1JRYA

Crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTKDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C
publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jryA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jryA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jryA01
4TM0A 1M6IA 1ZK7A 2C72A 3D1IA 1S2QA 4H4WA 2X8CA 1XANA 4USQA 5TR3A 3TTBA 1OJCA 1D4EA 3SFDA 1DJQA 2XDOA 1TDFA 1TYPA 2A87A 2E4GA 4J36A 1RP0A 4XWRA 2GB0A 1DOEA 4Q4UA 4L3YA 2BXSA 3BNFA 2YLXA 2JKCA 4EQSA 1KF6A 1GV4A 4UDQA 2GR3A 1K0JA 2APGA 2FJEA 2WP6A 4NEWA 4TM3A 3VRAA 1E1MA 1LPFA 1GU6A 3CPHG 1F8RA 4YSHA 1D5TA 1REOA 3ALLA 5FS7A 1P2EA 3RNMA 2VVMA 4H4VA 2CULA 2XLSA 1OJAA 3AB1A 2OA1A 2VRLA 4A7AA 5LV9A 1CL0A 1VG9A 2Y6RA 4KX6A 1DOBA 1GERA 4C77A 1F8WA 2GR1A 1GALA 2Z5XA 1IUUA 1NHQA 3CGEA 3S61A 4A5LA 4B1BA 5CKUA 2R9ZA 4FDCB 4FX9A 5BUKA 4K8DA 4IVMB 3D8XA 2VR0A 3KLJA 1MO9A 3DJGX 4D04A 1NG3A 2BA9A 2FJAA 1JOAA 2NVKX 2R4JA 3NLCA 3NYCA 3Q9TA 3R9UA 1BWCA 3CNSA 1GSNA 4K5RA 2E81A 2X8HA 3CGBA 2C3CA 4EMIA 2XFOA 2WP9A 4X9MA 3UKFA 2AQJA 1FL2A 2XVJA 4JNAA 1GT8A 1ONFA 3K30A 1N4VA 3NGCX 2JAEA 3DJDA 3G5SA 2GR0A 3RP7A 3QVRA 1B4VA 4DNAA 5HY5A 1NPXA 4B69A 2C67A 3CNJA 1GRFA 1KNRA 2X50A 2YLZA 4PABA 5KVIA 4GCMA 2V3BA 3VR8A 3BI5A 3VR9A 2VQBA 2GAGB 4A9WA 1L0VA 2WS3A 4JY3A 1PXAA 4WCTA 4Z2TA 2CVJA 1EL7A 5IQ1A 1M1RA 4OVIA 1COYA 1GRAA 1PDHA 1TDOA 1JNZA 2B9YA 4YKFA 4Q5CA 3F8DA 1OAHA 3AE7A 3P4QA 2BXRA 1IUVA 1Y56B 4BK1A 3V76A 3UTHA 3UKQA 1EL5A 2WHDA 3GWFA 3FIMB 1AOGA 1FS8A 2WPEA 1N4WA 3PO7A 4N9XA 1H7WA 3M13A 4OPTA 3UU9A 4I58A 4K2XA 3H8IA 1CJ3A 1O5WA 4H50A 3BHKA 2WESA 1TYTA 1YKJA 4CY8A 3LZXA 2R0PA 2CDUA 2ZO5A 3GM6A 1GNDA 2NPXA 5J7XA 1K0LA 3GRTA 1UKVG 3F8RA 3KD9A 4H4UA 4B63A 2YG5A 3EPTA 2VOUA 2YR4A 3UKHA 3DH9A 2V6OA 2JBVA 3URHA 2Z5YA 2WDQA 4CCQA 3RKHA 1OJ9A 3AD8B 4Q1OA 3ADAB 3NN6X 5KXJA 1NHRA 3BI2A 1GTEA 4GDPA 2JB2A 2DKHA 1PXBA 1SP3A 3DK8A 4ICYA 3VQRA 4TLZA 4OPUA 4EQXA 2A89A 2CFYA 3CPJG 4Z2RA 5JCKA 3LZWA 4NZHA 4B68A 3NYFA 1W4XA 2X8GA 3II4A 1ZP0A 2BC0A 4WX1A 3UP4A 4AP3A 3CPIG 2WOVA 2B76A 3CGCA 3I6DA 1EL9A 1LV0A 3AE2A 1DODA 4Y4MA 3NHOX 3UKLA 5ER0A 4A6NB 4Z25A 4A6NA 4BK3A 3AE9A 4J57A 2OAMA 2E1MA 4TM1A 1D4CA 4DSHA 3IWAA 2EQ9A 1D4DA 4Z2UA 1QDBA 2JK6A 3QSMA 3VRDB 4C5OA 4YTMA 1VDCA 3UBRA 4U8IA 4XWZA 4BJYA 3RP8A 1NHSA 2A8XA 1N1PA 2VRMA 2QA1A 3S5WA 1JRZA 1PBDA 3JSKA 4U2TA 3FMWA 1JRYA 3FBSA 3EF6A 1QLBA 2X99A 3AE6A 4C3XA 4NTCA 3BNMA 4AOXA 2XFPA 3AE3A 2Q0KA 4PAAA 3LXDA 3NYEA 2BABA 2RDZA 3OZ2A 3UOVA 2I0ZA 3LJPA 2R45A 2V3AA 2GAHB 2BK4A 1PXCA 4U2SA 1E39A 1DNCA 3P4RA 4Y4NA 4OPDA 5M10A 3L1RA 3NNEA 3BNGA 1TDEA 3B6DA 1D7LA 2YG4A 3GDPA 3HZLA 4B64A 1PBFA 1LTXR 4LIIA 2IVEA 4H4TA 1FS7A 2RGOA 2C66A 4AT0A 3K7MX 3AECA 3E1TA 4H4RA 2XFUA 3C4AA 1F6MA 1XDIA 3KU9A 3REDA 4L3ZA 3FPZA 1P2HA 4EM4A 1NG4A 3CIRA 5BULA 2BS4A 2BS3A 1CBOA 5HYMA 4YSXA 2V60A 5IPYA 3ABVA 2R0CA 2XLUA 4CCRA 1CC2A 3D1CA 4CY6A 5KOWA 2LFCA 5KOXA 4FK1C 2Y6QA 3MMOA 4X9NA 3NK2X 2XFNA 2GMHA 3GWDA 1IJHA 3ICSA 2JB1A 2OLNA 4L3XA 4K5SA 3EAOA 3LOVA 3UCLA 4DGKA 2YG3A 4Q0TA 5GRTA 2XVEA 3QSEA 1VRQB 5EB4A 4J2WA 4GR1A 2BCGG 3SXQA 2GH5A 1X31B 3AEAA 3ITJA 1TRBA 3NRNA 1M1PA 3AD9B 2DKIA 2AR8A 3GRSA 2WPCA 2B7SA 4DSGA 2YQUA 3CNDA 1Z6LA 4IA5A 3AXBA 1JU2A 1S3EA 3P9UA 3NKSA 3CGDA 4RG4A 5FS6A 4O5UA 2V61A 1GESA 4OPLA 2YWLA 3AD7B 3DGHA 1H82A 3Q6JA 3NK0X 1H7XA 5L46A 1H81A 4UDPA 2VZ2A 3QSSA 4H7UA 5EOWA 1VG0A 2GF3A 1M64A 5J60A 1NENA 1E7PA 1Y56A 3AEGA 4U2LA 3ZYXA 4YXDA 4H4PA 3GYXA 2ZZBA 4Z43A 3DJEA 4YKGA 1PJ5A 4ADWA 2PYXA 4EMJA 3UP5A 4A99A 4FK1A 2Q0LA 2YVJA 4A65A 4EQRA 5FS9A 2QA2A 4Z44A 1XHCA 2IIDA 2QCUA 1MXTA 3M0OA 4LA1A 3SQPA 5U63A 1Q9IA 2K3VA 1KSUA 4YSYA 1L9EA 2WOIA 1JEHA 3L1TA 1B5QA 1ZMDA 2TMDA 4P9SA 1BKWA 3IHMA 5DBJA 2C3DA 3UTEA 1GEUA 4TLXA 5CQFA 4U8PA 4J56A 1B37A 4CBQA 3BNJA 2WOWA 3PS9A 1KFYA 2GQFA 3TORA 4AT2A 4JY2A 3M12A 1DOCA 1E1NA 1NEKA 1O94A 4MJWA 1FT6A 4YSZA 4JDRA 4Q5BA 5U1OA 1Y0PA 2FJDA 1GPEA 4IA6A 2W0HA 2WPFA 1CJCA 2XLRA 3T37A 2J7AA 5FMHA 3GD4A 4C3YA 5JCLA 4TM4A 3ZDNA 4APNA 3LGQA 4CNKA 3QVPA 1IUSA 1EL8A 1M1QA 1PBCA 1ELIA 1NHPA 2AAQA 4OPGA 1PBEA 1LQTA 3CN8A 2YM1A 2YLSA 1O95A 1GXFA 1N4UA 2C75A 2RABA 4K22A 3SFEA 2E80A 2PHHA 3ISHA 4NTEA 3AYJA 4H4QA 4HA6A 4U8KA 1ZY8A 3AEEA 4YTNA 4AOSA 4OPCA 2XLTA 4YTPA 3AE8A 2O9ZA 3BNHA 2OALA 2B7RA 1FEAA 1KDGA 1E6EA 2OT4A 3NTDA 2C64A 1BF3A 2WETA 1BGJA 1F8SA 3DK4A 4CRTA 4UP3A 2XVFA 2VQ7A 3FG2P 2XFQA 1PJ6A 1YQ4A 1LJ1A 1FEBA 2B9WA 1Q1RA 3DMEA 2YLTA 5JCNA 2GRTA 2RF7A 3IHGA 3V3NA 3SM8A 1S2YA 3DGZA 3ICRA 1CC6A 3NTAA 4LU6A 3OC4A 1TDKA 3UOZA 2F5ZA 1L9CA 3G5QA 2HQMA 4ECHA 2GMJA 4USRA 3IC9A 5KVHA 1BGNA 2GVCA 2IVDA 2WEUA 3DA1A 2J3NA 4IVOB 2YVGA 4I59A 4U8NA 4HB9A 1CC4A 1RSGA 1NAAA 3AYIA 4OPIA 4KPRA 1LQUA 1GREA 2H89A 1XPQA 1K4QA 3ALMA 1GRTA 1JNIA 3FO3A 1VQWA 3GD3A 1IUXA 2BK3A 3IF9A 3KKJA 2C76A 2UZZA 2YR5A 1H6VA 1GRHA 3AEFA 1FT5A 2R4EA 1JNRA 1OJTA 2WU2A 3NIXA 4H4ZA 2YLWA 4NEVA 3UKAA 1FS9A 2Q6UA 2QAEA 1PS9A 2H88A 2YG6A 5C3JA 4JN9A 1GTHA 2YVFA 3O0HA 4OCGA 5U25A 4EMWA 3UKPA 2YAUA 3UKKA 4H4SA 4U8MA 4H2QA 3GDNA 3L8KA 4XXGA 2GR2A 2X3NA 4GF7A 4WJYA 3H4KA 4EM3A 3C96A 1DXLA 2BYBA 2VVLA 3AWIA 3P1WA 1FECA 1HYUA 1SEZA 2BS2A 2R46A 4C74A 3C4NA 3H8LA 2C73A 4GRTA 4U8OA 4X4JA 1BVBA 3VRBA 1GOSA 2GQWA 3I3LA 4NTDA 5JCIA 1GETA 3P4PA 3GYIA 2R0GA 4B65A 4IV9A 5HXIA 3KA7A 1L9DA 1H84A 3P4SA 2ACZA 2YM2A 2WP5A 3CTYA 3GSIA 1KSSA 1PBBA 2ZBWA 1YQ3A 3DJJA 3UTGA 3V3OA 1EBDA 4YWOA 5C2TA 4J31A 2ZZ0A 1E1LA 2BACA 3EANA 3KPFA 4JQ9A 3K7QX 3AEDA 1YY5A 2RGJA 1CJ2A 3CNPA 4U8JA 3LADA 4H4XA 3UOYA 1TDNA 2V5ZA 1LVLA 2YR6A 4BV6A 3LG1A 4E0VA 3S7WA 3ATRA 4J33A 1JRXA 5KRQA 3OWMA 2OLOA 4GDEA 5M0ZA 1QO8A 3KVEA 1ZDLA 1PN0A 2Q7VA 4CNJA 3CNTA 3GYJA 3UOXA 5JCMA 1H86A 2YLRA 3UTFA 3SGLA 4BURA 4EQWA 5IQ4A 4K7ZA 5HHFA 4H2PA 4BJZA 3BI4A 2BCPA 3NN0X 3PVCA 2XCGA 3QFBA 2EQ7A 1PJ7A 2WQYA 4Y4LA 3QFAA 2RGHA 2XYOA 4D03A 3BHFA 2JB3A 3ALJA 2WDVA 4ZCCA 4B67A 4RSLA 5BVAA 3AE5A 3G5RA 4RG3A 1QJDA 4L38A 1IUTA 4B66A 1PHHA 1CHUA 1ZOYA 1GRGA 4GUVA 3COXA 3ICTA 5GSNA 5KWFA 3ATQA 3DK9A 5EBKA 4AP1A 2XVHA 1FCDA 1KNPA 3NH3X 4UDRA 1RYIA 1D7YA 2ARDA 3AYLA 3BNUA 1ZMCA 2WDRA 2GEWA 4EIQA 1K0IA 2TPRA 1YQZA 1GRBA 3GMBA 2E5VA 1V59A 4H2NA 3RP6A 3NG7X 4H2RA 3AE1A 4BK2A 1E1KA 2VVLG 2XLPA 3NT6A 3SCEA 1ZOVA 2C65A 3GMCA 1NDAA 4ZN0A 4A79A 1H83A 4YT0A 5BRTA 2YG7A 1DJNA 1Q1WA 2FJBA 4EIPA 1BZLA 2C70A 2BC1A 3B3RA 4M52A 4ZCDA 4Z24A 1FOHA 2WBAA 5FS8A 2B9XA 2BK5A 4O5QA 4Z26A 4JNQA 4U8LA 1ZX9A 3AE4A 1F3PA 1CJ4A 3F8PA 2GV8A 2XVIA 1ZKQA 4REKA 1OJDA 2FBWA 1IUWA 3F29A 2ZZCA 3LB8A 3NK1X 4Q17A 4H4YA 5EB5A 1CF3A 1B8SA 4J34A 3RHAA 1MOKA 1S3BA 3K7TA 3AEBA 2C7GA 3QJ4A 3WE0A 2EQ6A 2WU5A 2EQ8A
chains in the Genus database with same CATH superfamily
4TM0A 1M6IA 1ZK7A 2C72A 3D1IA 1S2QA 4GAVA 4H4WA 2X8CA 1XANA 4USQA 5TR3A 3TTBA 1OJCA 1D4EA 3SFDA 1DJQA 2XDOA 1TDFA 1TYPA 2A87A 2E4GA 4J36A 1RP0A 4XWRA 2GB0A 1DOEA 4Q4UA 4L3YA 2BXSA 3BNFA 2YLXA 2JKCA 4EQSA 1KF6A 1GV4A 4UDQA 2GR3A 1K0JA 2APGA 2FJEA 2WP6A 4NEWA 4TM3A 3VRAA 1E1MA 1LPFA 1GU6A 3CPHG 1F8RA 4YSHA 1D5TA 1REOA 3ALLA 5FS7A 1P2EA 3RNMA 2VVMA 4H4VA 2CULA 2XLSA 1OJAA 3AB1A 2OA1A 2VRLA 4A7AA 5LV9A 1CL0A 1VG9A 2Y6RA 4KX6A 1DOBA 1GERA 4C77A 1F8WA 2GR1A 1GALA 2Z5XA 1IUUA 1NHQA 3CGEA 3S61A 4A5LA 4B1BA 5CKUA 2R9ZA 4FDCB 4FX9A 5BUKA 4K8DA 4IVMB 3D8XA 2VR0A 3KLJA 1MO9A 3DJGX 4D04A 1NG3A 2BA9A 2FJAA 1JOAA 2NVKX 2R4JA 3NLCA 3NYCA 3Q9TA 3R9UA 1BWCA 3CNSA 1GSNA 4K5RA 2E81A 2X8HA 3CGBA 2C3CA 4EMIA 2XFOA 2WP9A 4X9MA 3UKFA 2AQJA 1FL2A 2XVJA 4JNAA 1GT8A 1ONFA 3K30A 1N4VA 3NGCX 2JAEA 3DJDA 3G5SA 2GR0A 3RP7A 3KPKA 1B4VA 3QVRA 4DNAA 5HY5A 1NPXA 4B69A 2C67A 3CNJA 1GRFA 1KNRA 2X50A 2YLZA 5KMSA 4PABA 5KVIA 4GCMA 2V3BA 3VR8A 3BI5A 3VR9A 2VQBA 2GAGB 4A9WA 1L0VA 2WS3A 4JY3A 1PXAA 4WCTA 4Z2TA 2CVJA 1EL7A 5IQ1A 1M1RA 4OVIA 1COYA 1GRAA 1PDHA 1TDOA 1JNZA 2B9YA 4G6GA 4YKFA 4Q5CA 3T0KA 3F8DA 1OAHA 3AE7A 3P4QA 2BXRA 1IUVA 1Y56B 4BK1A 3V76A 3UTHA 3UKQA 1EL5A 2WHDA 3GWFA 3FIMB 1AOGA 1FS8A 2WPEA 1N4WA 3PO7A 4N9XA 1H7WA 3SZWA 3M13A 4NWZA 4Z25A 4OPTA 3UU9A 4I58A 4K2XA 3T2ZA 3H8IA 1CJ3A 1O5WA 4H50A 3BHKA 2WESA 1TYTA 1YKJA 4CY8A 3LZXA 4G6HA 4II2A 2R0PA 2CDUA 2ZO5A 3GM6A 1GNDA 2NPXA 5J7XA 1K0LA 3GRTA 1UKVG 3F8RA 3KD9A 4H4UA 4B63A 2YG5A 3EPTA 2VOUA 2YR4A 3UKHA 3DH9A 2V6OA 2JBVA 3URHA 2Z5YA 2WDQA 4CCQA 3RKHA 1OJ9A 3AD8B 4Q1OA 3ADAB 3NN6X 5KXJA 1NHRA 3BI2A 1GTEA 4GDPA 2JB2A 2DKHA 1PXBA 1SP3A 3DK8A 4ICYA 3VQRA 4TLZA 4OPUA 4EQXA 2A89A 2CFYA 3CPJG 4Z2RA 3CMMA 3LZWA 5JCKA 4NZHA 4B68A 3NYFA 1W4XA 2X8GA 3II4A 1ZP0A 2BC0A 4WX1A 3UP4A 4AP3A 3CPIG 2WOVA 2B76A 3CGCA 3I6DA 1EL9A 1LV0A 3AE2A 1DODA 4Y4MA 3NHOX 3T2KA 5ER0A 3UKLA 4A6NB 4A6NA 4BK3A 3AE9A 4J57A 3T2YA 2OAMA 2E1MA 4GAPA 1D4CA 4TM1A 4DSHA 3IWAA 2EQ9A 1D4DA 4Z2UA 1QDBA 2JK6A 3QSMA 3VRDB 4C5OA 4YTMA 1VDCA 3UBRA 4U8IA 4XWZA 4BJYA 3RP8A 1NHSA 2A8XA 1N1PA 2VRMA 2QA1A 3S5WA 1JRZA 1PBDA 3JSKA 4U2TA 3FMWA 1JRYA 3FBSA 3EF6A 1QLBA 2X99A 3AE6A 4C3XA 4NTCA 3BNMA 4AOXA 2XFPA 3AE3A 2Q0KA 4PAAA 3LXDA 3NYEA 2BABA 2RDZA 3OZ2A 3UOVA 2I0ZA 3LJPA 2R45A 2V3AA 2GAHB 2BK4A 1PXCA 4U2SA 1E39A 1DNCA 3P4RA 4Y4NA 4OPDA 5M10A 3L1RA 3NNEA 3BNGA 1TDEA 3B6DA 1D7LA 2YG4A 3GDPA 3HZLA 4B64A 1PBFA 1LTXR 4LIIA 2IVEA 4H4TA 1FS7A 2RGOA 2C66A 4AT0A 3K7MX 3AECA 3E1TA 4H4RA 2XFUA 3C4AA 1F6MA 1XDIA 3KU9A 3REDA 4L3ZA 3FPZA 1P2HA 4EM4A 1NG4A 3CIRA 5BULA 2BS4A 2BS3A 1CBOA 5HYMA 4YSXA 2V60A 5IPYA 3ABVA 2R0CA 2XLUA 4CCRA 1CC2A 3D1CA 4CY6A 5KOWA 2LFCA 5KOXA 4FK1C 2Y6QA 3MMOA 4X9NA 3NK2X 2XFNA 2GMHA 3GWDA 1IJHA 3ICSA 2JB1A 2OLNA 3HYWA 4L3XA 4K5SA 3EAOA 3LOVA 3UCLA 4DGKA 2YG3A 4Q0TA 5GRTA 2XVEA 3QSEA 1VRQB 5EB4A 4J2WA 4GR1A 2BCGG 3SXQA 2GH5A 1X31B 3AEAA 3ITJA 1TRBA 3NRNA 3SY4A 1M1PA 3AD9B 2DKIA 2AR8A 3GRSA 2WPCA 2B7SA 4DSGA 2YQUA 3CNDA 1Z6LA 4IA5A 3AXBA 1JU2A 1S3EA 3P9UA 3NKSA 3CGDA 4RG4A 5FS6A 4O5UA 5KMPA 2V61A 1GESA 4OPLA 2YWLA 3AD7B 3DGHA 1H82A 3Q6JA 3NK0X 1H7XA 5L46A 1H81A 4UDPA 2VZ2A 3QSSA 4H7UA 5EOWA 1VG0A 2GF3A 1M64A 5J60A 1NENA 1E7PA 1Y56A 3AEGA 3GYXA 4U2LA 3ZYXA 4H4PA 4YXDA 2ZZBA 4Z43A 3SYIA 3DJEA 4YKGA 1PJ5A 4ADWA 2PYXA 4EMJA 3UP5A 4A99A 4FK1A 2Q0LA 2YVJA 4A65A 4EQRA 5FS9A 2QA2A 4Z44A 1XHCA 2IIDA 2QCUA 1MXTA 3M0OA 4LA1A 3SQPA 5U63A 1Q9IA 2K3VA 1KSUA 4YSYA 1L9EA 2WOIA 1JEHA 4NNJA 3L1TA 1B5QA 1ZMDA 2TMDA 4P9SA 1BKWA 3IHMA 5DBJA 2C3DA 3UTEA 1GEUA 4TLXA 5CQFA 4U8PA 4J56A 1B37A 4CBQA 3BNJA 2WOWA 3PS9A 1KFYA 2GQFA 3TORA 4AT2A 4JY2A 3M12A 1DOCA 1E1NA 1NEKA 1O94A 4MJWA 1FT6A 4YSZA 4JDRA 4Q5BA 5U1OA 1Y0PA 2FJDA 1GPEA 4IA6A 2W0HA 3SZ0A 2WPFA 1CJCA 2XLRA 3T37A 2J7AA 5FMHA 3GD4A 4C3YA 5JCLA 4TM4A 3ZDNA 4APNA 3LGQA 4CNKA 3QVPA 1IUSA 1EL8A 1M1QA 1PBCA 1ELIA 1NHPA 2AAQA 4OPGA 1PBEA 1LQTA 3CN8A 2YM1A 2YLSA 1O95A 1GXFA 1N4UA 2C75A 2RABA 4K22A 3SFEA 2E80A 2PHHA 3ISHA 4NTEA 3AYJA 4H4QA 4HA6A 4U8KA 1ZY8A 3AEEA 4YTNA 4AOSA 4OPCA 2XLTA 4YTPA 3AE8A 2O9ZA 3BNHA 2OALA 2B7RA 1FEAA 1KDGA 1E6EA 2OT4A 3NTDA 2C64A 1BF3A 2WETA 1BGJA 1F8SA 3DK4A 4CRTA 4UP3A 2XVFA 2VQ7A 3FG2P 2XFQA 1PJ6A 1YQ4A 1LJ1A 1FEBA 2B9WA 1Q1RA 3DMEA 2YLTA 5JCNA 2GRTA 3T31A 2RF7A 3IHGA 3V3NA 3SM8A 1S2YA 3DGZA 3ICRA 1CC6A 3NTAA 4LU6A 3OC4A 1TDKA 3UOZA 2F5ZA 1L9CA 3G5QA 2HQMA 4ECHA 2GMJA 4USRA 3IC9A 5KVHA 1BGNA 2GVCA 2IVDA 2WEUA 3DA1A 2J3NA 4IVOB 2YVGA 4I59A 2CZSA 4U8NA 4HB9A 1CC4A 1RSGA 1NAAA 3AYIA 4OPIA 4KPRA 1LQUA 1GREA 2H89A 1XPQA 2C4CA 1K4QA 3ALMA 1GRTA 1JNIA 3FO3A 1VQWA 3GD3A 1IUXA 2BK3A 3IF9A 3KKJA 4G9KA 2C76A 2UZZA 2YR5A 1H6VA 1GRHA 3AEFA 1FT5A 2R4EA 1JNRA 1OJTA 2WU2A 3NIXA 4H4ZA 2YLWA 4G73A 4NEVA 3UKAA 1FS9A 2Q6UA 2QAEA 1PS9A 2H88A 2YG6A 5C3JA 4JN9A 1GTHA 2YVFA 3O0HA 4OCGA 5U25A 4EMWA 3UKPA 2YAUA 3UKKA 4H4SA 4U8MA 4H2QA 3GDNA 3L8KA 4XXGA 2GR2A 2X3NA 4GF7A 4WJYA 3H4KA 4EM3A 3C96A 1DXLA 2BYBA 2VVLA 3AWIA 3P1WA 1FECA 1HYUA 1SEZA 2BS2A 2R46A 4C74A 3C4NA 3H8LA 2C73A 4GRTA 4U8OA 4X4JA 1BVBA 3VRBA 1GOSA 2GQWA 3I3LA 4NTDA 5JCIA 1GETA 3P4PA 3GYIA 3SXIA 2R0GA 4B65A 4IV9A 5HXIA 3KA7A 1L9DA 1H84A 3P4SA 2ACZA 2YM2A 2WP5A 3CTYA 3GSIA 1KSSA 1PBBA 2ZBWA 1YQ3A 3DJJA 3UTGA 3V3OA 1EBDA 4YWOA 5C2TA 4J31A 3SX6A 2ZZ0A 1E1LA 3HYVA 2BACA 3EANA 3HYXA 3KPFA 4JQ9A 3K7QX 3AEDA 1YY5A 2RGJA 1CJ2A 2BRYA 3CNPA 4U8JA 3LADA 4H4XA 3UOYA 1TDNA 2V5ZA 1LVLA 2YR6A 3SZFA 3LG1A 4BV6A 4E0VA 3S7WA 3ATRA 4J33A 1JRXA 5KRQA 3OWMA 2OLOA 4GDEA 5M0ZA 1QO8A 3KVEA 1ZDLA 1PN0A 2Q7VA 4CNJA 3CNTA 3GYJA 3UOXA 5JCMA 1H86A 2YLRA 3UTFA 3SGLA 4BURA 4EQWA 5IQ4A 4K7ZA 5HHFA 4H2PA 4BJZA 3BI4A 2BCPA 3NN0X 3PVCA 2XCGA 3QFBA 2EQ7A 1PJ7A 2WQYA 3SZCA 4Y4LA 3QFAA 2RGHA 2XYOA 4D03A 3BHFA 5KMRA 2JB3A 3ALJA 2WDVA 4ZCCA 4B67A 4RSLA 5BVAA 3AE5A 3G5RA 4RG3A 1QJDA 5KNLA 4L38A 1IUTA 4B66A 2BRAA 1PHHA 1CHUA 1ZOYA 1GRGA 4GUVA 3COXA 3ICTA 5GSNA 5KWFA 3ATQA 3DK9A 5EBKA 4AP1A 2XVHA 1FCDA 3T14A 1KNPA 3NH3X 4II3A 4UDRA 1RYIA 1D7YA 2ARDA 3AYLA 3BNUA 1ZMCA 2WDRA 4G74A 2GEWA 4EIQA 1K0IA 2TPRA 1YQZA 1GRBA 3GMBA 2E5VA 1V59A 4H2NA 3RP6A 3NG7X 4H2RA 3AE1A 4BK2A 1E1KA 2VVLG 2XLPA 3NT6A 3SCEA 1ZOVA 2C65A 3GMCA 1NDAA 4ZN0A 4A79A 1H83A 4YT0A 5BRTA 2YG7A 1DJNA 1Q1WA 2FJBA 4EIPA 1BZLA 2C70A 2BC1A 3B3RA 4M52A 5KMQA 4ZCDA 4Z24A 1FOHA 2WBAA 5FS8A 2B9XA 2BK5A 4O5QA 4Z26A 4JNQA 4U8LA 1ZX9A 3AE4A 1F3PA 1CJ4A 3F8PA 2GV8A 2XVIA 1ZKQA 4REKA 1OJDA 2FBWA 1IUWA 3F29A 2ZZCA 3LB8A 3NK1X 4Q17A 4H4YA 5EB5A 1CF3A 1B8SA 4J34A 3RHAA 1MOKA 1S3BA 3K7TA 3AEBA 2C7GA 3QJ4A 3WE0A 2EQ6A 2WU5A 2EQ8A
chains in the Genus database with same CATH topology
4TM0A 1M6IA 1ZK7A 2C72A 3D1IA 1S2QA 4GAVA 4H4WA 2X8CA 1XANA 4USQA 5TR3A 3TTBA 1OJCA 1D4EA 3SFDA 1DJQA 2XDOA 1TDFA 1TYPA 2A87A 2E4GA 4J36A 1RP0A 4XWRA 2GB0A 1DOEA 4Q4UA 4L3YA 2BXSA 3BNFA 2YLXA 2JKCA 4EQSA 1KF6A 1GV4A 4UDQA 2GR3A 1K0JA 2APGA 2FJEA 2WP6A 4NEWA 4TM3A 3VRAA 1E1MA 1LPFA 1GU6A 3CPHG 1F8RA 4YSHA 1D5TA 1REOA 3ALLA 5FS7A 1P2EA 3RNMA 2VVMA 4H4VA 2CULA 2XLSA 1OJAA 3AB1A 2OA1A 2VRLA 4A7AA 5LV9A 1CL0A 1VG9A 2Y6RA 4KX6A 1DOBA 1GERA 4C77A 1F8WA 2GR1A 1GALA 2Z5XA 1IUUA 1NHQA 3CGEA 3S61A 4A5LA 4B1BA 5CKUA 2R9ZA 4FDCB 4FX9A 5BUKA 4K8DA 4IVMB 3D8XA 2VR0A 3KLJA 1MO9A 3DJGX 4D04A 1NG3A 2BA9A 2FJAA 1JOAA 2NVKX 2R4JA 3NLCA 3NYCA 3Q9TA 3R9UA 1BWCA 3CNSA 1GSNA 4K5RA 2E81A 2X8HA 3CGBA 2C3CA 4EMIA 2XFOA 2WP9A 4X9MA 3UKFA 2AQJA 1FL2A 2XVJA 4JNAA 1GT8A 1ONFA 3K30A 1N4VA 3NGCX 2JAEA 3DJDA 3G5SA 2GR0A 3RP7A 3KPKA 1B4VA 3QVRA 4DNAA 5HY5A 1NPXA 4B69A 2C67A 3CNJA 1GRFA 1KNRA 2X50A 2YLZA 5KMSA 4PABA 5KVIA 4GCMA 2V3BA 3VR8A 3BI5A 3VR9A 2VQBA 2GAGB 4A9WA 1L0VA 2WS3A 4JY3A 1PXAA 4WCTA 4Z2TA 2CVJA 1EL7A 5IQ1A 1M1RA 4OVIA 1COYA 1GRAA 1PDHA 1TDOA 1JNZA 2B9YA 4G6GA 4YKFA 4Q5CA 3T0KA 3F8DA 1OAHA 3AE7A 3P4QA 2BXRA 1IUVA 1Y56B 4BK1A 3V76A 3UTHA 3UKQA 1EL5A 2WHDA 3GWFA 3FIMB 1AOGA 1FS8A 2WPEA 1N4WA 3PO7A 4N9XA 1H7WA 3SZWA 3M13A 4NWZA 4Z25A 4OPTA 3UU9A 4I58A 4K2XA 3T2ZA 3H8IA 1CJ3A 1O5WA 4H50A 3BHKA 2WESA 1TYTA 1YKJA 4CY8A 3LZXA 4G6HA 4II2A 2R0PA 2CDUA 2ZO5A 3GM6A 1GNDA 2NPXA 5J7XA 1K0LA 3GRTA 1UKVG 3F8RA 3KD9A 4H4UA 4B63A 2YG5A 3EPTA 2VOUA 2YR4A 3UKHA 3DH9A 2V6OA 2JBVA 3URHA 2Z5YA 2WDQA 4CCQA 3RKHA 1OJ9A 3AD8B 4Q1OA 3ADAB 3NN6X 5KXJA 1NHRA 3BI2A 1GTEA 4GDPA 2JB2A 2DKHA 1PXBA 1SP3A 3DK8A 4ICYA 3VQRA 4TLZA 4OPUA 4EQXA 2A89A 2CFYA 3CPJG 4Z2RA 3CMMA 3LZWA 5JCKA 4NZHA 4B68A 3NYFA 1W4XA 2X8GA 3II4A 1ZP0A 2BC0A 4WX1A 3UP4A 4AP3A 3CPIG 2WOVA 2B76A 3CGCA 3I6DA 1EL9A 1LV0A 3AE2A 1DODA 4Y4MA 3NHOX 3T2KA 5ER0A 3UKLA 4A6NB 4A6NA 4BK3A 3AE9A 4J57A 3T2YA 2OAMA 2E1MA 4GAPA 1D4CA 4TM1A 4DSHA 3IWAA 2EQ9A 1D4DA 4Z2UA 1QDBA 2JK6A 3QSMA 3VRDB 4C5OA 4YTMA 1VDCA 3UBRA 4U8IA 4XWZA 4BJYA 3RP8A 1NHSA 2A8XA 1N1PA 2VRMA 2QA1A 3S5WA 1JRZA 1PBDA 3JSKA 4U2TA 3FMWA 1JRYA 3FBSA 3EF6A 1QLBA 2X99A 3AE6A 4C3XA 4NTCA 3BNMA 4AOXA 2XFPA 3AE3A 2Q0KA 4PAAA 3LXDA 3NYEA 2BABA 2RDZA 3OZ2A 3UOVA 2I0ZA 3LJPA 2R45A 2V3AA 2GAHB 2BK4A 1PXCA 4U2SA 1E39A 1DNCA 3P4RA 4Y4NA 4OPDA 5M10A 3L1RA 3NNEA 3BNGA 1TDEA 3B6DA 1D7LA 2YG4A 3GDPA 3HZLA 4B64A 1PBFA 1LTXR 4LIIA 2IVEA 4H4TA 1FS7A 2RGOA 2C66A 4AT0A 3K7MX 3AECA 3E1TA 4H4RA 2XFUA 3C4AA 1F6MA 1XDIA 3KU9A 3REDA 4L3ZA 3FPZA 1P2HA 4EM4A 1NG4A 3CIRA 5BULA 2BS4A 2BS3A 1CBOA 5HYMA 4YSXA 2V60A 5IPYA 3ABVA 2R0CA 2XLUA 4CCRA 1CC2A 3D1CA 4CY6A 5KOWA 2LFCA 5KOXA 4FK1C 2Y6QA 3MMOA 4X9NA 3NK2X 2XFNA 2GMHA 3GWDA 1IJHA 3ICSA 2JB1A 2OLNA 3HYWA 4L3XA 4K5SA 3EAOA 3LOVA 3UCLA 4DGKA 2YG3A 4Q0TA 5GRTA 2XVEA 3QSEA 1VRQB 5EB4A 4J2WA 4GR1A 2BCGG 3SXQA 2GH5A 1X31B 3AEAA 3ITJA 1TRBA 3NRNA 3SY4A 1M1PA 3AD9B 2DKIA 2AR8A 3GRSA 2WPCA 2B7SA 4DSGA 2YQUA 3CNDA 1Z6LA 4IA5A 3AXBA 1JU2A 1S3EA 3P9UA 3NKSA 3CGDA 4RG4A 5FS6A 4O5UA 5KMPA 2V61A 1GESA 4OPLA 2YWLA 3AD7B 3DGHA 1H82A 3Q6JA 3NK0X 1H7XA 5L46A 1H81A 4UDPA 2VZ2A 3QSSA 4H7UA 5EOWA 1VG0A 2GF3A 1M64A 5J60A 1NENA 1E7PA 1Y56A 3AEGA 3GYXA 4U2LA 3ZYXA 4H4PA 4YXDA 2ZZBA 4Z43A 3SYIA 3DJEA 4YKGA 1PJ5A 4ADWA 2PYXA 4EMJA 3UP5A 4A99A 4FK1A 2Q0LA 2YVJA 4A65A 4EQRA 5FS9A 2QA2A 4Z44A 1XHCA 2IIDA 2QCUA 1MXTA 3M0OA 4LA1A 3SQPA 5U63A 1Q9IA 2K3VA 1KSUA 4YSYA 1L9EA 2WOIA 1JEHA 4NNJA 3L1TA 1B5QA 1ZMDA 2TMDA 4P9SA 1BKWA 3IHMA 5DBJA 2C3DA 3UTEA 1GEUA 4TLXA 5CQFA 4U8PA 4J56A 1B37A 4CBQA 3BNJA 2WOWA 3PS9A 1KFYA 2GQFA 3TORA 4AT2A 4JY2A 3M12A 1DOCA 1E1NA 1NEKA 1O94A 4MJWA 1FT6A 4YSZA 4JDRA 4Q5BA 5U1OA 1Y0PA 2FJDA 1GPEA 4IA6A 2W0HA 3SZ0A 2WPFA 1CJCA 2XLRA 3T37A 2J7AA 5FMHA 3GD4A 4C3YA 5JCLA 4TM4A 3ZDNA 4APNA 3LGQA 4CNKA 3QVPA 1IUSA 1EL8A 1M1QA 1PBCA 1ELIA 1NHPA 2AAQA 4OPGA 1PBEA 1LQTA 3CN8A 2YM1A 2YLSA 1O95A 1GXFA 1N4UA 2C75A 2RABA 4K22A 3SFEA 2E80A 2PHHA 3ISHA 4NTEA 3AYJA 4H4QA 4HA6A 4U8KA 1ZY8A 3AEEA 4YTNA 4AOSA 4OPCA 2XLTA 4YTPA 3AE8A 2O9ZA 3BNHA 2OALA 2B7RA 1FEAA 1KDGA 1E6EA 2OT4A 3NTDA 2C64A 1BF3A 2WETA 1BGJA 1F8SA 3DK4A 4CRTA 4UP3A 2XVFA 2VQ7A 3FG2P 2XFQA 1PJ6A 1YQ4A 1LJ1A 1FEBA 2B9WA 1Q1RA 3DMEA 2YLTA 5JCNA 2GRTA 3T31A 2RF7A 3IHGA 3V3NA 3SM8A 1S2YA 3DGZA 3ICRA 1CC6A 3NTAA 4LU6A 3OC4A 1TDKA 3UOZA 2F5ZA 1L9CA 3G5QA 2HQMA 4ECHA 2GMJA 4USRA 3IC9A 5KVHA 1BGNA 2GVCA 2IVDA 2WEUA 3DA1A 2J3NA 4IVOB 2YVGA 4I59A 4U8NA 4HB9A 1CC4A 1RSGA 1NAAA 3AYIA 4OPIA 4KPRA 1LQUA 1GREA 2H89A 1XPQA 2C4CA 1K4QA 3ALMA 1GRTA 1JNIA 3FO3A 1VQWA 3GD3A 1IUXA 2BK3A 3IF9A 3KKJA 4G9KA 2C76A 2UZZA 2YR5A 1H6VA 1GRHA 3AEFA 1FT5A 2R4EA 1JNRA 1OJTA 2WU2A 3NIXA 4H4ZA 2YLWA 4G73A 4NEVA 3UKAA 1FS9A 2Q6UA 2QAEA 1PS9A 2H88A 2YG6A 5C3JA 4JN9A 1GTHA 2YVFA 3O0HA 4OCGA 5U25A 4EMWA 3UKPA 2YAUA 3UKKA 4H4SA 4U8MA 4H2QA 3GDNA 3L8KA 4XXGA 2GR2A 2X3NA 4GF7A 4WJYA 3H4KA 4EM3A 3C96A 1DXLA 2BYBA 2VVLA 3AWIA 3P1WA 1FECA 1HYUA 1SEZA 2BS2A 2R46A 4C74A 3C4NA 3H8LA 2C73A 4GRTA 4U8OA 4X4JA 1BVBA 3VRBA 1GOSA 2GQWA 3I3LA 4NTDA 5JCIA 1GETA 3P4PA 3GYIA 3SXIA 2R0GA 4B65A 4IV9A 5HXIA 3KA7A 1L9DA 1H84A 3P4SA 2ACZA 2YM2A 2WP5A 3CTYA 3GSIA 1KSSA 1PBBA 2ZBWA 1YQ3A 3DJJA 3UTGA 3V3OA 1EBDA 4YWOA 5C2TA 4J31A 3SX6A 2ZZ0A 1E1LA 3HYVA 2BACA 3EANA 3HYXA 3KPFA 4JQ9A 3K7QX 3AEDA 1YY5A 2RGJA 1CJ2A 2BRYA 3CNPA 4U8JA 3LADA 4H4XA 3UOYA 1TDNA 2V5ZA 1LVLA 2YR6A 3SZFA 3LG1A 4BV6A 4E0VA 3S7WA 3ATRA 4J33A 1JRXA 5KRQA 3OWMA 2OLOA 4GDEA 5M0ZA 1QO8A 3KVEA 1ZDLA 1PN0A 2Q7VA 4CNJA 3CNTA 3GYJA 3UOXA 5JCMA 1H86A 2YLRA 3UTFA 3SGLA 4BURA 4EQWA 5IQ4A 4K7ZA 5HHFA 4H2PA 4BJZA 3BI4A 2BCPA 3NN0X 3PVCA 2XCGA 3QFBA 2EQ7A 1PJ7A 2WQYA 3SZCA 4Y4LA 3QFAA 2RGHA 2XYOA 4D03A 3BHFA 5KMRA 2JB3A 3ALJA 2WDVA 4ZCCA 4B67A 4RSLA 5BVAA 3AE5A 3G5RA 4RG3A 1QJDA 5KNLA 4L38A 1IUTA 4B66A 2BRAA 1PHHA 1CHUA 1ZOYA 1GRGA 4GUVA 3COXA 3ICTA 5GSNA 5KWFA 3ATQA 3DK9A 5EBKA 4AP1A 2XVHA 1FCDA 3T14A 1KNPA 3NH3X 4II3A 4UDRA 1RYIA 1D7YA 2ARDA 3AYLA 3BNUA 1ZMCA 2WDRA 4G74A 2GEWA 4EIQA 1K0IA 2TPRA 1YQZA 1GRBA 3GMBA 2E5VA 1V59A 4H2NA 3RP6A 3NG7X 4H2RA 3AE1A 4BK2A 1E1KA 2VVLG 2XLPA 3NT6A 3SCEA 1ZOVA 2C65A 3GMCA 1NDAA 4ZN0A 4A79A 1H83A 4YT0A 5BRTA 2YG7A 1DJNA 1Q1WA 2FJBA 4EIPA 1BZLA 2C70A 2BC1A 3B3RA 4M52A 5KMQA 4ZCDA 4Z24A 1FOHA 2WBAA 5FS8A 2B9XA 2BK5A 4O5QA 4Z26A 4JNQA 4U8LA 1ZX9A 3AE4A 1F3PA 1CJ4A 3F8PA 2GV8A 2XVIA 1ZKQA 4REKA 1OJDA 2FBWA 1IUWA 3F29A 2ZZCA 3LB8A 3NK1X 4Q17A 4H4YA 5EB5A 1CF3A 1B8SA 4J34A 3RHAA 1MOKA 1S3BA 3K7TA 3AEBA 2C7GA 3QJ4A 3WE0A 2EQ6A 2WU5A 2EQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TM0 A;  1M6I A;  1ZK7 A;  2C72 A;  3D1I A;  1S2Q A;  4H4W A;  2X8C A;  1XAN A;  4USQ A;  5TR3 A;  3TTB A;  1OJC A;  1D4E A;  3SFD A;  1DJQ A;  2XDO A;  1TDF A;  1TYP A;  2A87 A;  2E4G A;  4J36 A;  1RP0 A;  4XWR A;  2GB0 A;  1DOE A;  4Q4U A;  4L3Y A;  2BXS A;  3BNF A;  2YLX A;  2JKC A;  4EQS A;  1KF6 A;  1GV4 A;  4UDQ A;  2GR3 A;  1K0J A;  2APG A;  2FJE A;  2WP6 A;  4NEW A;  4TM3 A;  3VRA A;  1E1M A;  1LPF A;  1GU6 A;  3CPH G;  1F8R A;  4YSH A;  1D5T A;  1REO A;  3ALL A;  5FS7 A;  1P2E A;  3RNM A;  2VVM A;  4H4V A;  2CUL A;  2XLS A;  1OJA A;  3AB1 A;  2OA1 A;  2VRL A;  4A7A A;  5LV9 A;  1CL0 A;  1VG9 A;  2Y6R A;  4KX6 A;  1DOB A;  1GER A;  4C77 A;  1F8W A;  2GR1 A;  1GAL A;  2Z5X A;  1IUU A;  1NHQ A;  3CGE A;  3S61 A;  4A5L A;  4B1B A;  5CKU A;  2R9Z A;  4FDC B;  4FX9 A;  5BUK A;  4K8D A;  4IVM B;  3D8X A;  2VR0 A;  3KLJ A;  1MO9 A;  3DJG X;  4D04 A;  1NG3 A;  2BA9 A;  2FJA A;  1JOA A;  2NVK X;  2R4J A;  3NLC A;  3NYC A;  3Q9T A;  3R9U A;  1BWC A;  3CNS A;  1GSN A;  4K5R A;  2E81 A;  2X8H A;  3CGB A;  2C3C A;  4EMI A;  2XFO A;  2WP9 A;  4X9M A;  3UKF A;  2AQJ A;  1FL2 A;  2XVJ A;  4JNA A;  1GT8 A;  1ONF A;  3K30 A;  1N4V A;  3NGC X;  2JAE A;  3DJD A;  3G5S A;  2GR0 A;  3RP7 A;  3QVR A;  1B4V A;  4DNA A;  5HY5 A;  1NPX A;  4B69 A;  2C67 A;  3CNJ A;  1GRF A;  1KNR A;  2X50 A;  2YLZ A;  4PAB A;  5KVI A;  4GCM A;  2V3B A;  3VR8 A;  3BI5 A;  3VR9 A;  2VQB A;  2GAG B;  4A9W A;  1L0V A;  2WS3 A;  4JY3 A;  1PXA A;  4WCT A;  4Z2T A;  2CVJ A;  1EL7 A;  5IQ1 A;  1M1R A;  4OVI A;  1COY A;  1GRA A;  1PDH A;  1TDO A;  1JNZ A;  2B9Y A;  4YKF A;  4Q5C A;  3F8D A;  1OAH A;  3AE7 A;  3P4Q A;  2BXR A;  1IUV A;  1Y56 B;  4BK1 A;  3V76 A;  3UTH A;  3UKQ A;  1EL5 A;  2WHD A;  3GWF A;  3FIM B;  1AOG A;  1FS8 A;  2WPE A;  1N4W A;  3PO7 A;  4N9X A;  1H7W A;  3M13 A;  4OPT A;  3UU9 A;  4I58 A;  4K2X A;  3H8I A;  1CJ3 A;  1O5W A;  4H50 A;  3BHK A;  2WES A;  1TYT A;  1YKJ A;  4CY8 A;  3LZX A;  2R0P A;  2CDU A;  2ZO5 A;  3GM6 A;  1GND A;  2NPX A;  5J7X A;  1K0L A;  3GRT A;  1UKV G;  3F8R A;  3KD9 A;  4H4U A;  4B63 A;  2YG5 A;  3EPT A;  2VOU A;  2YR4 A;  3UKH A;  3DH9 A;  2V6O A;  2JBV A;  3URH A;  2Z5Y A;  2WDQ A;  4CCQ A;  3RKH A;  1OJ9 A;  3AD8 B;  4Q1O A;  3ADA B;  3NN6 X;  5KXJ A;  1NHR A;  3BI2 A;  1GTE A;  4GDP A;  2JB2 A;  2DKH A;  1PXB A;  1SP3 A;  3DK8 A;  4ICY A;  3VQR A;  4TLZ A;  4OPU A;  4EQX A;  2A89 A;  2CFY A;  3CPJ G;  4Z2R A;  5JCK A;  3LZW A;  4NZH A;  4B68 A;  3NYF A;  1W4X A;  2X8G A;  3II4 A;  1ZP0 A;  2BC0 A;  4WX1 A;  3UP4 A;  4AP3 A;  3CPI G;  2WOV A;  2B76 A;  3CGC A;  3I6D A;  1EL9 A;  1LV0 A;  3AE2 A;  1DOD A;  4Y4M A;  3NHO X;  3UKL A;  5ER0 A;  4A6N B;  4Z25 A;  4A6N A;  4BK3 A;  3AE9 A;  4J57 A;  2OAM A;  2E1M A;  4TM1 A;  1D4C A;  4DSH A;  3IWA A;  2EQ9 A;  1D4D A;  4Z2U A;  1QDB A;  2JK6 A;  3QSM A;  3VRD B;  4C5O A;  4YTM A;  1VDC A;  3UBR A;  4U8I A;  4XWZ A;  4BJY A;  3RP8 A;  1NHS A;  2A8X A;  1N1P A;  2VRM A;  2QA1 A;  3S5W A;  1JRZ A;  1PBD A;  3JSK A;  4U2T A;  3FMW A;  1JRY A;  3FBS A;  3EF6 A;  1QLB A;  2X99 A;  3AE6 A;  4C3X A;  4NTC A;  3BNM A;  4AOX A;  2XFP A;  3AE3 A;  2Q0K A;  4PAA A;  3LXD A;  3NYE A;  2BAB A;  2RDZ A;  3OZ2 A;  3UOV A;  2I0Z A;  3LJP A;  2R45 A;  2V3A A;  2GAH B;  2BK4 A;  1PXC A;  4U2S A;  1E39 A;  1DNC A;  3P4R A;  4Y4N A;  4OPD A;  5M10 A;  3L1R A;  3NNE A;  3BNG A;  1TDE A;  3B6D A;  1D7L A;  2YG4 A;  3GDP A;  3HZL A;  4B64 A;  1PBF A;  1LTX R;  4LII A;  2IVE A;  4H4T A;  1FS7 A;  2RGO A;  2C66 A;  4AT0 A;  3K7M X;  3AEC A;  3E1T A;  4H4R A;  2XFU A;  3C4A A;  1F6M A;  1XDI A;  3KU9 A;  3RED A;  4L3Z A;  3FPZ A;  1P2H A;  4EM4 A;  1NG4 A;  3CIR A;  5BUL A;  2BS4 A;  2BS3 A;  1CBO A;  5HYM A;  4YSX A;  2V60 A;  5IPY A;  3ABV A;  2R0C A;  2XLU A;  4CCR A;  1CC2 A;  3D1C A;  4CY6 A;  5KOW A;  2LFC A;  5KOX A;  4FK1 C;  2Y6Q A;  3MMO A;  4X9N A;  3NK2 X;  2XFN A;  2GMH A;  3GWD A;  1IJH A;  3ICS A;  2JB1 A;  2OLN A;  4L3X A;  4K5S A;  3EAO A;  3LOV A;  3UCL A;  4DGK A;  2YG3 A;  4Q0T A;  5GRT A;  2XVE A;  3QSE A;  1VRQ B;  5EB4 A;  4J2W A;  4GR1 A;  2BCG G;  3SXQ A;  2GH5 A;  1X31 B;  3AEA A;  3ITJ A;  1TRB A;  3NRN A;  1M1P A;  3AD9 B;  2DKI A;  2AR8 A;  3GRS A;  2WPC A;  2B7S A;  4DSG A;  2YQU A;  3CND A;  1Z6L A;  4IA5 A;  3AXB A;  1JU2 A;  1S3E A;  3P9U A;  3NKS A;  3CGD A;  4RG4 A;  5FS6 A;  4O5U A;  2V61 A;  1GES A;  4OPL A;  2YWL A;  3AD7 B;  3DGH A;  1H82 A;  3Q6J A;  3NK0 X;  1H7X A;  5L46 A;  1H81 A;  4UDP A;  2VZ2 A;  3QSS A;  4H7U A;  5EOW A;  1VG0 A;  2GF3 A;  1M64 A;  5J60 A;  1NEN A;  1E7P A;  1Y56 A;  3AEG A;  4U2L A;  3ZYX A;  4YXD A;  4H4P A;  3GYX A;  2ZZB A;  4Z43 A;  3DJE A;  4YKG A;  1PJ5 A;  4ADW A;  2PYX A;  4EMJ A;  3UP5 A;  4A99 A;  4FK1 A;  2Q0L A;  2YVJ A;  4A65 A;  4EQR A;  5FS9 A;  2QA2 A;  4Z44 A;  1XHC A;  2IID A;  2QCU A;  1MXT A;  3M0O A;  4LA1 A;  3SQP A;  5U63 A;  1Q9I A;  2K3V A;  1KSU A;  4YSY A;  1L9E A;  2WOI A;  1JEH A;  3L1T A;  1B5Q A;  1ZMD A;  2TMD A;  4P9S A;  1BKW A;  3IHM A;  5DBJ A;  2C3D A;  3UTE A;  1GEU A;  4TLX A;  5CQF A;  4U8P A;  4J56 A;  1B37 A;  4CBQ A;  3BNJ A;  2WOW A;  3PS9 A;  1KFY A;  2GQF A;  3TOR A;  4AT2 A;  4JY2 A;  3M12 A;  1DOC A;  1E1N A;  1NEK A;  1O94 A;  4MJW A;  1FT6 A;  4YSZ A;  4JDR A;  4Q5B A;  5U1O A;  1Y0P A;  2FJD A;  1GPE A;  4IA6 A;  2W0H A;  2WPF A;  1CJC A;  2XLR A;  3T37 A;  2J7A A;  5FMH A;  3GD4 A;  4C3Y A;  5JCL A;  4TM4 A;  3ZDN A;  4APN A;  3LGQ A;  4CNK A;  3QVP A;  1IUS A;  1EL8 A;  1M1Q A;  1PBC A;  1ELI A;  1NHP A;  2AAQ A;  4OPG A;  1PBE A;  1LQT A;  3CN8 A;  2YM1 A;  2YLS A;  1O95 A;  1GXF A;  1N4U A;  2C75 A;  2RAB A;  4K22 A;  3SFE A;  2E80 A;  2PHH A;  3ISH A;  4NTE A;  3AYJ A;  4H4Q A;  4HA6 A;  4U8K A;  1ZY8 A;  3AEE A;  4YTN A;  4AOS A;  4OPC A;  2XLT A;  4YTP A;  3AE8 A;  2O9Z A;  3BNH A;  2OAL A;  2B7R A;  1FEA A;  1KDG A;  1E6E A;  2OT4 A;  3NTD A;  2C64 A;  1BF3 A;  2WET A;  1BGJ A;  1F8S A;  3DK4 A;  4CRT A;  4UP3 A;  2XVF A;  2VQ7 A;  3FG2 P;  2XFQ A;  1PJ6 A;  1YQ4 A;  1LJ1 A;  1FEB A;  2B9W A;  1Q1R A;  3DME A;  2YLT A;  5JCN A;  2GRT A;  2RF7 A;  3IHG A;  3V3N A;  3SM8 A;  1S2Y A;  3DGZ A;  3ICR A;  1CC6 A;  3NTA A;  4LU6 A;  3OC4 A;  1TDK A;  3UOZ A;  2F5Z A;  1L9C A;  3G5Q A;  2HQM A;  4ECH A;  2GMJ A;  4USR A;  3IC9 A;  5KVH A;  1BGN A;  2GVC A;  2IVD A;  2WEU A;  3DA1 A;  2J3N A;  4IVO B;  2YVG A;  4I59 A;  4U8N A;  4HB9 A;  1CC4 A;  1RSG A;  1NAA A;  3AYI A;  4OPI A;  4KPR A;  1LQU A;  1GRE A;  2H89 A;  1XPQ A;  1K4Q A;  3ALM A;  1GRT A;  1JNI A;  3FO3 A;  1VQW A;  3GD3 A;  1IUX A;  2BK3 A;  3IF9 A;  3KKJ A;  2C76 A;  2UZZ A;  2YR5 A;  1H6V A;  1GRH A;  3AEF A;  1FT5 A;  2R4E A;  1JNR A;  1OJT A;  2WU2 A;  3NIX A;  4H4Z A;  2YLW A;  4NEV A;  3UKA A;  1FS9 A;  2Q6U A;  2QAE A;  1PS9 A;  2H88 A;  2YG6 A;  5C3J A;  4JN9 A;  1GTH A;  2YVF A;  3O0H A;  4OCG A;  5U25 A;  4EMW A;  3UKP A;  2YAU A;  3UKK A;  4H4S A;  4U8M A;  4H2Q A;  3GDN A;  3L8K A;  4XXG A;  2GR2 A;  2X3N A;  4GF7 A;  4WJY A;  3H4K A;  4EM3 A;  3C96 A;  1DXL A;  2BYB A;  2VVL A;  3AWI A;  3P1W A;  1FEC A;  1HYU A;  1SEZ A;  2BS2 A;  2R46 A;  4C74 A;  3C4N A;  3H8L A;  2C73 A;  4GRT A;  4U8O A;  4X4J A;  1BVB A;  3VRB A;  1GOS A;  2GQW A;  3I3L A;  4NTD A;  5JCI A;  1GET A;  3P4P A;  3GYI A;  2R0G A;  4B65 A;  4IV9 A;  5HXI A;  3KA7 A;  1L9D A;  1H84 A;  3P4S A;  2ACZ A;  2YM2 A;  2WP5 A;  3CTY A;  3GSI A;  1KSS A;  1PBB A;  2ZBW A;  1YQ3 A;  3DJJ A;  3UTG A;  3V3O A;  1EBD A;  4YWO A;  5C2T A;  4J31 A;  2ZZ0 A;  1E1L A;  2BAC A;  3EAN A;  3KPF A;  4JQ9 A;  3K7Q X;  3AED A;  1YY5 A;  2RGJ A;  1CJ2 A;  3CNP A;  4U8J A;  3LAD A;  4H4X A;  3UOY A;  1TDN A;  2V5Z A;  1LVL A;  2YR6 A;  4BV6 A;  3LG1 A;  4E0V A;  3S7W A;  3ATR A;  4J33 A;  1JRX A;  5KRQ A;  3OWM A;  2OLO A;  4GDE A;  5M0Z A;  1QO8 A;  3KVE A;  1ZDL A;  1PN0 A;  2Q7V A;  4CNJ A;  3CNT A;  3GYJ A;  3UOX A;  5JCM A;  1H86 A;  2YLR A;  3UTF A;  3SGL A;  4BUR A;  4EQW A;  5IQ4 A;  4K7Z A;  5HHF A;  4H2P A;  4BJZ A;  3BI4 A;  2BCP A;  3NN0 X;  3PVC A;  2XCG A;  3QFB A;  2EQ7 A;  1PJ7 A;  2WQY A;  4Y4L A;  3QFA A;  2RGH A;  2XYO A;  4D03 A;  3BHF A;  2JB3 A;  3ALJ A;  2WDV A;  4ZCC A;  4B67 A;  4RSL A;  5BVA A;  3AE5 A;  3G5R A;  4RG3 A;  1QJD A;  4L38 A;  1IUT A;  4B66 A;  1PHH A;  1CHU A;  1ZOY A;  1GRG A;  4GUV A;  3COX A;  3ICT A;  5GSN A;  5KWF A;  3ATQ A;  3DK9 A;  5EBK A;  4AP1 A;  2XVH A;  1FCD A;  1KNP A;  3NH3 X;  4UDR A;  1RYI A;  1D7Y A;  2ARD A;  3AYL A;  3BNU A;  1ZMC A;  2WDR A;  2GEW A;  4EIQ A;  1K0I A;  2TPR A;  1YQZ A;  1GRB A;  3GMB A;  2E5V A;  1V59 A;  4H2N A;  3RP6 A;  3NG7 X;  4H2R A;  3AE1 A;  4BK2 A;  1E1K A;  2VVL G;  2XLP A;  3NT6 A;  3SCE A;  1ZOV A;  2C65 A;  3GMC A;  1NDA A;  4ZN0 A;  4A79 A;  1H83 A;  4YT0 A;  5BRT A;  2YG7 A;  1DJN A;  1Q1W A;  2FJB A;  4EIP A;  1BZL A;  2C70 A;  2BC1 A;  3B3R A;  4M52 A;  4ZCD A;  4Z24 A;  1FOH A;  2WBA A;  5FS8 A;  2B9X A;  2BK5 A;  4O5Q A;  4Z26 A;  4JNQ A;  4U8L A;  1ZX9 A;  3AE4 A;  1F3P A;  1CJ4 A;  3F8P A;  2GV8 A;  2XVI A;  1ZKQ A;  4REK A;  1OJD A;  2FBW A;  1IUW A;  3F29 A;  2ZZC A;  3LB8 A;  3NK1 X;  4Q17 A;  4H4Y A;  5EB5 A;  1CF3 A;  1B8S A;  4J34 A;  3RHA A;  1MOK A;  1S3B A;  3K7T A;  3AEB A;  2C7G A;  3QJ4 A;  3WE0 A;  2EQ6 A;  2WU5 A;  2EQ8 A; 
#chains in the Genus database with same CATH topology
 4TM0 A;  1M6I A;  1ZK7 A;  2C72 A;  3D1I A;  1S2Q A;  4GAV A;  4H4W A;  2X8C A;  1XAN A;  4USQ A;  5TR3 A;  3TTB A;  1OJC A;  1D4E A;  3SFD A;  1DJQ A;  2XDO A;  1TDF A;  1TYP A;  2A87 A;  2E4G A;  4J36 A;  1RP0 A;  4XWR A;  2GB0 A;  1DOE A;  4Q4U A;  4L3Y A;  2BXS A;  3BNF A;  2YLX A;  2JKC A;  4EQS A;  1KF6 A;  1GV4 A;  4UDQ A;  2GR3 A;  1K0J A;  2APG A;  2FJE A;  2WP6 A;  4NEW A;  4TM3 A;  3VRA A;  1E1M A;  1LPF A;  1GU6 A;  3CPH G;  1F8R A;  4YSH A;  1D5T A;  1REO A;  3ALL A;  5FS7 A;  1P2E A;  3RNM A;  2VVM A;  4H4V A;  2CUL A;  2XLS A;  1OJA A;  3AB1 A;  2OA1 A;  2VRL A;  4A7A A;  5LV9 A;  1CL0 A;  1VG9 A;  2Y6R A;  4KX6 A;  1DOB A;  1GER A;  4C77 A;  1F8W A;  2GR1 A;  1GAL A;  2Z5X A;  1IUU A;  1NHQ A;  3CGE A;  3S61 A;  4A5L A;  4B1B A;  5CKU A;  2R9Z A;  4FDC B;  4FX9 A;  5BUK A;  4K8D A;  4IVM B;  3D8X A;  2VR0 A;  3KLJ A;  1MO9 A;  3DJG X;  4D04 A;  1NG3 A;  2BA9 A;  2FJA A;  1JOA A;  2NVK X;  2R4J A;  3NLC A;  3NYC A;  3Q9T A;  3R9U A;  1BWC A;  3CNS A;  1GSN A;  4K5R A;  2E81 A;  2X8H A;  3CGB A;  2C3C A;  4EMI A;  2XFO A;  2WP9 A;  4X9M A;  3UKF A;  2AQJ A;  1FL2 A;  2XVJ A;  4JNA A;  1GT8 A;  1ONF A;  3K30 A;  1N4V A;  3NGC X;  2JAE A;  3DJD A;  3G5S A;  2GR0 A;  3RP7 A;  3KPK A;  1B4V A;  3QVR A;  4DNA A;  5HY5 A;  1NPX A;  4B69 A;  2C67 A;  3CNJ A;  1GRF A;  1KNR A;  2X50 A;  2YLZ A;  5KMS A;  4PAB A;  5KVI A;  4GCM A;  2V3B A;  3VR8 A;  3BI5 A;  3VR9 A;  2VQB A;  2GAG B;  4A9W A;  1L0V A;  2WS3 A;  4JY3 A;  1PXA A;  4WCT A;  4Z2T A;  2CVJ A;  1EL7 A;  5IQ1 A;  1M1R A;  4OVI A;  1COY A;  1GRA A;  1PDH A;  1TDO A;  1JNZ A;  2B9Y A;  4G6G A;  4YKF A;  4Q5C A;  3T0K A;  3F8D A;  1OAH A;  3AE7 A;  3P4Q A;  2BXR A;  1IUV A;  1Y56 B;  4BK1 A;  3V76 A;  3UTH A;  3UKQ A;  1EL5 A;  2WHD A;  3GWF A;  3FIM B;  1AOG A;  1FS8 A;  2WPE A;  1N4W A;  3PO7 A;  4N9X A;  1H7W A;  3SZW A;  3M13 A;  4NWZ A;  4Z25 A;  4OPT A;  3UU9 A;  4I58 A;  4K2X A;  3T2Z A;  3H8I A;  1CJ3 A;  1O5W A;  4H50 A;  3BHK A;  2WES A;  1TYT A;  1YKJ A;  4CY8 A;  3LZX A;  4G6H A;  4II2 A;  2R0P A;  2CDU A;  2ZO5 A;  3GM6 A;  1GND A;  2NPX A;  5J7X A;  1K0L A;  3GRT A;  1UKV G;  3F8R A;  3KD9 A;  4H4U A;  4B63 A;  2YG5 A;  3EPT A;  2VOU A;  2YR4 A;  3UKH A;  3DH9 A;  2V6O A;  2JBV A;  3URH A;  2Z5Y A;  2WDQ A;  4CCQ A;  3RKH A;  1OJ9 A;  3AD8 B;  4Q1O A;  3ADA B;  3NN6 X;  5KXJ A;  1NHR A;  3BI2 A;  1GTE A;  4GDP A;  2JB2 A;  2DKH A;  1PXB A;  1SP3 A;  3DK8 A;  4ICY A;  3VQR A;  4TLZ A;  4OPU A;  4EQX A;  2A89 A;  2CFY A;  3CPJ G;  4Z2R A;  3CMM A;  3LZW A;  5JCK A;  4NZH A;  4B68 A;  3NYF A;  1W4X A;  2X8G A;  3II4 A;  1ZP0 A;  2BC0 A;  4WX1 A;  3UP4 A;  4AP3 A;  3CPI G;  2WOV A;  2B76 A;  3CGC A;  3I6D A;  1EL9 A;  1LV0 A;  3AE2 A;  1DOD A;  4Y4M A;  3NHO X;  3T2K A;  5ER0 A;  3UKL A;  4A6N B;  4A6N A;  4BK3 A;  3AE9 A;  4J57 A;  3T2Y A;  2OAM A;  2E1M A;  4GAP A;  1D4C A;  4TM1 A;  4DSH A;  3IWA A;  2EQ9 A;  1D4D A;  4Z2U A;  1QDB A;  2JK6 A;  3QSM A;  3VRD B;  4C5O A;  4YTM A;  1VDC A;  3UBR A;  4U8I A;  4XWZ A;  4BJY A;  3RP8 A;  1NHS A;  2A8X A;  1N1P A;  2VRM A;  2QA1 A;  3S5W A;  1JRZ A;  1PBD A;  3JSK A;  4U2T A;  3FMW A;  1JRY A;  3FBS A;  3EF6 A;  1QLB A;  2X99 A;  3AE6 A;  4C3X A;  4NTC A;  3BNM A;  4AOX A;  2XFP A;  3AE3 A;  2Q0K A;  4PAA A;  3LXD A;  3NYE A;  2BAB A;  2RDZ A;  3OZ2 A;  3UOV A;  2I0Z A;  3LJP A;  2R45 A;  2V3A A;  2GAH B;  2BK4 A;  1PXC A;  4U2S A;  1E39 A;  1DNC A;  3P4R A;  4Y4N A;  4OPD A;  5M10 A;  3L1R A;  3NNE A;  3BNG A;  1TDE A;  3B6D A;  1D7L A;  2YG4 A;  3GDP A;  3HZL A;  4B64 A;  1PBF A;  1LTX R;  4LII A;  2IVE A;  4H4T A;  1FS7 A;  2RGO A;  2C66 A;  4AT0 A;  3K7M X;  3AEC A;  3E1T A;  4H4R A;  2XFU A;  3C4A A;  1F6M A;  1XDI A;  3KU9 A;  3RED A;  4L3Z A;  3FPZ A;  1P2H A;  4EM4 A;  1NG4 A;  3CIR A;  5BUL A;  2BS4 A;  2BS3 A;  1CBO A;  5HYM A;  4YSX A;  2V60 A;  5IPY A;  3ABV A;  2R0C A;  2XLU A;  4CCR A;  1CC2 A;  3D1C A;  4CY6 A;  5KOW A;  2LFC A;  5KOX A;  4FK1 C;  2Y6Q A;  3MMO A;  4X9N A;  3NK2 X;  2XFN A;  2GMH A;  3GWD A;  1IJH A;  3ICS A;  2JB1 A;  2OLN A;  3HYW A;  4L3X A;  4K5S A;  3EAO A;  3LOV A;  3UCL A;  4DGK A;  2YG3 A;  4Q0T A;  5GRT A;  2XVE A;  3QSE A;  1VRQ B;  5EB4 A;  4J2W A;  4GR1 A;  2BCG G;  3SXQ A;  2GH5 A;  1X31 B;  3AEA A;  3ITJ A;  1TRB A;  3NRN A;  3SY4 A;  1M1P A;  3AD9 B;  2DKI A;  2AR8 A;  3GRS A;  2WPC A;  2B7S A;  4DSG A;  2YQU A;  3CND A;  1Z6L A;  4IA5 A;  3AXB A;  1JU2 A;  1S3E A;  3P9U A;  3NKS A;  3CGD A;  4RG4 A;  5FS6 A;  4O5U A;  5KMP A;  2V61 A;  1GES A;  4OPL A;  2YWL A;  3AD7 B;  3DGH A;  1H82 A;  3Q6J A;  3NK0 X;  1H7X A;  5L46 A;  1H81 A;  4UDP A;  2VZ2 A;  3QSS A;  4H7U A;  5EOW A;  1VG0 A;  2GF3 A;  1M64 A;  5J60 A;  1NEN A;  1E7P A;  1Y56 A;  3AEG A;  3GYX A;  4U2L A;  3ZYX A;  4H4P A;  4YXD A;  2ZZB A;  4Z43 A;  3SYI A;  3DJE A;  4YKG A;  1PJ5 A;  4ADW A;  2PYX A;  4EMJ A;  3UP5 A;  4A99 A;  4FK1 A;  2Q0L A;  2YVJ A;  4A65 A;  4EQR A;  5FS9 A;  2QA2 A;  4Z44 A;  1XHC A;  2IID A;  2QCU A;  1MXT A;  3M0O A;  4LA1 A;  3SQP A;  5U63 A;  1Q9I A;  2K3V A;  1KSU A;  4YSY A;  1L9E A;  2WOI A;  1JEH A;  4NNJ A;  3L1T A;  1B5Q A;  1ZMD A;  2TMD A;  4P9S A;  1BKW A;  3IHM A;  5DBJ A;  2C3D A;  3UTE A;  1GEU A;  4TLX A;  5CQF A;  4U8P A;  4J56 A;  1B37 A;  4CBQ A;  3BNJ A;  2WOW A;  3PS9 A;  1KFY A;  2GQF A;  3TOR A;  4AT2 A;  4JY2 A;  3M12 A;  1DOC A;  1E1N A;  1NEK A;  1O94 A;  4MJW A;  1FT6 A;  4YSZ A;  4JDR A;  4Q5B A;  5U1O A;  1Y0P A;  2FJD A;  1GPE A;  4IA6 A;  2W0H A;  3SZ0 A;  2WPF A;  1CJC A;  2XLR A;  3T37 A;  2J7A A;  5FMH A;  3GD4 A;  4C3Y A;  5JCL A;  4TM4 A;  3ZDN A;  4APN A;  3LGQ A;  4CNK A;  3QVP A;  1IUS A;  1EL8 A;  1M1Q A;  1PBC A;  1ELI A;  1NHP A;  2AAQ A;  4OPG A;  1PBE A;  1LQT A;  3CN8 A;  2YM1 A;  2YLS A;  1O95 A;  1GXF A;  1N4U A;  2C75 A;  2RAB A;  4K22 A;  3SFE A;  2E80 A;  2PHH A;  3ISH A;  4NTE A;  3AYJ A;  4H4Q A;  4HA6 A;  4U8K A;  1ZY8 A;  3AEE A;  4YTN A;  4AOS A;  4OPC A;  2XLT A;  4YTP A;  3AE8 A;  2O9Z A;  3BNH A;  2OAL A;  2B7R A;  1FEA A;  1KDG A;  1E6E A;  2OT4 A;  3NTD A;  2C64 A;  1BF3 A;  2WET A;  1BGJ A;  1F8S A;  3DK4 A;  4CRT A;  4UP3 A;  2XVF A;  2VQ7 A;  3FG2 P;  2XFQ A;  1PJ6 A;  1YQ4 A;  1LJ1 A;  1FEB A;  2B9W A;  1Q1R A;  3DME A;  2YLT A;  5JCN A;  2GRT A;  3T31 A;  2RF7 A;  3IHG A;  3V3N A;  3SM8 A;  1S2Y A;  3DGZ A;  3ICR A;  1CC6 A;  3NTA A;  4LU6 A;  3OC4 A;  1TDK A;  3UOZ A;  2F5Z A;  1L9C A;  3G5Q A;  2HQM A;  4ECH A;  2GMJ A;  4USR A;  3IC9 A;  5KVH A;  1BGN A;  2GVC A;  2IVD A;  2WEU A;  3DA1 A;  2J3N A;  4IVO B;  2YVG A;  4I59 A;  2CZS A;  4U8N A;  4HB9 A;  1CC4 A;  1RSG A;  1NAA A;  3AYI A;  4OPI A;  4KPR A;  1LQU A;  1GRE A;  2H89 A;  1XPQ A;  2C4C A;  1K4Q A;  3ALM A;  1GRT A;  1JNI A;  3FO3 A;  1VQW A;  3GD3 A;  1IUX A;  2BK3 A;  3IF9 A;  3KKJ A;  4G9K A;  2C76 A;  2UZZ A;  2YR5 A;  1H6V A;  1GRH A;  3AEF A;  1FT5 A;  2R4E A;  1JNR A;  1OJT A;  2WU2 A;  3NIX A;  4H4Z A;  2YLW A;  4G73 A;  4NEV A;  3UKA A;  1FS9 A;  2Q6U A;  2QAE A;  1PS9 A;  2H88 A;  2YG6 A;  5C3J A;  4JN9 A;  1GTH A;  2YVF A;  3O0H A;  4OCG A;  5U25 A;  4EMW A;  3UKP A;  2YAU A;  3UKK A;  4H4S A;  4U8M A;  4H2Q A;  3GDN A;  3L8K A;  4XXG A;  2GR2 A;  2X3N A;  4GF7 A;  4WJY A;  3H4K A;  4EM3 A;  3C96 A;  1DXL A;  2BYB A;  2VVL A;  3AWI A;  3P1W A;  1FEC A;  1HYU A;  1SEZ A;  2BS2 A;  2R46 A;  4C74 A;  3C4N A;  3H8L A;  2C73 A;  4GRT A;  4U8O A;  4X4J A;  1BVB A;  3VRB A;  1GOS A;  2GQW A;  3I3L A;  4NTD A;  5JCI A;  1GET A;  3P4P A;  3GYI A;  3SXI A;  2R0G A;  4B65 A;  4IV9 A;  5HXI A;  3KA7 A;  1L9D A;  1H84 A;  3P4S A;  2ACZ A;  2YM2 A;  2WP5 A;  3CTY A;  3GSI A;  1KSS A;  1PBB A;  2ZBW A;  1YQ3 A;  3DJJ A;  3UTG A;  3V3O A;  1EBD A;  4YWO A;  5C2T A;  4J31 A;  3SX6 A;  2ZZ0 A;  1E1L A;  3HYV A;  2BAC A;  3EAN A;  3HYX A;  3KPF A;  4JQ9 A;  3K7Q X;  3AED A;  1YY5 A;  2RGJ A;  1CJ2 A;  2BRY A;  3CNP A;  4U8J A;  3LAD A;  4H4X A;  3UOY A;  1TDN A;  2V5Z A;  1LVL A;  2YR6 A;  3SZF A;  3LG1 A;  4BV6 A;  4E0V A;  3S7W A;  3ATR A;  4J33 A;  1JRX A;  5KRQ A;  3OWM A;  2OLO A;  4GDE A;  5M0Z A;  1QO8 A;  3KVE A;  1ZDL A;  1PN0 A;  2Q7V A;  4CNJ A;  3CNT A;  3GYJ A;  3UOX A;  5JCM A;  1H86 A;  2YLR A;  3UTF A;  3SGL A;  4BUR A;  4EQW A;  5IQ4 A;  4K7Z A;  5HHF A;  4H2P A;  4BJZ A;  3BI4 A;  2BCP A;  3NN0 X;  3PVC A;  2XCG A;  3QFB A;  2EQ7 A;  1PJ7 A;  2WQY A;  3SZC A;  4Y4L A;  3QFA A;  2RGH A;  2XYO A;  4D03 A;  3BHF A;  5KMR A;  2JB3 A;  3ALJ A;  2WDV A;  4ZCC A;  4B67 A;  4RSL A;  5BVA A;  3AE5 A;  3G5R A;  4RG3 A;  1QJD A;  5KNL A;  4L38 A;  1IUT A;  4B66 A;  2BRA A;  1PHH A;  1CHU A;  1ZOY A;  1GRG A;  4GUV A;  3COX A;  3ICT A;  5GSN A;  5KWF A;  3ATQ A;  3DK9 A;  5EBK A;  4AP1 A;  2XVH A;  1FCD A;  3T14 A;  1KNP A;  3NH3 X;  4II3 A;  4UDR A;  1RYI A;  1D7Y A;  2ARD A;  3AYL A;  3BNU A;  1ZMC A;  2WDR A;  4G74 A;  2GEW A;  4EIQ A;  1K0I A;  2TPR A;  1YQZ A;  1GRB A;  3GMB A;  2E5V A;  1V59 A;  4H2N A;  3RP6 A;  3NG7 X;  4H2R A;  3AE1 A;  4BK2 A;  1E1K A;  2VVL G;  2XLP A;  3NT6 A;  3SCE A;  1ZOV A;  2C65 A;  3GMC A;  1NDA A;  4ZN0 A;  4A79 A;  1H83 A;  4YT0 A;  5BRT A;  2YG7 A;  1DJN A;  1Q1W A;  2FJB A;  4EIP A;  1BZL A;  2C70 A;  2BC1 A;  3B3R A;  4M52 A;  5KMQ A;  4ZCD A;  4Z24 A;  1FOH A;  2WBA A;  5FS8 A;  2B9X A;  2BK5 A;  4O5Q A;  4Z26 A;  4JNQ A;  4U8L A;  1ZX9 A;  3AE4 A;  1F3P A;  1CJ4 A;  3F8P A;  2GV8 A;  2XVI A;  1ZKQ A;  4REK A;  1OJD A;  2FBW A;  1IUW A;  3F29 A;  2ZZC A;  3LB8 A;  3NK1 X;  4Q17 A;  4H4Y A;  5EB5 A;  1CF3 A;  1B8S A;  4J34 A;  3RHA A;  1MOK A;  1S3B A;  3K7T A;  3AEB A;  2C7G A;  3QJ4 A;  3WE0 A;  2EQ6 A;  2WU5 A;  2EQ8 A; 
#chains in the Genus database with same CATH homology
 4TM0 A;  1M6I A;  1ZK7 A;  2C72 A;  3D1I A;  1S2Q A;  4GAV A;  4H4W A;  2X8C A;  1XAN A;  4USQ A;  5TR3 A;  3TTB A;  1OJC A;  1D4E A;  3SFD A;  1DJQ A;  2XDO A;  1TDF A;  1TYP A;  2A87 A;  2E4G A;  4J36 A;  1RP0 A;  4XWR A;  2GB0 A;  1DOE A;  4Q4U A;  4L3Y A;  2BXS A;  3BNF A;  2YLX A;  2JKC A;  4EQS A;  1KF6 A;  1GV4 A;  4UDQ A;  2GR3 A;  1K0J A;  2APG A;  2FJE A;  2WP6 A;  4NEW A;  4TM3 A;  3VRA A;  1E1M A;  1LPF A;  1GU6 A;  3CPH G;  1F8R A;  4YSH A;  1D5T A;  1REO A;  3ALL A;  5FS7 A;  1P2E A;  3RNM A;  2VVM A;  4H4V A;  2CUL A;  2XLS A;  1OJA A;  3AB1 A;  2OA1 A;  2VRL A;  4A7A A;  5LV9 A;  1CL0 A;  1VG9 A;  2Y6R A;  4KX6 A;  1DOB A;  1GER A;  4C77 A;  1F8W A;  2GR1 A;  1GAL A;  2Z5X A;  1IUU A;  1NHQ A;  3CGE A;  3S61 A;  4A5L A;  4B1B A;  5CKU A;  2R9Z A;  4FDC B;  4FX9 A;  5BUK A;  4K8D A;  4IVM B;  3D8X A;  2VR0 A;  3KLJ A;  1MO9 A;  3DJG X;  4D04 A;  1NG3 A;  2BA9 A;  2FJA A;  1JOA A;  2NVK X;  2R4J A;  3NLC A;  3NYC A;  3Q9T A;  3R9U A;  1BWC A;  3CNS A;  1GSN A;  4K5R A;  2E81 A;  2X8H A;  3CGB A;  2C3C A;  4EMI A;  2XFO A;  2WP9 A;  4X9M A;  3UKF A;  2AQJ A;  1FL2 A;  2XVJ A;  4JNA A;  1GT8 A;  1ONF A;  3K30 A;  1N4V A;  3NGC X;  2JAE A;  3DJD A;  3G5S A;  2GR0 A;  3RP7 A;  3KPK A;  1B4V A;  3QVR A;  4DNA A;  5HY5 A;  1NPX A;  4B69 A;  2C67 A;  3CNJ A;  1GRF A;  1KNR A;  2X50 A;  2YLZ A;  5KMS A;  4PAB A;  5KVI A;  4GCM A;  2V3B A;  3VR8 A;  3BI5 A;  3VR9 A;  2VQB A;  2GAG B;  4A9W A;  1L0V A;  2WS3 A;  4JY3 A;  1PXA A;  4WCT A;  4Z2T A;  2CVJ A;  1EL7 A;  5IQ1 A;  1M1R A;  4OVI A;  1COY A;  1GRA A;  1PDH A;  1TDO A;  1JNZ A;  2B9Y A;  4G6G A;  4YKF A;  4Q5C A;  3T0K A;  3F8D A;  1OAH A;  3AE7 A;  3P4Q A;  2BXR A;  1IUV A;  1Y56 B;  4BK1 A;  3V76 A;  3UTH A;  3UKQ A;  1EL5 A;  2WHD A;  3GWF A;  3FIM B;  1AOG A;  1FS8 A;  2WPE A;  1N4W A;  3PO7 A;  4N9X A;  1H7W A;  3SZW A;  3M13 A;  4NWZ A;  4Z25 A;  4OPT A;  3UU9 A;  4I58 A;  4K2X A;  3T2Z A;  3H8I A;  1CJ3 A;  1O5W A;  4H50 A;  3BHK A;  2WES A;  1TYT A;  1YKJ A;  4CY8 A;  3LZX A;  4G6H A;  4II2 A;  2R0P A;  2CDU A;  2ZO5 A;  3GM6 A;  1GND A;  2NPX A;  5J7X A;  1K0L A;  3GRT A;  1UKV G;  3F8R A;  3KD9 A;  4H4U A;  4B63 A;  2YG5 A;  3EPT A;  2VOU A;  2YR4 A;  3UKH A;  3DH9 A;  2V6O A;  2JBV A;  3URH A;  2Z5Y A;  2WDQ A;  4CCQ A;  3RKH A;  1OJ9 A;  3AD8 B;  4Q1O A;  3ADA B;  3NN6 X;  5KXJ A;  1NHR A;  3BI2 A;  1GTE A;  4GDP A;  2JB2 A;  2DKH A;  1PXB A;  1SP3 A;  3DK8 A;  4ICY A;  3VQR A;  4TLZ A;  4OPU A;  4EQX A;  2A89 A;  2CFY A;  3CPJ G;  4Z2R A;  3CMM A;  3LZW A;  5JCK A;  4NZH A;  4B68 A;  3NYF A;  1W4X A;  2X8G A;  3II4 A;  1ZP0 A;  2BC0 A;  4WX1 A;  3UP4 A;  4AP3 A;  3CPI G;  2WOV A;  2B76 A;  3CGC A;  3I6D A;  1EL9 A;  1LV0 A;  3AE2 A;  1DOD A;  4Y4M A;  3NHO X;  3T2K A;  5ER0 A;  3UKL A;  4A6N B;  4A6N A;  4BK3 A;  3AE9 A;  4J57 A;  3T2Y A;  2OAM A;  2E1M A;  4GAP A;  1D4C A;  4TM1 A;  4DSH A;  3IWA A;  2EQ9 A;  1D4D A;  4Z2U A;  1QDB A;  2JK6 A;  3QSM A;  3VRD B;  4C5O A;  4YTM A;  1VDC A;  3UBR A;  4U8I A;  4XWZ A;  4BJY A;  3RP8 A;  1NHS A;  2A8X A;  1N1P A;  2VRM A;  2QA1 A;  3S5W A;  1JRZ A;  1PBD A;  3JSK A;  4U2T A;  3FMW A;  1JRY A;  3FBS A;  3EF6 A;  1QLB A;  2X99 A;  3AE6 A;  4C3X A;  4NTC A;  3BNM A;  4AOX A;  2XFP A;  3AE3 A;  2Q0K A;  4PAA A;  3LXD A;  3NYE A;  2BAB A;  2RDZ A;  3OZ2 A;  3UOV A;  2I0Z A;  3LJP A;  2R45 A;  2V3A A;  2GAH B;  2BK4 A;  1PXC A;  4U2S A;  1E39 A;  1DNC A;  3P4R A;  4Y4N A;  4OPD A;  5M10 A;  3L1R A;  3NNE A;  3BNG A;  1TDE A;  3B6D A;  1D7L A;  2YG4 A;  3GDP A;  3HZL A;  4B64 A;  1PBF A;  1LTX R;  4LII A;  2IVE A;  4H4T A;  1FS7 A;  2RGO A;  2C66 A;  4AT0 A;  3K7M X;  3AEC A;  3E1T A;  4H4R A;  2XFU A;  3C4A A;  1F6M A;  1XDI A;  3KU9 A;  3RED A;  4L3Z A;  3FPZ A;  1P2H A;  4EM4 A;  1NG4 A;  3CIR A;  5BUL A;  2BS4 A;  2BS3 A;  1CBO A;  5HYM A;  4YSX A;  2V60 A;  5IPY A;  3ABV A;  2R0C A;  2XLU A;  4CCR A;  1CC2 A;  3D1C A;  4CY6 A;  5KOW A;  2LFC A;  5KOX A;  4FK1 C;  2Y6Q A;  3MMO A;  4X9N A;  3NK2 X;  2XFN A;  2GMH A;  3GWD A;  1IJH A;  3ICS A;  2JB1 A;  2OLN A;  3HYW A;  4L3X A;  4K5S A;  3EAO A;  3LOV A;  3UCL A;  4DGK A;  2YG3 A;  4Q0T A;  5GRT A;  2XVE A;  3QSE A;  1VRQ B;  5EB4 A;  4J2W A;  4GR1 A;  2BCG G;  3SXQ A;  2GH5 A;  1X31 B;  3AEA A;  3ITJ A;  1TRB A;  3NRN A;  3SY4 A;  1M1P A;  3AD9 B;  2DKI A;  2AR8 A;  3GRS A;  2WPC A;  2B7S A;  4DSG A;  2YQU A;  3CND A;  1Z6L A;  4IA5 A;  3AXB A;  1JU2 A;  1S3E A;  3P9U A;  3NKS A;  3CGD A;  4RG4 A;  5FS6 A;  4O5U A;  5KMP A;  2V61 A;  1GES A;  4OPL A;  2YWL A;  3AD7 B;  3DGH A;  1H82 A;  3Q6J A;  3NK0 X;  1H7X A;  5L46 A;  1H81 A;  4UDP A;  2VZ2 A;  3QSS A;  4H7U A;  5EOW A;  1VG0 A;  2GF3 A;  1M64 A;  5J60 A;  1NEN A;  1E7P A;  1Y56 A;  3AEG A;  3GYX A;  4U2L A;  3ZYX A;  4H4P A;  4YXD A;  2ZZB A;  4Z43 A;  3SYI A;  3DJE A;  4YKG A;  1PJ5 A;  4ADW A;  2PYX A;  4EMJ A;  3UP5 A;  4A99 A;  4FK1 A;  2Q0L A;  2YVJ A;  4A65 A;  4EQR A;  5FS9 A;  2QA2 A;  4Z44 A;  1XHC A;  2IID A;  2QCU A;  1MXT A;  3M0O A;  4LA1 A;  3SQP A;  5U63 A;  1Q9I A;  2K3V A;  1KSU A;  4YSY A;  1L9E A;  2WOI A;  1JEH A;  4NNJ A;  3L1T A;  1B5Q A;  1ZMD A;  2TMD A;  4P9S A;  1BKW A;  3IHM A;  5DBJ A;  2C3D A;  3UTE A;  1GEU A;  4TLX A;  5CQF A;  4U8P A;  4J56 A;  1B37 A;  4CBQ A;  3BNJ A;  2WOW A;  3PS9 A;  1KFY A;  2GQF A;  3TOR A;  4AT2 A;  4JY2 A;  3M12 A;  1DOC A;  1E1N A;  1NEK A;  1O94 A;  4MJW A;  1FT6 A;  4YSZ A;  4JDR A;  4Q5B A;  5U1O A;  1Y0P A;  2FJD A;  1GPE A;  4IA6 A;  2W0H A;  3SZ0 A;  2WPF A;  1CJC A;  2XLR A;  3T37 A;  2J7A A;  5FMH A;  3GD4 A;  4C3Y A;  5JCL A;  4TM4 A;  3ZDN A;  4APN A;  3LGQ A;  4CNK A;  3QVP A;  1IUS A;  1EL8 A;  1M1Q A;  1PBC A;  1ELI A;  1NHP A;  2AAQ A;  4OPG A;  1PBE A;  1LQT A;  3CN8 A;  2YM1 A;  2YLS A;  1O95 A;  1GXF A;  1N4U A;  2C75 A;  2RAB A;  4K22 A;  3SFE A;  2E80 A;  2PHH A;  3ISH A;  4NTE A;  3AYJ A;  4H4Q A;  4HA6 A;  4U8K A;  1ZY8 A;  3AEE A;  4YTN A;  4AOS A;  4OPC A;  2XLT A;  4YTP A;  3AE8 A;  2O9Z A;  3BNH A;  2OAL A;  2B7R A;  1FEA A;  1KDG A;  1E6E A;  2OT4 A;  3NTD A;  2C64 A;  1BF3 A;  2WET A;  1BGJ A;  1F8S A;  3DK4 A;  4CRT A;  4UP3 A;  2XVF A;  2VQ7 A;  3FG2 P;  2XFQ A;  1PJ6 A;  1YQ4 A;  1LJ1 A;  1FEB A;  2B9W A;  1Q1R A;  3DME A;  2YLT A;  5JCN A;  2GRT A;  3T31 A;  2RF7 A;  3IHG A;  3V3N A;  3SM8 A;  1S2Y A;  3DGZ A;  3ICR A;  1CC6 A;  3NTA A;  4LU6 A;  3OC4 A;  1TDK A;  3UOZ A;  2F5Z A;  1L9C A;  3G5Q A;  2HQM A;  4ECH A;  2GMJ A;  4USR A;  3IC9 A;  5KVH A;  1BGN A;  2GVC A;  2IVD A;  2WEU A;  3DA1 A;  2J3N A;  4IVO B;  2YVG A;  4I59 A;  4U8N A;  4HB9 A;  1CC4 A;  1RSG A;  1NAA A;  3AYI A;  4OPI A;  4KPR A;  1LQU A;  1GRE A;  2H89 A;  1XPQ A;  2C4C A;  1K4Q A;  3ALM A;  1GRT A;  1JNI A;  3FO3 A;  1VQW A;  3GD3 A;  1IUX A;  2BK3 A;  3IF9 A;  3KKJ A;  4G9K A;  2C76 A;  2UZZ A;  2YR5 A;  1H6V A;  1GRH A;  3AEF A;  1FT5 A;  2R4E A;  1JNR A;  1OJT A;  2WU2 A;  3NIX A;  4H4Z A;  2YLW A;  4G73 A;  4NEV A;  3UKA A;  1FS9 A;  2Q6U A;  2QAE A;  1PS9 A;  2H88 A;  2YG6 A;  5C3J A;  4JN9 A;  1GTH A;  2YVF A;  3O0H A;  4OCG A;  5U25 A;  4EMW A;  3UKP A;  2YAU A;  3UKK A;  4H4S A;  4U8M A;  4H2Q A;  3GDN A;  3L8K A;  4XXG A;  2GR2 A;  2X3N A;  4GF7 A;  4WJY A;  3H4K A;  4EM3 A;  3C96 A;  1DXL A;  2BYB A;  2VVL A;  3AWI A;  3P1W A;  1FEC A;  1HYU A;  1SEZ A;  2BS2 A;  2R46 A;  4C74 A;  3C4N A;  3H8L A;  2C73 A;  4GRT A;  4U8O A;  4X4J A;  1BVB A;  3VRB A;  1GOS A;  2GQW A;  3I3L A;  4NTD A;  5JCI A;  1GET A;  3P4P A;  3GYI A;  3SXI A;  2R0G A;  4B65 A;  4IV9 A;  5HXI A;  3KA7 A;  1L9D A;  1H84 A;  3P4S A;  2ACZ A;  2YM2 A;  2WP5 A;  3CTY A;  3GSI A;  1KSS A;  1PBB A;  2ZBW A;  1YQ3 A;  3DJJ A;  3UTG A;  3V3O A;  1EBD A;  4YWO A;  5C2T A;  4J31 A;  3SX6 A;  2ZZ0 A;  1E1L A;  3HYV A;  2BAC A;  3EAN A;  3HYX A;  3KPF A;  4JQ9 A;  3K7Q X;  3AED A;  1YY5 A;  2RGJ A;  1CJ2 A;  2BRY A;  3CNP A;  4U8J A;  3LAD A;  4H4X A;  3UOY A;  1TDN A;  2V5Z A;  1LVL A;  2YR6 A;  3SZF A;  3LG1 A;  4BV6 A;  4E0V A;  3S7W A;  3ATR A;  4J33 A;  1JRX A;  5KRQ A;  3OWM A;  2OLO A;  4GDE A;  5M0Z A;  1QO8 A;  3KVE A;  1ZDL A;  1PN0 A;  2Q7V A;  4CNJ A;  3CNT A;  3GYJ A;  3UOX A;  5JCM A;  1H86 A;  2YLR A;  3UTF A;  3SGL A;  4BUR A;  4EQW A;  5IQ4 A;  4K7Z A;  5HHF A;  4H2P A;  4BJZ A;  3BI4 A;  2BCP A;  3NN0 X;  3PVC A;  2XCG A;  3QFB A;  2EQ7 A;  1PJ7 A;  2WQY A;  3SZC A;  4Y4L A;  3QFA A;  2RGH A;  2XYO A;  4D03 A;  3BHF A;  5KMR A;  2JB3 A;  3ALJ A;  2WDV A;  4ZCC A;  4B67 A;  4RSL A;  5BVA A;  3AE5 A;  3G5R A;  4RG3 A;  1QJD A;  5KNL A;  4L38 A;  1IUT A;  4B66 A;  2BRA A;  1PHH A;  1CHU A;  1ZOY A;  1GRG A;  4GUV A;  3COX A;  3ICT A;  5GSN A;  5KWF A;  3ATQ A;  3DK9 A;  5EBK A;  4AP1 A;  2XVH A;  1FCD A;  3T14 A;  1KNP A;  3NH3 X;  4II3 A;  4UDR A;  1RYI A;  1D7Y A;  2ARD A;  3AYL A;  3BNU A;  1ZMC A;  2WDR A;  4G74 A;  2GEW A;  4EIQ A;  1K0I A;  2TPR A;  1YQZ A;  1GRB A;  3GMB A;  2E5V A;  1V59 A;  4H2N A;  3RP6 A;  3NG7 X;  4H2R A;  3AE1 A;  4BK2 A;  1E1K A;  2VVL G;  2XLP A;  3NT6 A;  3SCE A;  1ZOV A;  2C65 A;  3GMC A;  1NDA A;  4ZN0 A;  4A79 A;  1H83 A;  4YT0 A;  5BRT A;  2YG7 A;  1DJN A;  1Q1W A;  2FJB A;  4EIP A;  1BZL A;  2C70 A;  2BC1 A;  3B3R A;  4M52 A;  5KMQ A;  4ZCD A;  4Z24 A;  1FOH A;  2WBA A;  5FS8 A;  2B9X A;  2BK5 A;  4O5Q A;  4Z26 A;  4JNQ A;  4U8L A;  1ZX9 A;  3AE4 A;  1F3P A;  1CJ4 A;  3F8P A;  2GV8 A;  2XVI A;  1ZKQ A;  4REK A;  1OJD A;  2FBW A;  1IUW A;  3F29 A;  2ZZC A;  3LB8 A;  3NK1 X;  4Q17 A;  4H4Y A;  5EB5 A;  1CF3 A;  1B8S A;  4J34 A;  3RHA A;  1MOK A;  1S3B A;  3K7T A;  3AEB A;  2C7G A;  3QJ4 A;  3WE0 A;  2EQ6 A;  2WU5 A;  2EQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...