1JNIA

Structure of the napb subunit of the periplasmic nitrate reductase from haemophilus influenzae.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
62
Chain Sequence
b'QPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVPRRYFCLQCHVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHEME CYTOCHROME C NAPB
publication title The 1.25 A resolution structure of the diheme NapB subunit of soluble nitrate reductase reveals a novel cytochrome c fold with a stacked heme arrangement.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 13
structure length 62
sequence length 67
ec nomenclature
pdb deposition date 2001-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jniA00
1Q9IA 4Q5BA 3UBRA 1D4EA 1GU6A 4Q4UA 4Q1OA 3RKHA 3OWMA 1M64A 1D4CA 1QO8A 4L3XA 1M1RA 1FS7A 4Q5CA 4Q17A 2OT4A 1JRXA 1D4DA 3TORA 4L3ZA 2J7AA 1E39A 4WJYA 3SXQA 3L1TA 1FS8A 4L3YA 2B7RA 3FO3A 3D1IA 1Y0PA 2ZO5A 1FT5A 1QDBA 2VR0A 1M1QA 2RDZA 3SCEA 3BNFA 1JRYA 1KSUA 1JNIA 3GM6A 1FT6A 3LGQA 1KSSA 3BNGA 1LJ1A 1QJDA 1FS9A 3BNJA 3MMOA 1M1PA 2E81A 4Q0TA 2K3VA 2E80A 3BNHA 3S7WA 3UU9A 1JRZA 1P2HA 2B7SA 3TTBA 1SP3A 1BVBA 4L38A 1OAHA 2RF7A 3F29A 3LG1A 1P2EA
chains in the Genus database with same CATH superfamily
1Q9IA 4Q5BA 3UBRA 1D4EA 1GU6A 4Q4UA 4Q1OA 3RKHA 3OWMA 1M64A 1D4CA 1QO8A 4L3XA 1M1RA 1FS7A 4Q5CA 4Q17A 2OT4A 1JRXA 1D4DA 3TORA 4L3ZA 2J7AA 1E39A 4WJYA 3SXQA 3L1TA 1FS8A 4L3YA 2B7RA 3FO3A 3D1IA 1Y0PA 2ZO5A 1FT5A 1QDBA 2VR0A 1M1QA 2RDZA 3SCEA 3BNFA 1JRYA 1KSUA 1JNIA 3GM6A 1FT6A 3LGQA 1KSSA 3BNGA 1LJ1A 1QJDA 1FS9A 3BNJA 3MMOA 1M1PA 2E81A 4Q0TA 2CZSA 2K3VA 2E80A 3BNHA 3S7WA 3UU9A 1JRZA 1P2HA 2B7SA 3TTBA 1SP3A 1BVBA 4L38A 1OAHA 2RF7A 3F29A 3LG1A 1P2EA
chains in the Genus database with same CATH topology
1Q9IA 4Q5BA 3UBRA 1D4EA 1GU6A 4Q4UA 4Q1OA 3RKHA 3OWMA 1M64A 1D4CA 1QO8A 4L3XA 1M1RA 1FS7A 4Q5CA 4Q17A 2OT4A 1JRXA 1D4DA 3TORA 4L3ZA 2J7AA 1E39A 4WJYA 3SXQA 3L1TA 1FS8A 4L3YA 2B7RA 3FO3A 3D1IA 1Y0PA 2ZO5A 1FT5A 1QDBA 2VR0A 1M1QA 2RDZA 3SCEA 3BNFA 1JRYA 1KSUA 1JNIA 3GM6A 1FT6A 3LGQA 1KSSA 3BNGA 1LJ1A 1QJDA 1FS9A 3BNJA 3MMOA 1M1PA 2E81A 4Q0TA 2K3VA 2E80A 3BNHA 3S7WA 3UU9A 1JRZA 1P2HA 2B7SA 3TTBA 1SP3A 1BVBA 4L38A 1OAHA 2RF7A 3F29A 3LG1A 1P2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9I A;  4Q5B A;  3UBR A;  1D4E A;  1GU6 A;  4Q4U A;  4Q1O A;  3RKH A;  3OWM A;  1M64 A;  1D4C A;  1QO8 A;  4L3X A;  1M1R A;  1FS7 A;  4Q5C A;  4Q17 A;  2OT4 A;  1JRX A;  1D4D A;  3TOR A;  4L3Z A;  2J7A A;  1E39 A;  4WJY A;  3SXQ A;  3L1T A;  1FS8 A;  4L3Y A;  2B7R A;  3FO3 A;  3D1I A;  1Y0P A;  2ZO5 A;  1FT5 A;  1QDB A;  2VR0 A;  1M1Q A;  2RDZ A;  3SCE A;  3BNF A;  1JRY A;  1KSU A;  1JNI A;  3GM6 A;  1FT6 A;  3LGQ A;  1KSS A;  3BNG A;  1LJ1 A;  1QJD A;  1FS9 A;  3BNJ A;  3MMO A;  1M1P A;  2E81 A;  4Q0T A;  2K3V A;  2E80 A;  3BNH A;  3S7W A;  3UU9 A;  1JRZ A;  1P2H A;  2B7S A;  3TTB A;  1SP3 A;  1BVB A;  4L38 A;  1OAH A;  2RF7 A;  3F29 A;  3LG1 A;  1P2E A; 
#chains in the Genus database with same CATH topology
 1Q9I A;  4Q5B A;  3UBR A;  1D4E A;  1GU6 A;  4Q4U A;  4Q1O A;  3RKH A;  3OWM A;  1M64 A;  1D4C A;  1QO8 A;  4L3X A;  1M1R A;  1FS7 A;  4Q5C A;  4Q17 A;  2OT4 A;  1JRX A;  1D4D A;  3TOR A;  4L3Z A;  2J7A A;  1E39 A;  4WJY A;  3SXQ A;  3L1T A;  1FS8 A;  4L3Y A;  2B7R A;  3FO3 A;  3D1I A;  1Y0P A;  2ZO5 A;  1FT5 A;  1QDB A;  2VR0 A;  1M1Q A;  2RDZ A;  3SCE A;  3BNF A;  1JRY A;  1KSU A;  1JNI A;  3GM6 A;  1FT6 A;  3LGQ A;  1KSS A;  3BNG A;  1LJ1 A;  1QJD A;  1FS9 A;  3BNJ A;  3MMO A;  1M1P A;  2E81 A;  4Q0T A;  2CZS A;  2K3V A;  2E80 A;  3BNH A;  3S7W A;  3UU9 A;  1JRZ A;  1P2H A;  2B7S A;  3TTB A;  1SP3 A;  1BVB A;  4L38 A;  1OAH A;  2RF7 A;  3F29 A;  3LG1 A;  1P2E A; 
#chains in the Genus database with same CATH homology
 1Q9I A;  4Q5B A;  3UBR A;  1D4E A;  1GU6 A;  4Q4U A;  4Q1O A;  3RKH A;  3OWM A;  1M64 A;  1D4C A;  1QO8 A;  4L3X A;  1M1R A;  1FS7 A;  4Q5C A;  4Q17 A;  2OT4 A;  1JRX A;  1D4D A;  3TOR A;  4L3Z A;  2J7A A;  1E39 A;  4WJY A;  3SXQ A;  3L1T A;  1FS8 A;  4L3Y A;  2B7R A;  3FO3 A;  3D1I A;  1Y0P A;  2ZO5 A;  1FT5 A;  1QDB A;  2VR0 A;  1M1Q A;  2RDZ A;  3SCE A;  3BNF A;  1JRY A;  1KSU A;  1JNI A;  3GM6 A;  1FT6 A;  3LGQ A;  1KSS A;  3BNG A;  1LJ1 A;  1QJD A;  1FS9 A;  3BNJ A;  3MMO A;  1M1P A;  2E81 A;  4Q0T A;  2K3V A;  2E80 A;  3BNH A;  3S7W A;  3UU9 A;  1JRZ A;  1P2H A;  2B7S A;  3TTB A;  1SP3 A;  1BVB A;  4L38 A;  1OAH A;  2RF7 A;  3F29 A;  3LG1 A;  1P2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...