 3SXQA 3F29A 4Q1OA 1P2HA 3BNFA 1D4DA 1D4EA 4Q0TA 1OAHA 2E80A 1KSSA 1M64A 4Q5BA 1JRZA 3TTBA 3TORA 3OWMA 1FT6A 4L38A 3L1TA 2B7SA 1GU6A 3BNGA 3MMOA 2E81A 1D4CA 4Q4UA 2RF7A 2ZO5A 3UU9A 1LJ1A 3D1IA 1FS7A 4L3YA 4Q5CA 3BNJA 3UBRA 2B7RA 4L3XA 1JRYA 2K3VA 2OT4A 1FS8A 1E39A 3S7WA 2J7AA 1BVBA 1M1QA 1FT5A 2VR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKH A;  3FO3 A;  1FS9 A;  1M1R A;  3SCE A;  3LG1 A;  3GM6 A;  1Y0P A;  1JNI A;  4Q17 A;  1QJD A;  1M1P A;  1Q9I A;  1KSU A;  1SP3 A;  1JRX A;  1QDB A;  1QO8 A;  2RDZ A;  3BNH A;  3LGQ A;  1P2E A;  4L3Z A;  4WJY A;  3SXQ A;  3F29 A;  4Q1O A;  1P2H A;  3BNF A;  1D4D A;  1D4E A;  4Q0T A;  1OAH A;  2E80 A;  1KSS A;  1M64 A;  4Q5B A;  1JRZ A;  3TTB A;  3TOR A;  3OWM A;  1FT6 A;  4L38 A;  3L1T A;  2B7S A;  1GU6 A;  3BNG A;  3MMO A;  2E81 A;  1D4C A;  4Q4U A;  2RF7 A;  2ZO5 A;  3UU9 A;  1LJ1 A;  3D1I A;  1FS7 A;  4L3Y A;  4Q5C A;  3BNJ A;  3UBR A;  2B7R A;  4L3X A;  1JRY A;  2K3V A;  2OT4 A;  1FS8 A;  1E39 A;  3S7W A;  2J7A A;  1BVB A;  1M1Q A;  1FT5 A;  2VR0 A; 
#chains in the Genus database with same CATH topology
 3RKH A;  3FO3 A;  1FS9 A;  1M1R A;  3SCE A;  3LG1 A;  3GM6 A;  1Y0P A;  1JNI A;  4Q17 A;  1QJD A;  1M1P A;  1Q9I A;  1KSU A;  1SP3 A;  1JRX A;  1QDB A;  1QO8 A;  2RDZ A;  3BNH A;  3LGQ A;  1P2E A;  4L3Z A;  4WJY A;  3SXQ A;  3F29 A;  4Q1O A;  1P2H A;  3BNF A;  1D4D A;  1D4E A;  4Q0T A;  1OAH A;  2E80 A;  1KSS A;  1M64 A;  4Q5B A;  1JRZ A;  3TTB A;  3TOR A;  3OWM A;  2CZS A;  1FT6 A;  4L38 A;  3L1T A;  2B7S A;  1GU6 A;  3BNG A;  3MMO A;  2E81 A;  1D4C A;  4Q4U A;  2RF7 A;  2ZO5 A;  3UU9 A;  1LJ1 A;  3D1I A;  1FS7 A;  4L3Y A;  4Q5C A;  3BNJ A;  3UBR A;  2B7R A;  4L3X A;  1JRY A;  2K3V A;  2OT4 A;  1FS8 A;  1E39 A;  3S7W A;  2J7A A;  1BVB A;  1M1Q A;  1FT5 A;  2VR0 A; 
#chains in the Genus database with same CATH homology
 3RKH A;  3FO3 A;  1FS9 A;  1M1R A;  3SCE A;  3LG1 A;  3GM6 A;  1Y0P A;  1JNI A;  4Q17 A;  1QJD A;  1M1P A;  1Q9I A;  1KSU A;  1SP3 A;  1JRX A;  1QDB A;  1QO8 A;  2RDZ A;  3BNH A;  3LGQ A;  1P2E A;  4L3Z A;  4WJY A;  3SXQ A;  3F29 A;  4Q1O A;  1P2H A;  3BNF A;  1D4D A;  1D4E A;  4Q0T A;  1OAH A;  2E80 A;  1KSS A;  1M64 A;  4Q5B A;  1JRZ A;  3TTB A;  3TOR A;  3OWM A;  1FT6 A;  4L38 A;  3L1T A;  2B7S A;  1GU6 A;  3BNG A;  3MMO A;  2E81 A;  1D4C A;  4Q4U A;  2RF7 A;  2ZO5 A;  3UU9 A;  1LJ1 A;  3D1I A;  1FS7 A;  4L3Y A;  4Q5C A;  3BNJ A;  3UBR A;  2B7R A;  4L3X A;  1JRY A;  2K3V A;  2OT4 A;  1FS8 A;  1E39 A;  3S7W A;  2J7A A;  1BVB A;  1M1Q A;  1FT5 A;  2VR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...