1JRYA

Crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTKDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jryA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jryA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jryA01
2WU2A 4AP3A 4B69A 4WJYA 4I59A 4L3ZA 3NYFA 1GRFA 5BRTA 3BNUA 1F8SA 3DMEA 2AR8A 3ZDNA 2R0GA 5KVHA 1PS9A 2XLRA 4UDPA 3BNHA 3CGBA 3BNMA 3AECA 2YLZA 1TDKA 3FPZA 4NEWA 3UTFA 4JN9A 3BI4A 3AE9A 1BGNA 1FECA 5M10A 4TM1A 2XFPA 2FJEA 4WCTA 3SFDA 4L3XA 4A9WA 4JQ9A 4YKGA 3PO7A 5JCLA 4H4PA 4A65A 3SCEA 3ALLA 1RYIA 2XYOA 3I6DA 4FX9A 4N9XA 4C3XA 3ISHA 3D8XA 4H4RA 1NHRA 4E0VA 2F5ZA 4IA6A 2GQWA 4YTNA 3KD9A 4HA6A 3UBRA 3RHAA 4B64A 1L9DA 1Y56B 2FJBA 1GPEA 3QVPA 4Z26A 2YG7A 3EF6A 2QCUA 3QSEA 2C73A 3RKHA 1GALA 3K7QX 4H2RA 1E1KA 3NH3X 1F8WA 1PBFA 4XXGA 4K5RA 4EMJA 2BCGG 2YLSA 4C77A 3UKFA 4BURA 4CNJA 4PABA 5IQ1A 2Z5XA 2WPEA 2YQUA 2V60A 4CBQA 4H4ZA 2VVLA 4U8LA 2JB1A 2FJDA 1JOAA 4EQXA 1Q1RA 4JY3A 2X50A 1GNDA 3H8IA 3AEBA 4H2NA 5BULA 2C64A 3AEAA 4CNKA 4EQSA 3ABVA 2Q7VA 2FBWA 4YSXA 4GR1A 4AOSA 2JKCA 4ZN0A 4U8OA 2OLOA 3Q6JA 2TPRA 4YTMA 3NKSA 2GAGB 2XCGA 3NN0X 4IVMB 3DJDA 5KOWA 1Y56A 2R4JA 1LTXR 2BA9A 3FIMB 1PXBA 1NG3A 3AEGA 1PBDA 1JU2A 2BS2A 3UTEA 5TR3A 2CDUA 2XFUA 3FG2P 4B67A 1LPFA 1O94A 1S3EA 3RNMA 1MO9A 1VG9A 2BK5A 5BUKA 5KXJA 4LIIA 1OJ9A 4FDCB 4I58A 4EIPA 3QFBA 2H88A 3QFAA 4C74A 1M6IA 5IPYA 2EQ7A 4J34A 3LOVA 5GRTA 4AT2A 1VG0A 3NRNA 5HHFA 4H7UA 1PBCA 3S61A 3L1TA 3URHA 2JB2A 5KOXA 1OAHA 3BNFA 4Q5CA 1IUVA 1K4QA 1O5WA 2UZZA 2YVFA 3AEFA 4GUVA 1H86A 3L8KA 5J7XA 3VQRA 4A79A 1IUTA 4J33A 1GV4A 4YTPA 2YM2A 1XHCA 1GRTA 1COYA 2YM1A 4JDRA 1TDNA 2XVJA 4HB9A 4A6NA 1CC6A 1PXAA 4BK3A 3ICRA 1IUXA 3K7MX 1OJTA 2XLPA 3NK2X 4Z2RA 4TM0A 2APGA 5U1OA 4U2TA 1Y0PA 4EM4A 5HY5A 2C3DA 2WETA 3H8LA 2YG5A 1JNZA 2WOWA 3QSMA 4EMWA 3KA7A 4XWRA 3ADAB 2VRLA 4OCGA 1QO8A 4EMIA 2WHDA 1FS9A 1YY5A 4OPLA 3NGCX 1D7LA 3I3LA 3LZXA 3M13A 3V3NA 1YQ3A 1BGJA 2OA1A 2YR6A 5FS6A 2ZBWA 1GT8A 3DJJA 1JRZA 1TYPA 4JNAA 4U8KA 1ZMDA 2BC0A 2WEUA 4A99A 4OPUA 1LVLA 4J2WA 2CULA 2WP9A 4B66A 1CC2A 2XFOA 4L3YA 1TYTA 2YLRA 1FCDA 3DGZA 3EANA 3DK9A 2JAEA 3IHGA 1M1PA 1PJ7A 3KPFA 1H6VA 3KU9A 2ZZ0A 2JB3A 3UCLA 3IHMA 3GRTA 3NYEA 4X4JA 1PJ5A 1DOBA 2VQBA 3F8RA 3GDPA 3C4NA 3UKHA 3ICSA 1FS7A 2RF7A 3SQPA 1IUWA 5FMHA 2EQ9A 1TDOA 3IWAA 1P2HA 2BACA 1NG4A 2YR5A 2GV8A 1GRHA 2JBVA 4H4QA 1B4VA 4BJZA 1TDFA 3AE4A 4RG4A 1S3BA 2BS3A 1BWCA 3OZ2A 1ZK7A 1LJ1A 1NHPA 2A89A 1SEZA 3IC9A 3V76A 4RSLA 1OJCA 4NTEA 1PN0A 3M12A 3CPHG 4O5UA 3SXQA 4Q0TA 4Q1OA 3P4QA 1TRBA 1IUUA 3H4KA 1F3PA 3CGCA 3P4RA 1ZP0A 3ATRA 4NTDA 3WE0A 4H4UA 3DGHA 4NEVA 4K22A 2YLWA 1H83A 3BHKA 2XVFA 4K5SA 1CL0A 1PDHA 1TDEA 2WPFA 3NTAA 4H4TA 4Z2TA 2GB0A 2XVEA 3D1IA 3EAOA 1KSSA 2WOIA 1DXLA 2WDRA 3CPJG 4IVOB 4ZCDA 3OWMA 4OPDA 2C66A 2FJAA 4BK1A 4Y4LA 4WX1A 1E1MA 1K0LA 3UP4A 3NLCA 1F8RA 1GOSA 1V59A 2XLTA 1Q1WA 3AD7B 2ZZBA 1GRAA 2C75A 1D4CA 2Y6QA 2B7RA 2VRMA 4UDRA 2WBAA 3GSIA 4ADWA 1GETA 2X8HA 4LA1A 3JSKA 3NT6A 1NDAA 4YXDA 1QDBA 2WU5A 3B3RA 3VR9A 3FO3A 3KLJA 1K0JA 1EL8A 3AYLA 2Q6UA 4J31A 3UOYA 3SGLA 2R46A 4OPCA 1Z6LA 2GAHB 1EL5A 1L9CA 3MMOA 1EL9A 2B76A 4OPIA 5JCNA 2YVJA 1IJHA 2WDQA 1BF3A 3CPIG 2C72A 1S2QA 5U25A 3ITJA 5CQFA 2YG3A 4U8IA 4B68A 4H2PA 2ZO5A 3GD3A 4YKFA 4BK2A 1PJ6A 1GREA 2E5VA 4Q17A 5M0ZA 4J57A 4A7AA 2B9YA 1E1NA 2RGJA 1CBOA 2J7AA 3AD9B 2VQ7A 3CGDA 1FT5A 4Y4MA 3UKLA 4H4WA 3G5QA 2GEWA 1FL2A 2QA1A 4GCMA 3UKKA 3REDA 1VDCA 3GYIA 4CCRA 4GF7A 3HZLA 4KX6A 3R9UA 5EB5A 2BXSA 1M1QA 1FEBA 1GTHA 3P1WA 1GERA 5JCMA 2GR1A 1BVBA 1CJCA 3G5SA 1YQZA 4TLXA 4M52A 2V3BA 4YSZA 1GU6A 1E7PA 5LV9A 3K30A 4TLZA 4TM3A 1N4WA 5KWFA 1JNRA 1KNRA 1RP0A 3NNEA 4IV9A 4YSYA 2GMHA 1BZLA 1OJAA 3GM6A 3AEEA 3S5WA 1S2YA 1NHQA 5J60A 2GRTA 2ZZCA 3FBSA 2Q0KA 2E1MA 4U8MA 1D4DA 1DJNA 2XVHA 3AEDA 4RG3A 2ACZA 4H4XA 2E81A 3LB8A 5CKUA 2WOVA 3COXA 2C65A 5GSNA 1N4UA 4L38A 5EOWA 3VRDB 1B8SA 5BVAA 3IF9A 2BS4A 2Z5YA 4UDQA 3UKQA 1B37A 1GTEA 1CJ2A 3B6DA 3GYJA 2BABA 2LFCA 3CNJA 2R45A 1OJDA 2VVLG 4GRTA 1DJQA 3QVRA 1JRXA 2AAQA 3CGEA 1ZKQA 1X31B 2WP6A 4BJYA 4Q4UA 4B63A 4DNAA 2B9XA 4P9SA 5IQ4A 2X8CA 3NK0X 2B9WA 3GWDA 3GYXA 4FK1C 4NTCA 2BC1A 5KVIA 1HYUA 3DJGX 1JNIA 4U2LA 1D7YA 1EBDA 3BNJA 4O5QA 3ALJA 3NTDA 1FEAA 2B7SA 3EPTA 4OPTA 4CY6A 4DSGA 3AE8A 3KVEA 4U8JA 2IIDA 1D4EA 2E80A 1GRGA 2PHHA 4H2QA 1N4VA 3NN6X 2XFQA 4J56A 2PYXA 2V6OA 3RP7A 1XDIA 4K7ZA 1YQ4A 3PS9A 3BHFA 3T37A 1P2EA 2E4GA 4C5OA 4EQRA 4USQA 1B5QA 1DOEA 2X3NA 3F8PA 3GMCA 3OC4A 4H50A 4X9NA 1GSNA 1ZOYA 3VRBA 2XDOA 4C3YA 2K3VA 3AWIA 4H4VA 1FS8A 3PVCA 4PAAA 1DNCA 4ECHA 3DK4A 4USRA 1JEHA 1ZMCA 2R0PA 3CN8A 2YVGA 4AOXA 4K2XA 3CNPA 3AXBA 1LV0A 3DH9A 4MJWA 3TTBA 3CNSA 4ICYA 5FS7A 3UTHA 2HQMA 4BV6A 2RDZA 1M1RA 3D1CA 4X9MA 5FS9A 2YLXA 3UOXA 1DODA 2WESA 2RGOA 4EM3A 4EIQA 4D03A 2BK3A 1NPXA 1D5TA 2IVEA 2V5ZA 4K8DA 4B1BA 1KNPA 4CY8A 2C67A 1N1PA 2OALA 3L1RA 2YLTA 3E1TA 4D04A 4YT0A 2V61A 1RSGA 2EQ6A 3NK1X 3FMWA 2A8XA 3AYJA 4UP3A 2Q0LA 4U8PA 2WS3A 1PBEA 3AYIA 1ZX9A 3VRAA 2QA2A 1GEUA 1FOHA 5C2TA 1E1LA 1MXTA 3Q9TA 3M0OA 5L46A 4Y4NA 2RABA 3LXDA 2YG4A 3UP5A 3CTYA 2J3NA 3P4PA 5KRQA 1FT6A 1E39A 2AQJA 4B65A 3CNTA 1GXFA 1H7XA 2DKHA 2O9ZA 2H89A 3ATQA 2V3AA 3AE6A 4A6NB 4YSHA 1DOCA 3VR8A 3GD4A 4H4SA 3CNDA 2R9ZA 3NG7X 1H7WA 2C3CA 2BCPA 3RP6A 3UTGA 5C3JA 1H81A 3UOZA 1PXCA 3BI2A 4YWOA 5JCKA 1CC4A 1PHHA 2Y6RA 3P9UA 4U8NA 2YR4A 1VQWA 1KF6A 3GMBA 2X99A 1E6EA 4KPRA 4IA5A 2I0ZA 4OPGA 2GR0A 3NYCA 1H82A 3LG1A 1XPQA 3QSSA 4LU6A 1YKJA 2GH5A 5DBJA 2GMJA 3ZYXA 1AOGA 2YAUA 2IVDA 3F29A 1GRBA 1NAAA 2XVIA 3NHOX 3DA1A 4GDPA 2GF3A 1GESA 4AP1A 1CHUA 2CFYA 1SP3A 4REKA 4DSHA 1UKVG 1EL7A 2OAMA 4JY2A 3UKPA 3LZWA 2CVJA 1KDGA 3F8DA 1ZDLA 3DJEA 2OLNA 1QLBA 2TMDA 3ALMA 3AB1A 1VRQB 1JRYA 2ARDA 2C70A 2VR0A 3S7WA 3AE3A 1K0IA 2A87A 3KKJA 3AE5A 3GDNA 1F6MA 3AD8B 3G5RA 1L9EA 2JK6A 4NZHA 3AE2A 2BYBA 2R0CA 3CIRA 3BI5A 3NIXA 3QJ4A 1H84A 4EQWA 2C7GA 4JNQA 4DGKA 4H4YA 3GWFA 3UOVA 2XLSA 4Z2UA 2R4EA 4CCQA 4XWZA 3SFEA 2OT4A 1IUSA 1W4XA 2RGHA 4FK1A 3BNGA 2YG6A 1L0VA 1Q9IA 5ER0A 5U63A 2WDVA 4OVIA 3C96A 5HXIA 2GVCA 5JCIA 1ONFA 5EB4A 1CJ3A 3ICTA 3O0HA 1M64A 1PBBA 1ZY8A 2YWLA 3V3OA 4A5LA 3AE7A 1CJ4A 3RP8A 4Z25A 3SM8A 1ELIA 4GDEA 1QJDA 1KSUA 1NENA 2C76A 3K7TA 1MOKA 2GR2A 2VZ2A 4Z44A 2DKIA 2QAEA 1XANA 1LQUA 4ZCCA 1NEKA 3LJPA 4Z43A 4Z24A 2WQYA 3LGQA 2BK4A 2XLUA 3GRSA 1O95A 1NHSA 1REOA 3LADA 3P4SA 1KFYA 3AE1A 4TM4A 2VVMA 1CF3A 2WP5A 2XFNA 3II4A 2EQ8A 3UU9A 3C4AA 2GQFA 2NPXA 4J36A 2VOUA 4CRTA 3TORA 1ZOVA 3UKAA 2BXRA 5EBKA 5HYMA 4APNA 4U2SA 2WPCA 2X8GA 2GR3A 4Q5BA 2W0HA 4AT0A 1LQTA 1BKWA 3DK8A 2NVKX 5FS8A
chains in the Genus database with same CATH superfamily
2WU2A 4AP3A 4B69A 4WJYA 4I59A 4L3ZA 3NYFA 1GRFA 5BRTA 3BNUA 1F8SA 3DMEA 2AR8A 3ZDNA 2R0GA 5KVHA 3SZFA 1PS9A 2XLRA 4UDPA 3BNHA 3CGBA 3BNMA 3AECA 2YLZA 1TDKA 3FPZA 4NEWA 3UTFA 4JN9A 3BI4A 3AE9A 1BGNA 1FECA 3SXIA 5M10A 4TM1A 2XFPA 2FJEA 4WCTA 3SFDA 4L3XA 4A9WA 4JQ9A 4YKGA 3PO7A 5JCLA 4H4PA 4A65A 3SCEA 3ALLA 1RYIA 2C4CA 2XYOA 3I6DA 4FX9A 4N9XA 4C3XA 5KMSA 3ISHA 3D8XA 4H4RA 3T2YA 1NHRA 4E0VA 2F5ZA 4IA6A 2GQWA 4YTNA 3KD9A 4HA6A 3UBRA 3RHAA 4B64A 1L9DA 1Y56B 2FJBA 1GPEA 3QVPA 4Z26A 3SZWA 2YG7A 3EF6A 2QCUA 3QSEA 2C73A 3RKHA 1GALA 3K7QX 4H2RA 1E1KA 3NH3X 1F8WA 1PBFA 4XXGA 4K5RA 4EMJA 2BCGG 2YLSA 4G6HA 4C77A 3UKFA 4BURA 4CNJA 4PABA 5IQ1A 2Z5XA 2WPEA 2YQUA 2V60A 4CBQA 4H4ZA 2VVLA 4U8LA 2JB1A 2FJDA 1JOAA 4EQXA 1Q1RA 4JY3A 2X50A 1GNDA 3H8IA 3AEBA 4H2NA 3SY4A 5BULA 2C64A 3AEAA 4CNKA 3T0KA 4EQSA 3ABVA 2Q7VA 2FBWA 4YSXA 4GR1A 4AOSA 2JKCA 4ZN0A 4U8OA 2OLOA 3Q6JA 2TPRA 4YTMA 3NKSA 2GAGB 2XCGA 3NN0X 4IVMB 3SZ0A 3DJDA 5KOWA 1Y56A 2R4JA 1LTXR 2BA9A 3FIMB 1PXBA 1NG3A 3AEGA 1PBDA 1JU2A 2BS2A 4G6GA 5TR3A 2CDUA 3UTEA 2XFUA 3FG2P 4B67A 1LPFA 1O94A 5KNLA 1S3EA 3RNMA 1MO9A 1VG9A 2BK5A 5BUKA 5KXJA 4LIIA 1OJ9A 4FDCB 4I58A 4G9KA 4EIPA 3QFBA 2H88A 3QFAA 4C74A 1M6IA 5IPYA 2EQ7A 4J34A 3LOVA 5GRTA 4AT2A 1VG0A 3NRNA 5HHFA 4H7UA 1PBCA 3S61A 3L1TA 3URHA 2JB2A 5KOXA 1OAHA 3BNFA 4Q5CA 1IUVA 1K4QA 1O5WA 2UZZA 2YVFA 3AEFA 4GUVA 1H86A 3L8KA 5J7XA 3VQRA 4A79A 1IUTA 4J33A 1GV4A 4YTPA 2YM2A 1XHCA 1GRTA 1COYA 2YM1A 4JDRA 1TDNA 2XVJA 3CMMA 4HB9A 4A6NA 1CC6A 1PXAA 4BK3A 3ICRA 1IUXA 3K7MX 1OJTA 2XLPA 3NK2X 4Z2RA 4TM0A 2APGA 5U1OA 4U2TA 1Y0PA 4EM4A 5HY5A 2C3DA 2WETA 3H8LA 2YG5A 1JNZA 2WOWA 3QSMA 4EMWA 3KA7A 4XWRA 3ADAB 2VRLA 4OCGA 1QO8A 4EMIA 2WHDA 1FS9A 1YY5A 4OPLA 3NGCX 1D7LA 3I3LA 3LZXA 3M13A 3V3NA 1YQ3A 1BGJA 2OA1A 2YR6A 5FS6A 2ZBWA 1GT8A 3DJJA 1JRZA 1TYPA 4JNAA 4U8KA 1ZMDA 2BC0A 2WEUA 4A99A 4OPUA 1LVLA 4J2WA 2CULA 2WP9A 4B66A 1CC2A 2XFOA 4L3YA 4II3A 1TYTA 2YLRA 1FCDA 3DGZA 3EANA 3DK9A 2JAEA 3IHGA 1M1PA 1PJ7A 3KPFA 1H6VA 3KU9A 2ZZ0A 2JB3A 3UCLA 3IHMA 3GRTA 3NYEA 4X4JA 1PJ5A 1DOBA 2VQBA 3F8RA 3GDPA 3C4NA 3KPKA 3UKHA 3ICSA 1FS7A 2RF7A 3SQPA 1IUWA 5FMHA 2EQ9A 1TDOA 3IWAA 1P2HA 2BACA 1NG4A 2YR5A 2GV8A 1GRHA 2JBVA 4H4QA 1B4VA 4BJZA 1TDFA 3AE4A 4RG4A 1S3BA 2BS3A 1BWCA 3OZ2A 1ZK7A 1LJ1A 1NHPA 2A89A 1SEZA 3IC9A 3V76A 4RSLA 1OJCA 4NTEA 1PN0A 3M12A 3CPHG 4O5UA 3SXQA 4Q0TA 4Q1OA 3P4QA 1TRBA 1IUUA 3H4KA 1F3PA 3CGCA 3P4RA 1ZP0A 3ATRA 4NTDA 3WE0A 4H4UA 3DGHA 4NEVA 4K22A 2YLWA 1H83A 3BHKA 2XVFA 4K5SA 1CL0A 1PDHA 1TDEA 2WPFA 3NTAA 4H4TA 4Z2TA 2GB0A 2XVEA 3D1IA 3EAOA 1KSSA 2WOIA 1DXLA 2WDRA 3CPJG 4IVOB 4ZCDA 3OWMA 4OPDA 2C66A 2FJAA 4BK1A 4Y4LA 4WX1A 1E1MA 1K0LA 3UP4A 3NLCA 1F8RA 1GOSA 1V59A 2XLTA 1Q1WA 3AD7B 2ZZBA 1GRAA 2C75A 1D4CA 2Y6QA 2B7RA 2VRMA 4UDRA 2WBAA 3GSIA 4ADWA 1GETA 2X8HA 4LA1A 3JSKA 3NT6A 1NDAA 4YXDA 1QDBA 2WU5A 3B3RA 3VR9A 3FO3A 3KLJA 1K0JA 1EL8A 3AYLA 2Q6UA 3HYVA 4J31A 3UOYA 3SGLA 2R46A 4OPCA 1Z6LA 2GAHB 1EL5A 1L9CA 3MMOA 1EL9A 2B76A 4OPIA 5JCNA 2YVJA 1IJHA 2WDQA 1BF3A 3CPIG 2C72A 1S2QA 5U25A 3ITJA 5CQFA 2YG3A 4U8IA 4B68A 4H2PA 2ZO5A 3GD3A 4YKFA 4BK2A 1PJ6A 1GREA 2E5VA 4Q17A 5M0ZA 4J57A 4A7AA 2B9YA 1E1NA 2RGJA 1CBOA 2J7AA 3AD9B 2VQ7A 3CGDA 1FT5A 4Y4MA 3UKLA 4H4WA 3G5QA 2GEWA 1FL2A 2QA1A 4GCMA 3UKKA 3REDA 1VDCA 3GYIA 4CCRA 4GF7A 3HZLA 4KX6A 3R9UA 5EB5A 2BXSA 1M1QA 1FEBA 1GTHA 3P1WA 1GERA 5JCMA 2GR1A 1BVBA 1CJCA 3G5SA 1YQZA 4TLXA 4M52A 2V3BA 4YSZA 1GU6A 1E7PA 3HYXA 5LV9A 4NWZA 3K30A 4TLZA 4TM3A 1N4WA 5KWFA 1JNRA 1KNRA 1RP0A 3NNEA 4IV9A 4YSYA 2GMHA 1BZLA 1OJAA 3GM6A 3AEEA 3S5WA 1S2YA 1NHQA 5J60A 2GRTA 2ZZCA 3HYWA 3FBSA 2Q0KA 2E1MA 4U8MA 1D4DA 1DJNA 2XVHA 3AEDA 4G74A 4RG3A 2ACZA 4H4XA 2E81A 3LB8A 5CKUA 2WOVA 3COXA 2C65A 5GSNA 1N4UA 4L38A 5EOWA 3VRDB 1B8SA 5BVAA 3IF9A 2BS4A 2Z5YA 4UDQA 3UKQA 1B37A 1GTEA 1CJ2A 3B6DA 3GYJA 2BABA 2LFCA 3CNJA 2R45A 1OJDA 2VVLG 4GRTA 1DJQA 3QVRA 3T14A 1JRXA 2AAQA 3CGEA 1ZKQA 1X31B 2WP6A 4BJYA 4Q4UA 3T2KA 4B63A 4DNAA 2B9XA 4P9SA 4II2A 2X8CA 5IQ4A 3NK0X 2B9WA 3GWDA 3GYXA 4FK1C 4NTCA 2BC1A 5KVIA 1HYUA 3DJGX 1JNIA 4U2LA 1D7YA 1EBDA 3BNJA 4O5QA 3ALJA 3NTDA 1FEAA 2B7SA 2CZSA 3EPTA 4OPTA 4CY6A 3AE8A 3KVEA 4U8JA 2IIDA 4DSGA 1D4EA 2E80A 1GRGA 2PHHA 4H2QA 1N4VA 3NN6X 2XFQA 4J56A 2PYXA 2V6OA 3RP7A 1XDIA 4K7ZA 1YQ4A 3PS9A 3BHFA 3T37A 1P2EA 2E4GA 4C5OA 4EQRA 4USQA 1B5QA 1DOEA 2X3NA 3F8PA 3GMCA 3OC4A 4H50A 4X9NA 1GSNA 1ZOYA 3VRBA 2XDOA 4C3YA 2K3VA 3AWIA 4H4VA 1FS8A 3PVCA 4PAAA 1DNCA 4ECHA 3DK4A 4USRA 1JEHA 1ZMCA 2R0PA 3CN8A 2YVGA 4AOXA 4K2XA 3CNPA 3AXBA 1LV0A 3DH9A 5KMQA 4MJWA 3TTBA 3CNSA 4ICYA 5FS7A 3UTHA 2HQMA 4BV6A 5KMPA 2RDZA 1M1RA 5KMRA 3D1CA 4X9MA 5FS9A 2YLXA 3UOXA 1DODA 2WESA 2RGOA 4EM3A 4EIQA 4D03A 2BK3A 1NPXA 1D5TA 2IVEA 2V5ZA 4K8DA 4B1BA 1KNPA 4CY8A 2C67A 1N1PA 2OALA 3L1RA 2YLTA 3E1TA 4D04A 4YT0A 2V61A 1RSGA 2EQ6A 3NK1X 3FMWA 2A8XA 3AYJA 4UP3A 2Q0LA 4U8PA 2WS3A 1PBEA 3AYIA 1ZX9A 3VRAA 2QA2A 1GEUA 1FOHA 4G73A 5C2TA 1E1LA 1MXTA 3Q9TA 3M0OA 5L46A 4Y4NA 2RABA 3LXDA 2YG4A 3UP5A 3CTYA 2J3NA 3SX6A 3P4PA 5KRQA 1FT6A 1E39A 2AQJA 4B65A 3CNTA 1GXFA 1H7XA 2DKHA 2O9ZA 2H89A 3ATQA 2V3AA 3AE6A 4A6NB 4YSHA 1DOCA 3VR8A 3GD4A 3T2ZA 4H4SA 3CNDA 2R9ZA 3NG7X 1H7WA 2C3CA 2BCPA 3RP6A 3UTGA 5C3JA 1H81A 3UOZA 1PXCA 3BI2A 4YWOA 5JCKA 1CC4A 1PHHA 2BRAA 2Y6RA 3P9UA 4U8NA 2YR4A 1VQWA 1KF6A 3GMBA 2X99A 1E6EA 4KPRA 4GAPA 2I0ZA 4IA5A 2BRYA 2GR0A 4OPGA 3NYCA 1H82A 3LG1A 1XPQA 3QSSA 4LU6A 1YKJA 2GH5A 5DBJA 2GMJA 3ZYXA 1AOGA 2YAUA 2IVDA 3F29A 1GRBA 1NAAA 2XVIA 3NHOX 3DA1A 4GDPA 2GF3A 1GESA 4AP1A 1CHUA 2CFYA 1SP3A 4REKA 4DSHA 1UKVG 1EL7A 2OAMA 4JY2A 3UKPA 3LZWA 2CVJA 1KDGA 3F8DA 1ZDLA 3DJEA 2OLNA 1QLBA 2TMDA 3ALMA 3AB1A 1VRQB 1JRYA 2ARDA 2C70A 2VR0A 3S7WA 3AE3A 1K0IA 2A87A 3T31A 3KKJA 3AE5A 3GDNA 1F6MA 3AD8B 3G5RA 1L9EA 2JK6A 3SYIA 4NZHA 3AE2A 2BYBA 2R0CA 3CIRA 3BI5A 3NIXA 3QJ4A 1H84A 4NNJA 2C7GA 4JNQA 4DGKA 4H4YA 3GWFA 3UOVA 4EQWA 2XLSA 4Z2UA 2R4EA 4CCQA 4XWZA 3SFEA 2OT4A 1IUSA 1W4XA 2RGHA 4FK1A 3BNGA 2YG6A 1L0VA 1Q9IA 5ER0A 5U63A 2WDVA 4OVIA 3C96A 5HXIA 2GVCA 5JCIA 1ONFA 5EB4A 1CJ3A 3ICTA 3O0HA 1M64A 1PBBA 1ZY8A 2YWLA 3V3OA 4A5LA 3AE7A 1CJ4A 3RP8A 4Z25A 3SM8A 1ELIA 4GDEA 1QJDA 1KSUA 1NENA 2C76A 3K7TA 1MOKA 2GR2A 2VZ2A 4Z44A 2DKIA 2QAEA 1XANA 1LQUA 4ZCCA 1NEKA 4GAVA 3LJPA 4Z43A 4Z24A 2WQYA 3LGQA 2BK4A 2XLUA 3GRSA 1O95A 1NHSA 1REOA 3LADA 3P4SA 1KFYA 3AE1A 4TM4A 2VVMA 1CF3A 2WP5A 2XFNA 3II4A 2EQ8A 3UU9A 3C4AA 2GQFA 2NPXA 4J36A 2VOUA 4CRTA 3TORA 1ZOVA 3UKAA 2BXRA 5EBKA 5HYMA 4APNA 4U2SA 2WPCA 2X8GA 3SZCA 2GR3A 4Q5BA 2W0HA 4AT0A 1LQTA 1BKWA 3DK8A 2NVKX 5FS8A
chains in the Genus database with same CATH topology
2WU2A 4AP3A 4B69A 4WJYA 4I59A 4L3ZA 3NYFA 1GRFA 5BRTA 3BNUA 1F8SA 3DMEA 2AR8A 3ZDNA 2R0GA 5KVHA 3SZFA 1PS9A 2XLRA 4UDPA 3BNHA 3CGBA 3BNMA 3AECA 2YLZA 1TDKA 3FPZA 4NEWA 3UTFA 4JN9A 3BI4A 3AE9A 1BGNA 1FECA 3SXIA 5M10A 4TM1A 2XFPA 2FJEA 4WCTA 3SFDA 4L3XA 4A9WA 4JQ9A 4YKGA 3PO7A 5JCLA 4H4PA 4A65A 3SCEA 3ALLA 1RYIA 2C4CA 2XYOA 3I6DA 4FX9A 4N9XA 4C3XA 5KMSA 3ISHA 3D8XA 4H4RA 3T2YA 1NHRA 4E0VA 2F5ZA 4IA6A 2GQWA 4YTNA 3KD9A 4HA6A 3UBRA 3RHAA 4B64A 1L9DA 1Y56B 2FJBA 1GPEA 3QVPA 4Z26A 3SZWA 2YG7A 3EF6A 2QCUA 3QSEA 2C73A 3RKHA 1GALA 3K7QX 4H2RA 1E1KA 3NH3X 1F8WA 1PBFA 4XXGA 4K5RA 4EMJA 2BCGG 2YLSA 4G6HA 4C77A 3UKFA 4BURA 4CNJA 4PABA 5IQ1A 2Z5XA 2WPEA 2YQUA 2V60A 4CBQA 4H4ZA 2VVLA 4U8LA 2JB1A 2FJDA 1JOAA 4EQXA 1Q1RA 4JY3A 2X50A 1GNDA 3H8IA 3AEBA 4H2NA 3SY4A 5BULA 2C64A 3AEAA 4CNKA 3T0KA 4EQSA 3ABVA 2Q7VA 2FBWA 4YSXA 4GR1A 4AOSA 2JKCA 4ZN0A 4U8OA 2OLOA 3Q6JA 2TPRA 4YTMA 3NKSA 2GAGB 2XCGA 3NN0X 4IVMB 3SZ0A 3DJDA 5KOWA 1Y56A 2R4JA 1LTXR 2BA9A 3FIMB 1PXBA 1NG3A 3AEGA 1PBDA 1JU2A 2BS2A 4G6GA 5TR3A 2CDUA 3UTEA 2XFUA 3FG2P 4B67A 1LPFA 1O94A 5KNLA 1S3EA 3RNMA 1MO9A 1VG9A 2BK5A 5BUKA 5KXJA 4LIIA 1OJ9A 4FDCB 4I58A 4G9KA 4EIPA 3QFBA 2H88A 3QFAA 4C74A 1M6IA 5IPYA 2EQ7A 4J34A 3LOVA 5GRTA 4AT2A 1VG0A 3NRNA 5HHFA 4H7UA 1PBCA 3S61A 3L1TA 3URHA 2JB2A 5KOXA 1OAHA 3BNFA 4Q5CA 1IUVA 1K4QA 1O5WA 2UZZA 2YVFA 3AEFA 4GUVA 1H86A 3L8KA 5J7XA 3VQRA 4A79A 1IUTA 4J33A 1GV4A 4YTPA 2YM2A 1XHCA 1GRTA 1COYA 2YM1A 4JDRA 1TDNA 2XVJA 3CMMA 4HB9A 4A6NA 1CC6A 1PXAA 4BK3A 3ICRA 1IUXA 3K7MX 1OJTA 2XLPA 3NK2X 4Z2RA 4TM0A 2APGA 5U1OA 4U2TA 1Y0PA 4EM4A 5HY5A 2C3DA 2WETA 3H8LA 2YG5A 1JNZA 2WOWA 3QSMA 4EMWA 3KA7A 4XWRA 3ADAB 2VRLA 4OCGA 1QO8A 4EMIA 2WHDA 1FS9A 1YY5A 4OPLA 3NGCX 1D7LA 3I3LA 3LZXA 3M13A 3V3NA 1YQ3A 1BGJA 2OA1A 2YR6A 5FS6A 2ZBWA 1GT8A 3DJJA 1JRZA 1TYPA 4JNAA 4U8KA 1ZMDA 2BC0A 2WEUA 4A99A 4OPUA 1LVLA 4J2WA 2CULA 2WP9A 4B66A 1CC2A 2XFOA 4L3YA 4II3A 1TYTA 2YLRA 1FCDA 3DGZA 3EANA 3DK9A 2JAEA 3IHGA 1M1PA 1PJ7A 3KPFA 1H6VA 3KU9A 2ZZ0A 2JB3A 3UCLA 3IHMA 3GRTA 3NYEA 4X4JA 1PJ5A 1DOBA 2VQBA 3F8RA 3GDPA 3C4NA 3KPKA 3UKHA 3ICSA 1FS7A 2RF7A 3SQPA 1IUWA 5FMHA 2EQ9A 1TDOA 3IWAA 1P2HA 2BACA 1NG4A 2YR5A 2GV8A 1GRHA 2JBVA 4H4QA 1B4VA 4BJZA 1TDFA 3AE4A 4RG4A 1S3BA 2BS3A 1BWCA 3OZ2A 1ZK7A 1LJ1A 1NHPA 2A89A 1SEZA 3IC9A 3V76A 4RSLA 1OJCA 4NTEA 1PN0A 3M12A 3CPHG 4O5UA 3SXQA 4Q0TA 4Q1OA 3P4QA 1TRBA 1IUUA 3H4KA 1F3PA 3CGCA 3P4RA 1ZP0A 3ATRA 4NTDA 3WE0A 4H4UA 3DGHA 4NEVA 4K22A 2YLWA 1H83A 3BHKA 2XVFA 4K5SA 1CL0A 1PDHA 1TDEA 2WPFA 3NTAA 4H4TA 4Z2TA 2GB0A 2XVEA 3D1IA 3EAOA 1KSSA 2WOIA 1DXLA 2WDRA 3CPJG 4IVOB 4ZCDA 3OWMA 4OPDA 2C66A 2FJAA 4BK1A 4Y4LA 4WX1A 1E1MA 1K0LA 3UP4A 3NLCA 1F8RA 1GOSA 1V59A 2XLTA 1Q1WA 3AD7B 2ZZBA 1GRAA 2C75A 1D4CA 2Y6QA 2B7RA 2VRMA 4UDRA 2WBAA 3GSIA 4ADWA 1GETA 2X8HA 4LA1A 3JSKA 3NT6A 1NDAA 4YXDA 1QDBA 2WU5A 3B3RA 3VR9A 3FO3A 3KLJA 1K0JA 1EL8A 3AYLA 2Q6UA 3HYVA 4J31A 3UOYA 3SGLA 2R46A 4OPCA 1Z6LA 2GAHB 1EL5A 1L9CA 3MMOA 1EL9A 2B76A 4OPIA 5JCNA 2YVJA 1IJHA 2WDQA 1BF3A 3CPIG 2C72A 1S2QA 5U25A 3ITJA 5CQFA 2YG3A 4U8IA 4B68A 4H2PA 2ZO5A 3GD3A 4YKFA 4BK2A 1PJ6A 1GREA 2E5VA 4Q17A 5M0ZA 4J57A 4A7AA 2B9YA 1E1NA 2RGJA 1CBOA 2J7AA 3AD9B 2VQ7A 3CGDA 1FT5A 4Y4MA 3UKLA 4H4WA 3G5QA 2GEWA 1FL2A 2QA1A 4GCMA 3UKKA 3REDA 1VDCA 3GYIA 4CCRA 4GF7A 3HZLA 4KX6A 3R9UA 5EB5A 2BXSA 1M1QA 1FEBA 1GTHA 3P1WA 1GERA 5JCMA 2GR1A 1BVBA 1CJCA 3G5SA 1YQZA 4TLXA 4M52A 2V3BA 4YSZA 1GU6A 1E7PA 3HYXA 5LV9A 4NWZA 3K30A 4TLZA 4TM3A 1N4WA 5KWFA 1JNRA 1KNRA 1RP0A 3NNEA 4IV9A 4YSYA 2GMHA 1BZLA 1OJAA 3GM6A 3AEEA 3S5WA 1S2YA 1NHQA 5J60A 2GRTA 2ZZCA 3HYWA 3FBSA 2Q0KA 2E1MA 4U8MA 1D4DA 1DJNA 2XVHA 3AEDA 4G74A 4RG3A 2ACZA 4H4XA 2E81A 3LB8A 5CKUA 2WOVA 3COXA 2C65A 5GSNA 1N4UA 4L38A 5EOWA 3VRDB 1B8SA 5BVAA 3IF9A 2BS4A 2Z5YA 4UDQA 3UKQA 1B37A 1GTEA 1CJ2A 3B6DA 3GYJA 2BABA 2LFCA 3CNJA 2R45A 1OJDA 2VVLG 4GRTA 1DJQA 3QVRA 3T14A 1JRXA 2AAQA 3CGEA 1ZKQA 1X31B 2WP6A 4BJYA 4Q4UA 3T2KA 4B63A 4DNAA 2B9XA 4P9SA 4II2A 2X8CA 5IQ4A 3NK0X 2B9WA 3GWDA 3GYXA 4FK1C 4NTCA 2BC1A 5KVIA 1HYUA 3DJGX 1JNIA 4U2LA 1D7YA 1EBDA 3BNJA 4O5QA 3ALJA 3NTDA 1FEAA 2B7SA 3EPTA 4OPTA 4CY6A 4DSGA 3AE8A 3KVEA 4U8JA 2IIDA 1D4EA 2E80A 1GRGA 2PHHA 4H2QA 1N4VA 3NN6X 2XFQA 4J56A 2PYXA 2V6OA 3RP7A 1XDIA 4K7ZA 1YQ4A 3PS9A 3BHFA 3T37A 1P2EA 2E4GA 4C5OA 4EQRA 4USQA 1B5QA 1DOEA 2X3NA 3F8PA 3GMCA 3OC4A 4H50A 4X9NA 1GSNA 1ZOYA 3VRBA 2XDOA 4C3YA 2K3VA 3AWIA 4H4VA 1FS8A 3PVCA 4PAAA 1DNCA 4ECHA 3DK4A 4USRA 1JEHA 1ZMCA 2R0PA 3CN8A 2YVGA 4AOXA 4K2XA 3CNPA 3AXBA 1LV0A 3DH9A 5KMQA 4MJWA 3TTBA 3CNSA 4ICYA 5FS7A 3UTHA 2HQMA 4BV6A 5KMPA 2RDZA 1M1RA 5KMRA 3D1CA 4X9MA 5FS9A 2YLXA 3UOXA 1DODA 2WESA 2RGOA 4EM3A 4EIQA 4D03A 2BK3A 1NPXA 1D5TA 2IVEA 2V5ZA 4K8DA 4B1BA 1KNPA 4CY8A 2C67A 1N1PA 2OALA 3L1RA 2YLTA 3E1TA 4D04A 4YT0A 2V61A 1RSGA 2EQ6A 3NK1X 3FMWA 2A8XA 3AYJA 4UP3A 2Q0LA 4U8PA 2WS3A 1PBEA 3AYIA 1ZX9A 3VRAA 2QA2A 1GEUA 1FOHA 4G73A 5C2TA 1E1LA 1MXTA 3Q9TA 3M0OA 5L46A 4Y4NA 2RABA 3LXDA 2YG4A 3UP5A 3CTYA 2J3NA 3SX6A 3P4PA 5KRQA 1FT6A 1E39A 2AQJA 4B65A 3CNTA 1GXFA 1H7XA 2DKHA 2O9ZA 2H89A 3ATQA 2V3AA 3AE6A 4A6NB 4YSHA 1DOCA 3VR8A 3GD4A 3T2ZA 4H4SA 3CNDA 2R9ZA 3NG7X 1H7WA 2C3CA 2BCPA 3RP6A 3UTGA 5C3JA 1H81A 3UOZA 1PXCA 3BI2A 4YWOA 5JCKA 1CC4A 1PHHA 2BRAA 2Y6RA 3P9UA 4U8NA 2YR4A 1VQWA 1KF6A 3GMBA 2X99A 1E6EA 4KPRA 4GAPA 2I0ZA 4IA5A 2BRYA 2GR0A 4OPGA 3NYCA 1H82A 3LG1A 1XPQA 3QSSA 4LU6A 1YKJA 2GH5A 5DBJA 2GMJA 3ZYXA 1AOGA 2YAUA 2IVDA 3F29A 1GRBA 1NAAA 2XVIA 3NHOX 3DA1A 4GDPA 2GF3A 1GESA 4AP1A 1CHUA 2CFYA 1SP3A 4REKA 4DSHA 1UKVG 1EL7A 2OAMA 4JY2A 3UKPA 3LZWA 2CVJA 1KDGA 3F8DA 1ZDLA 3DJEA 2OLNA 1QLBA 2TMDA 3ALMA 3AB1A 1VRQB 1JRYA 2ARDA 2C70A 2VR0A 3S7WA 3AE3A 1K0IA 2A87A 3T31A 3KKJA 3AE5A 3GDNA 1F6MA 3AD8B 3G5RA 1L9EA 2JK6A 3SYIA 4NZHA 3AE2A 2BYBA 2R0CA 3CIRA 3BI5A 3NIXA 3QJ4A 1H84A 4NNJA 2C7GA 4JNQA 4DGKA 4H4YA 3GWFA 3UOVA 4EQWA 2XLSA 4Z2UA 2R4EA 4CCQA 4XWZA 3SFEA 2OT4A 1IUSA 1W4XA 2RGHA 4FK1A 3BNGA 2YG6A 1L0VA 1Q9IA 5ER0A 5U63A 2WDVA 4OVIA 3C96A 5HXIA 2GVCA 5JCIA 1ONFA 5EB4A 1CJ3A 3ICTA 3O0HA 1M64A 1PBBA 1ZY8A 2YWLA 3V3OA 4A5LA 3AE7A 1CJ4A 3RP8A 4Z25A 3SM8A 1ELIA 4GDEA 1QJDA 1KSUA 1NENA 2C76A 3K7TA 1MOKA 2GR2A 2VZ2A 4Z44A 2DKIA 2QAEA 1XANA 1LQUA 4ZCCA 1NEKA 4GAVA 3LJPA 4Z43A 4Z24A 2WQYA 3LGQA 2BK4A 2XLUA 3GRSA 1O95A 1NHSA 1REOA 3LADA 3P4SA 1KFYA 3AE1A 4TM4A 2VVMA 1CF3A 2WP5A 2XFNA 3II4A 2EQ8A 3UU9A 3C4AA 2GQFA 2NPXA 4J36A 2VOUA 4CRTA 3TORA 1ZOVA 3UKAA 2BXRA 5EBKA 5HYMA 4APNA 4U2SA 2WPCA 2X8GA 3SZCA 2GR3A 4Q5BA 2W0HA 4AT0A 1LQTA 1BKWA 3DK8A 2NVKX 5FS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WU2 A;  4AP3 A;  4B69 A;  4WJY A;  4I59 A;  4L3Z A;  3NYF A;  1GRF A;  5BRT A;  3BNU A;  1F8S A;  3DME A;  2AR8 A;  3ZDN A;  2R0G A;  5KVH A;  1PS9 A;  2XLR A;  4UDP A;  3BNH A;  3CGB A;  3BNM A;  3AEC A;  2YLZ A;  1TDK A;  3FPZ A;  4NEW A;  3UTF A;  4JN9 A;  3BI4 A;  3AE9 A;  1BGN A;  1FEC A;  5M10 A;  4TM1 A;  2XFP A;  2FJE A;  4WCT A;  3SFD A;  4L3X A;  4A9W A;  4JQ9 A;  4YKG A;  3PO7 A;  5JCL A;  4H4P A;  4A65 A;  3SCE A;  3ALL A;  1RYI A;  2XYO A;  3I6D A;  4FX9 A;  4N9X A;  4C3X A;  3ISH A;  3D8X A;  4H4R A;  1NHR A;  4E0V A;  2F5Z A;  4IA6 A;  2GQW A;  4YTN A;  3KD9 A;  4HA6 A;  3UBR A;  3RHA A;  4B64 A;  1L9D A;  1Y56 B;  2FJB A;  1GPE A;  3QVP A;  4Z26 A;  2YG7 A;  3EF6 A;  2QCU A;  3QSE A;  2C73 A;  3RKH A;  1GAL A;  3K7Q X;  4H2R A;  1E1K A;  3NH3 X;  1F8W A;  1PBF A;  4XXG A;  4K5R A;  4EMJ A;  2BCG G;  2YLS A;  4C77 A;  3UKF A;  4BUR A;  4CNJ A;  4PAB A;  5IQ1 A;  2Z5X A;  2WPE A;  2YQU A;  2V60 A;  4CBQ A;  4H4Z A;  2VVL A;  4U8L A;  2JB1 A;  2FJD A;  1JOA A;  4EQX A;  1Q1R A;  4JY3 A;  2X50 A;  1GND A;  3H8I A;  3AEB A;  4H2N A;  5BUL A;  2C64 A;  3AEA A;  4CNK A;  4EQS A;  3ABV A;  2Q7V A;  2FBW A;  4YSX A;  4GR1 A;  4AOS A;  2JKC A;  4ZN0 A;  4U8O A;  2OLO A;  3Q6J A;  2TPR A;  4YTM A;  3NKS A;  2GAG B;  2XCG A;  3NN0 X;  4IVM B;  3DJD A;  5KOW A;  1Y56 A;  2R4J A;  1LTX R;  2BA9 A;  3FIM B;  1PXB A;  1NG3 A;  3AEG A;  1PBD A;  1JU2 A;  2BS2 A;  3UTE A;  5TR3 A;  2CDU A;  2XFU A;  3FG2 P;  4B67 A;  1LPF A;  1O94 A;  1S3E A;  3RNM A;  1MO9 A;  1VG9 A;  2BK5 A;  5BUK A;  5KXJ A;  4LII A;  1OJ9 A;  4FDC B;  4I58 A;  4EIP A;  3QFB A;  2H88 A;  3QFA A;  4C74 A;  1M6I A;  5IPY A;  2EQ7 A;  4J34 A;  3LOV A;  5GRT A;  4AT2 A;  1VG0 A;  3NRN A;  5HHF A;  4H7U A;  1PBC A;  3S61 A;  3L1T A;  3URH A;  2JB2 A;  5KOX A;  1OAH A;  3BNF A;  4Q5C A;  1IUV A;  1K4Q A;  1O5W A;  2UZZ A;  2YVF A;  3AEF A;  4GUV A;  1H86 A;  3L8K A;  5J7X A;  3VQR A;  4A79 A;  1IUT A;  4J33 A;  1GV4 A;  4YTP A;  2YM2 A;  1XHC A;  1GRT A;  1COY A;  2YM1 A;  4JDR A;  1TDN A;  2XVJ A;  4HB9 A;  4A6N A;  1CC6 A;  1PXA A;  4BK3 A;  3ICR A;  1IUX A;  3K7M X;  1OJT A;  2XLP A;  3NK2 X;  4Z2R A;  4TM0 A;  2APG A;  5U1O A;  4U2T A;  1Y0P A;  4EM4 A;  5HY5 A;  2C3D A;  2WET A;  3H8L A;  2YG5 A;  1JNZ A;  2WOW A;  3QSM A;  4EMW A;  3KA7 A;  4XWR A;  3ADA B;  2VRL A;  4OCG A;  1QO8 A;  4EMI A;  2WHD A;  1FS9 A;  1YY5 A;  4OPL A;  3NGC X;  1D7L A;  3I3L A;  3LZX A;  3M13 A;  3V3N A;  1YQ3 A;  1BGJ A;  2OA1 A;  2YR6 A;  5FS6 A;  2ZBW A;  1GT8 A;  3DJJ A;  1JRZ A;  1TYP A;  4JNA A;  4U8K A;  1ZMD A;  2BC0 A;  2WEU A;  4A99 A;  4OPU A;  1LVL A;  4J2W A;  2CUL A;  2WP9 A;  4B66 A;  1CC2 A;  2XFO A;  4L3Y A;  1TYT A;  2YLR A;  1FCD A;  3DGZ A;  3EAN A;  3DK9 A;  2JAE A;  3IHG A;  1M1P A;  1PJ7 A;  3KPF A;  1H6V A;  3KU9 A;  2ZZ0 A;  2JB3 A;  3UCL A;  3IHM A;  3GRT A;  3NYE A;  4X4J A;  1PJ5 A;  1DOB A;  2VQB A;  3F8R A;  3GDP A;  3C4N A;  3UKH A;  3ICS A;  1FS7 A;  2RF7 A;  3SQP A;  1IUW A;  5FMH A;  2EQ9 A;  1TDO A;  3IWA A;  1P2H A;  2BAC A;  1NG4 A;  2YR5 A;  2GV8 A;  1GRH A;  2JBV A;  4H4Q A;  1B4V A;  4BJZ A;  1TDF A;  3AE4 A;  4RG4 A;  1S3B A;  2BS3 A;  1BWC A;  3OZ2 A;  1ZK7 A;  1LJ1 A;  1NHP A;  2A89 A;  1SEZ A;  3IC9 A;  3V76 A;  4RSL A;  1OJC A;  4NTE A;  1PN0 A;  3M12 A;  3CPH G;  4O5U A;  3SXQ A;  4Q0T A;  4Q1O A;  3P4Q A;  1TRB A;  1IUU A;  3H4K A;  1F3P A;  3CGC A;  3P4R A;  1ZP0 A;  3ATR A;  4NTD A;  3WE0 A;  4H4U A;  3DGH A;  4NEV A;  4K22 A;  2YLW A;  1H83 A;  3BHK A;  2XVF A;  4K5S A;  1CL0 A;  1PDH A;  1TDE A;  2WPF A;  3NTA A;  4H4T A;  4Z2T A;  2GB0 A;  2XVE A;  3D1I A;  3EAO A;  1KSS A;  2WOI A;  1DXL A;  2WDR A;  3CPJ G;  4IVO B;  4ZCD A;  3OWM A;  4OPD A;  2C66 A;  2FJA A;  4BK1 A;  4Y4L A;  4WX1 A;  1E1M A;  1K0L A;  3UP4 A;  3NLC A;  1F8R A;  1GOS A;  1V59 A;  2XLT A;  1Q1W A;  3AD7 B;  2ZZB A;  1GRA A;  2C75 A;  1D4C A;  2Y6Q A;  2B7R A;  2VRM A;  4UDR A;  2WBA A;  3GSI A;  4ADW A;  1GET A;  2X8H A;  4LA1 A;  3JSK A;  3NT6 A;  1NDA A;  4YXD A;  1QDB A;  2WU5 A;  3B3R A;  3VR9 A;  3FO3 A;  3KLJ A;  1K0J A;  1EL8 A;  3AYL A;  2Q6U A;  4J31 A;  3UOY A;  3SGL A;  2R46 A;  4OPC A;  1Z6L A;  2GAH B;  1EL5 A;  1L9C A;  3MMO A;  1EL9 A;  2B76 A;  4OPI A;  5JCN A;  2YVJ A;  1IJH A;  2WDQ A;  1BF3 A;  3CPI G;  2C72 A;  1S2Q A;  5U25 A;  3ITJ A;  5CQF A;  2YG3 A;  4U8I A;  4B68 A;  4H2P A;  2ZO5 A;  3GD3 A;  4YKF A;  4BK2 A;  1PJ6 A;  1GRE A;  2E5V A;  4Q17 A;  5M0Z A;  4J57 A;  4A7A A;  2B9Y A;  1E1N A;  2RGJ A;  1CBO A;  2J7A A;  3AD9 B;  2VQ7 A;  3CGD A;  1FT5 A;  4Y4M A;  3UKL A;  4H4W A;  3G5Q A;  2GEW A;  1FL2 A;  2QA1 A;  4GCM A;  3UKK A;  3RED A;  1VDC A;  3GYI A;  4CCR A;  4GF7 A;  3HZL A;  4KX6 A;  3R9U A;  5EB5 A;  2BXS A;  1M1Q A;  1FEB A;  1GTH A;  3P1W A;  1GER A;  5JCM A;  2GR1 A;  1BVB A;  1CJC A;  3G5S A;  1YQZ A;  4TLX A;  4M52 A;  2V3B A;  4YSZ A;  1GU6 A;  1E7P A;  5LV9 A;  3K30 A;  4TLZ A;  4TM3 A;  1N4W A;  5KWF A;  1JNR A;  1KNR A;  1RP0 A;  3NNE A;  4IV9 A;  4YSY A;  2GMH A;  1BZL A;  1OJA A;  3GM6 A;  3AEE A;  3S5W A;  1S2Y A;  1NHQ A;  5J60 A;  2GRT A;  2ZZC A;  3FBS A;  2Q0K A;  2E1M A;  4U8M A;  1D4D A;  1DJN A;  2XVH A;  3AED A;  4RG3 A;  2ACZ A;  4H4X A;  2E81 A;  3LB8 A;  5CKU A;  2WOV A;  3COX A;  2C65 A;  5GSN A;  1N4U A;  4L38 A;  5EOW A;  3VRD B;  1B8S A;  5BVA A;  3IF9 A;  2BS4 A;  2Z5Y A;  4UDQ A;  3UKQ A;  1B37 A;  1GTE A;  1CJ2 A;  3B6D A;  3GYJ A;  2BAB A;  2LFC A;  3CNJ A;  2R45 A;  1OJD A;  2VVL G;  4GRT A;  1DJQ A;  3QVR A;  1JRX A;  2AAQ A;  3CGE A;  1ZKQ A;  1X31 B;  2WP6 A;  4BJY A;  4Q4U A;  4B63 A;  4DNA A;  2B9X A;  4P9S A;  5IQ4 A;  2X8C A;  3NK0 X;  2B9W A;  3GWD A;  3GYX A;  4FK1 C;  4NTC A;  2BC1 A;  5KVI A;  1HYU A;  3DJG X;  1JNI A;  4U2L A;  1D7Y A;  1EBD A;  3BNJ A;  4O5Q A;  3ALJ A;  3NTD A;  1FEA A;  2B7S A;  3EPT A;  4OPT A;  4CY6 A;  4DSG A;  3AE8 A;  3KVE A;  4U8J A;  2IID A;  1D4E A;  2E80 A;  1GRG A;  2PHH A;  4H2Q A;  1N4V A;  3NN6 X;  2XFQ A;  4J56 A;  2PYX A;  2V6O A;  3RP7 A;  1XDI A;  4K7Z A;  1YQ4 A;  3PS9 A;  3BHF A;  3T37 A;  1P2E A;  2E4G A;  4C5O A;  4EQR A;  4USQ A;  1B5Q A;  1DOE A;  2X3N A;  3F8P A;  3GMC A;  3OC4 A;  4H50 A;  4X9N A;  1GSN A;  1ZOY A;  3VRB A;  2XDO A;  4C3Y A;  2K3V A;  3AWI A;  4H4V A;  1FS8 A;  3PVC A;  4PAA A;  1DNC A;  4ECH A;  3DK4 A;  4USR A;  1JEH A;  1ZMC A;  2R0P A;  3CN8 A;  2YVG A;  4AOX A;  4K2X A;  3CNP A;  3AXB A;  1LV0 A;  3DH9 A;  4MJW A;  3TTB A;  3CNS A;  4ICY A;  5FS7 A;  3UTH A;  2HQM A;  4BV6 A;  2RDZ A;  1M1R A;  3D1C A;  4X9M A;  5FS9 A;  2YLX A;  3UOX A;  1DOD A;  2WES A;  2RGO A;  4EM3 A;  4EIQ A;  4D03 A;  2BK3 A;  1NPX A;  1D5T A;  2IVE A;  2V5Z A;  4K8D A;  4B1B A;  1KNP A;  4CY8 A;  2C67 A;  1N1P A;  2OAL A;  3L1R A;  2YLT A;  3E1T A;  4D04 A;  4YT0 A;  2V61 A;  1RSG A;  2EQ6 A;  3NK1 X;  3FMW A;  2A8X A;  3AYJ A;  4UP3 A;  2Q0L A;  4U8P A;  2WS3 A;  1PBE A;  3AYI A;  1ZX9 A;  3VRA A;  2QA2 A;  1GEU A;  1FOH A;  5C2T A;  1E1L A;  1MXT A;  3Q9T A;  3M0O A;  5L46 A;  4Y4N A;  2RAB A;  3LXD A;  2YG4 A;  3UP5 A;  3CTY A;  2J3N A;  3P4P A;  5KRQ A;  1FT6 A;  1E39 A;  2AQJ A;  4B65 A;  3CNT A;  1GXF A;  1H7X A;  2DKH A;  2O9Z A;  2H89 A;  3ATQ A;  2V3A A;  3AE6 A;  4A6N B;  4YSH A;  1DOC A;  3VR8 A;  3GD4 A;  4H4S A;  3CND A;  2R9Z A;  3NG7 X;  1H7W A;  2C3C A;  2BCP A;  3RP6 A;  3UTG A;  5C3J A;  1H81 A;  3UOZ A;  1PXC A;  3BI2 A;  4YWO A;  5JCK A;  1CC4 A;  1PHH A;  2Y6R A;  3P9U A;  4U8N A;  2YR4 A;  1VQW A;  1KF6 A;  3GMB A;  2X99 A;  1E6E A;  4KPR A;  4IA5 A;  2I0Z A;  4OPG A;  2GR0 A;  3NYC A;  1H82 A;  3LG1 A;  1XPQ A;  3QSS A;  4LU6 A;  1YKJ A;  2GH5 A;  5DBJ A;  2GMJ A;  3ZYX A;  1AOG A;  2YAU A;  2IVD A;  3F29 A;  1GRB A;  1NAA A;  2XVI A;  3NHO X;  3DA1 A;  4GDP A;  2GF3 A;  1GES A;  4AP1 A;  1CHU A;  2CFY A;  1SP3 A;  4REK A;  4DSH A;  1UKV G;  1EL7 A;  2OAM A;  4JY2 A;  3UKP A;  3LZW A;  2CVJ A;  1KDG A;  3F8D A;  1ZDL A;  3DJE A;  2OLN A;  1QLB A;  2TMD A;  3ALM A;  3AB1 A;  1VRQ B;  1JRY A;  2ARD A;  2C70 A;  2VR0 A;  3S7W A;  3AE3 A;  1K0I A;  2A87 A;  3KKJ A;  3AE5 A;  3GDN A;  1F6M A;  3AD8 B;  3G5R A;  1L9E A;  2JK6 A;  4NZH A;  3AE2 A;  2BYB A;  2R0C A;  3CIR A;  3BI5 A;  3NIX A;  3QJ4 A;  1H84 A;  4EQW A;  2C7G A;  4JNQ A;  4DGK A;  4H4Y A;  3GWF A;  3UOV A;  2XLS A;  4Z2U A;  2R4E A;  4CCQ A;  4XWZ A;  3SFE A;  2OT4 A;  1IUS A;  1W4X A;  2RGH A;  4FK1 A;  3BNG A;  2YG6 A;  1L0V A;  1Q9I A;  5ER0 A;  5U63 A;  2WDV A;  4OVI A;  3C96 A;  5HXI A;  2GVC A;  5JCI A;  1ONF A;  5EB4 A;  1CJ3 A;  3ICT A;  3O0H A;  1M64 A;  1PBB A;  1ZY8 A;  2YWL A;  3V3O A;  4A5L A;  3AE7 A;  1CJ4 A;  3RP8 A;  4Z25 A;  3SM8 A;  1ELI A;  4GDE A;  1QJD A;  1KSU A;  1NEN A;  2C76 A;  3K7T A;  1MOK A;  2GR2 A;  2VZ2 A;  4Z44 A;  2DKI A;  2QAE A;  1XAN A;  1LQU A;  4ZCC A;  1NEK A;  3LJP A;  4Z43 A;  4Z24 A;  2WQY A;  3LGQ A;  2BK4 A;  2XLU A;  3GRS A;  1O95 A;  1NHS A;  1REO A;  3LAD A;  3P4S A;  1KFY A;  3AE1 A;  4TM4 A;  2VVM A;  1CF3 A;  2WP5 A;  2XFN A;  3II4 A;  2EQ8 A;  3UU9 A;  3C4A A;  2GQF A;  2NPX A;  4J36 A;  2VOU A;  4CRT A;  3TOR A;  1ZOV A;  3UKA A;  2BXR A;  5EBK A;  5HYM A;  4APN A;  4U2S A;  2WPC A;  2X8G A;  2GR3 A;  4Q5B A;  2W0H A;  4AT0 A;  1LQT A;  1BKW A;  3DK8 A;  2NVK X;  5FS8 A; 
#chains in the Genus database with same CATH topology
 2WU2 A;  4AP3 A;  4B69 A;  4WJY A;  4I59 A;  4L3Z A;  3NYF A;  1GRF A;  5BRT A;  3BNU A;  1F8S A;  3DME A;  2AR8 A;  3ZDN A;  2R0G A;  5KVH A;  3SZF A;  1PS9 A;  2XLR A;  4UDP A;  3BNH A;  3CGB A;  3BNM A;  3AEC A;  2YLZ A;  1TDK A;  3FPZ A;  4NEW A;  3UTF A;  4JN9 A;  3BI4 A;  3AE9 A;  1BGN A;  1FEC A;  3SXI A;  5M10 A;  4TM1 A;  2XFP A;  2FJE A;  4WCT A;  3SFD A;  4L3X A;  4A9W A;  4JQ9 A;  4YKG A;  3PO7 A;  5JCL A;  4H4P A;  4A65 A;  3SCE A;  3ALL A;  1RYI A;  2C4C A;  2XYO A;  3I6D A;  4FX9 A;  4N9X A;  4C3X A;  5KMS A;  3ISH A;  3D8X A;  4H4R A;  3T2Y A;  1NHR A;  4E0V A;  2F5Z A;  4IA6 A;  2GQW A;  4YTN A;  3KD9 A;  4HA6 A;  3UBR A;  3RHA A;  4B64 A;  1L9D A;  1Y56 B;  2FJB A;  1GPE A;  3QVP A;  4Z26 A;  3SZW A;  2YG7 A;  3EF6 A;  2QCU A;  3QSE A;  2C73 A;  3RKH A;  1GAL A;  3K7Q X;  4H2R A;  1E1K A;  3NH3 X;  1F8W A;  1PBF A;  4XXG A;  4K5R A;  4EMJ A;  2BCG G;  2YLS A;  4G6H A;  4C77 A;  3UKF A;  4BUR A;  4CNJ A;  4PAB A;  5IQ1 A;  2Z5X A;  2WPE A;  2YQU A;  2V60 A;  4CBQ A;  4H4Z A;  2VVL A;  4U8L A;  2JB1 A;  2FJD A;  1JOA A;  4EQX A;  1Q1R A;  4JY3 A;  2X50 A;  1GND A;  3H8I A;  3AEB A;  4H2N A;  3SY4 A;  5BUL A;  2C64 A;  3AEA A;  4CNK A;  3T0K A;  4EQS A;  3ABV A;  2Q7V A;  2FBW A;  4YSX A;  4GR1 A;  4AOS A;  2JKC A;  4ZN0 A;  4U8O A;  2OLO A;  3Q6J A;  2TPR A;  4YTM A;  3NKS A;  2GAG B;  2XCG A;  3NN0 X;  4IVM B;  3SZ0 A;  3DJD A;  5KOW A;  1Y56 A;  2R4J A;  1LTX R;  2BA9 A;  3FIM B;  1PXB A;  1NG3 A;  3AEG A;  1PBD A;  1JU2 A;  2BS2 A;  4G6G A;  5TR3 A;  2CDU A;  3UTE A;  2XFU A;  3FG2 P;  4B67 A;  1LPF A;  1O94 A;  5KNL A;  1S3E A;  3RNM A;  1MO9 A;  1VG9 A;  2BK5 A;  5BUK A;  5KXJ A;  4LII A;  1OJ9 A;  4FDC B;  4I58 A;  4G9K A;  4EIP A;  3QFB A;  2H88 A;  3QFA A;  4C74 A;  1M6I A;  5IPY A;  2EQ7 A;  4J34 A;  3LOV A;  5GRT A;  4AT2 A;  1VG0 A;  3NRN A;  5HHF A;  4H7U A;  1PBC A;  3S61 A;  3L1T A;  3URH A;  2JB2 A;  5KOX A;  1OAH A;  3BNF A;  4Q5C A;  1IUV A;  1K4Q A;  1O5W A;  2UZZ A;  2YVF A;  3AEF A;  4GUV A;  1H86 A;  3L8K A;  5J7X A;  3VQR A;  4A79 A;  1IUT A;  4J33 A;  1GV4 A;  4YTP A;  2YM2 A;  1XHC A;  1GRT A;  1COY A;  2YM1 A;  4JDR A;  1TDN A;  2XVJ A;  3CMM A;  4HB9 A;  4A6N A;  1CC6 A;  1PXA A;  4BK3 A;  3ICR A;  1IUX A;  3K7M X;  1OJT A;  2XLP A;  3NK2 X;  4Z2R A;  4TM0 A;  2APG A;  5U1O A;  4U2T A;  1Y0P A;  4EM4 A;  5HY5 A;  2C3D A;  2WET A;  3H8L A;  2YG5 A;  1JNZ A;  2WOW A;  3QSM A;  4EMW A;  3KA7 A;  4XWR A;  3ADA B;  2VRL A;  4OCG A;  1QO8 A;  4EMI A;  2WHD A;  1FS9 A;  1YY5 A;  4OPL A;  3NGC X;  1D7L A;  3I3L A;  3LZX A;  3M13 A;  3V3N A;  1YQ3 A;  1BGJ A;  2OA1 A;  2YR6 A;  5FS6 A;  2ZBW A;  1GT8 A;  3DJJ A;  1JRZ A;  1TYP A;  4JNA A;  4U8K A;  1ZMD A;  2BC0 A;  2WEU A;  4A99 A;  4OPU A;  1LVL A;  4J2W A;  2CUL A;  2WP9 A;  4B66 A;  1CC2 A;  2XFO A;  4L3Y A;  4II3 A;  1TYT A;  2YLR A;  1FCD A;  3DGZ A;  3EAN A;  3DK9 A;  2JAE A;  3IHG A;  1M1P A;  1PJ7 A;  3KPF A;  1H6V A;  3KU9 A;  2ZZ0 A;  2JB3 A;  3UCL A;  3IHM A;  3GRT A;  3NYE A;  4X4J A;  1PJ5 A;  1DOB A;  2VQB A;  3F8R A;  3GDP A;  3C4N A;  3KPK A;  3UKH A;  3ICS A;  1FS7 A;  2RF7 A;  3SQP A;  1IUW A;  5FMH A;  2EQ9 A;  1TDO A;  3IWA A;  1P2H A;  2BAC A;  1NG4 A;  2YR5 A;  2GV8 A;  1GRH A;  2JBV A;  4H4Q A;  1B4V A;  4BJZ A;  1TDF A;  3AE4 A;  4RG4 A;  1S3B A;  2BS3 A;  1BWC A;  3OZ2 A;  1ZK7 A;  1LJ1 A;  1NHP A;  2A89 A;  1SEZ A;  3IC9 A;  3V76 A;  4RSL A;  1OJC A;  4NTE A;  1PN0 A;  3M12 A;  3CPH G;  4O5U A;  3SXQ A;  4Q0T A;  4Q1O A;  3P4Q A;  1TRB A;  1IUU A;  3H4K A;  1F3P A;  3CGC A;  3P4R A;  1ZP0 A;  3ATR A;  4NTD A;  3WE0 A;  4H4U A;  3DGH A;  4NEV A;  4K22 A;  2YLW A;  1H83 A;  3BHK A;  2XVF A;  4K5S A;  1CL0 A;  1PDH A;  1TDE A;  2WPF A;  3NTA A;  4H4T A;  4Z2T A;  2GB0 A;  2XVE A;  3D1I A;  3EAO A;  1KSS A;  2WOI A;  1DXL A;  2WDR A;  3CPJ G;  4IVO B;  4ZCD A;  3OWM A;  4OPD A;  2C66 A;  2FJA A;  4BK1 A;  4Y4L A;  4WX1 A;  1E1M A;  1K0L A;  3UP4 A;  3NLC A;  1F8R A;  1GOS A;  1V59 A;  2XLT A;  1Q1W A;  3AD7 B;  2ZZB A;  1GRA A;  2C75 A;  1D4C A;  2Y6Q A;  2B7R A;  2VRM A;  4UDR A;  2WBA A;  3GSI A;  4ADW A;  1GET A;  2X8H A;  4LA1 A;  3JSK A;  3NT6 A;  1NDA A;  4YXD A;  1QDB A;  2WU5 A;  3B3R A;  3VR9 A;  3FO3 A;  3KLJ A;  1K0J A;  1EL8 A;  3AYL A;  2Q6U A;  3HYV A;  4J31 A;  3UOY A;  3SGL A;  2R46 A;  4OPC A;  1Z6L A;  2GAH B;  1EL5 A;  1L9C A;  3MMO A;  1EL9 A;  2B76 A;  4OPI A;  5JCN A;  2YVJ A;  1IJH A;  2WDQ A;  1BF3 A;  3CPI G;  2C72 A;  1S2Q A;  5U25 A;  3ITJ A;  5CQF A;  2YG3 A;  4U8I A;  4B68 A;  4H2P A;  2ZO5 A;  3GD3 A;  4YKF A;  4BK2 A;  1PJ6 A;  1GRE A;  2E5V A;  4Q17 A;  5M0Z A;  4J57 A;  4A7A A;  2B9Y A;  1E1N A;  2RGJ A;  1CBO A;  2J7A A;  3AD9 B;  2VQ7 A;  3CGD A;  1FT5 A;  4Y4M A;  3UKL A;  4H4W A;  3G5Q A;  2GEW A;  1FL2 A;  2QA1 A;  4GCM A;  3UKK A;  3RED A;  1VDC A;  3GYI A;  4CCR A;  4GF7 A;  3HZL A;  4KX6 A;  3R9U A;  5EB5 A;  2BXS A;  1M1Q A;  1FEB A;  1GTH A;  3P1W A;  1GER A;  5JCM A;  2GR1 A;  1BVB A;  1CJC A;  3G5S A;  1YQZ A;  4TLX A;  4M52 A;  2V3B A;  4YSZ A;  1GU6 A;  1E7P A;  3HYX A;  5LV9 A;  4NWZ A;  3K30 A;  4TLZ A;  4TM3 A;  1N4W A;  5KWF A;  1JNR A;  1KNR A;  1RP0 A;  3NNE A;  4IV9 A;  4YSY A;  2GMH A;  1BZL A;  1OJA A;  3GM6 A;  3AEE A;  3S5W A;  1S2Y A;  1NHQ A;  5J60 A;  2GRT A;  2ZZC A;  3HYW A;  3FBS A;  2Q0K A;  2E1M A;  4U8M A;  1D4D A;  1DJN A;  2XVH A;  3AED A;  4G74 A;  4RG3 A;  2ACZ A;  4H4X A;  2E81 A;  3LB8 A;  5CKU A;  2WOV A;  3COX A;  2C65 A;  5GSN A;  1N4U A;  4L38 A;  5EOW A;  3VRD B;  1B8S A;  5BVA A;  3IF9 A;  2BS4 A;  2Z5Y A;  4UDQ A;  3UKQ A;  1B37 A;  1GTE A;  1CJ2 A;  3B6D A;  3GYJ A;  2BAB A;  2LFC A;  3CNJ A;  2R45 A;  1OJD A;  2VVL G;  4GRT A;  1DJQ A;  3QVR A;  3T14 A;  1JRX A;  2AAQ A;  3CGE A;  1ZKQ A;  1X31 B;  2WP6 A;  4BJY A;  4Q4U A;  3T2K A;  4B63 A;  4DNA A;  2B9X A;  4P9S A;  4II2 A;  2X8C A;  5IQ4 A;  3NK0 X;  2B9W A;  3GWD A;  3GYX A;  4FK1 C;  4NTC A;  2BC1 A;  5KVI A;  1HYU A;  3DJG X;  1JNI A;  4U2L A;  1D7Y A;  1EBD A;  3BNJ A;  4O5Q A;  3ALJ A;  3NTD A;  1FEA A;  2B7S A;  2CZS A;  3EPT A;  4OPT A;  4CY6 A;  3AE8 A;  3KVE A;  4U8J A;  2IID A;  4DSG A;  1D4E A;  2E80 A;  1GRG A;  2PHH A;  4H2Q A;  1N4V A;  3NN6 X;  2XFQ A;  4J56 A;  2PYX A;  2V6O A;  3RP7 A;  1XDI A;  4K7Z A;  1YQ4 A;  3PS9 A;  3BHF A;  3T37 A;  1P2E A;  2E4G A;  4C5O A;  4EQR A;  4USQ A;  1B5Q A;  1DOE A;  2X3N A;  3F8P A;  3GMC A;  3OC4 A;  4H50 A;  4X9N A;  1GSN A;  1ZOY A;  3VRB A;  2XDO A;  4C3Y A;  2K3V A;  3AWI A;  4H4V A;  1FS8 A;  3PVC A;  4PAA A;  1DNC A;  4ECH A;  3DK4 A;  4USR A;  1JEH A;  1ZMC A;  2R0P A;  3CN8 A;  2YVG A;  4AOX A;  4K2X A;  3CNP A;  3AXB A;  1LV0 A;  3DH9 A;  5KMQ A;  4MJW A;  3TTB A;  3CNS A;  4ICY A;  5FS7 A;  3UTH A;  2HQM A;  4BV6 A;  5KMP A;  2RDZ A;  1M1R A;  5KMR A;  3D1C A;  4X9M A;  5FS9 A;  2YLX A;  3UOX A;  1DOD A;  2WES A;  2RGO A;  4EM3 A;  4EIQ A;  4D03 A;  2BK3 A;  1NPX A;  1D5T A;  2IVE A;  2V5Z A;  4K8D A;  4B1B A;  1KNP A;  4CY8 A;  2C67 A;  1N1P A;  2OAL A;  3L1R A;  2YLT A;  3E1T A;  4D04 A;  4YT0 A;  2V61 A;  1RSG A;  2EQ6 A;  3NK1 X;  3FMW A;  2A8X A;  3AYJ A;  4UP3 A;  2Q0L A;  4U8P A;  2WS3 A;  1PBE A;  3AYI A;  1ZX9 A;  3VRA A;  2QA2 A;  1GEU A;  1FOH A;  4G73 A;  5C2T A;  1E1L A;  1MXT A;  3Q9T A;  3M0O A;  5L46 A;  4Y4N A;  2RAB A;  3LXD A;  2YG4 A;  3UP5 A;  3CTY A;  2J3N A;  3SX6 A;  3P4P A;  5KRQ A;  1FT6 A;  1E39 A;  2AQJ A;  4B65 A;  3CNT A;  1GXF A;  1H7X A;  2DKH A;  2O9Z A;  2H89 A;  3ATQ A;  2V3A A;  3AE6 A;  4A6N B;  4YSH A;  1DOC A;  3VR8 A;  3GD4 A;  3T2Z A;  4H4S A;  3CND A;  2R9Z A;  3NG7 X;  1H7W A;  2C3C A;  2BCP A;  3RP6 A;  3UTG A;  5C3J A;  1H81 A;  3UOZ A;  1PXC A;  3BI2 A;  4YWO A;  5JCK A;  1CC4 A;  1PHH A;  2BRA A;  2Y6R A;  3P9U A;  4U8N A;  2YR4 A;  1VQW A;  1KF6 A;  3GMB A;  2X99 A;  1E6E A;  4KPR A;  4GAP A;  2I0Z A;  4IA5 A;  2BRY A;  2GR0 A;  4OPG A;  3NYC A;  1H82 A;  3LG1 A;  1XPQ A;  3QSS A;  4LU6 A;  1YKJ A;  2GH5 A;  5DBJ A;  2GMJ A;  3ZYX A;  1AOG A;  2YAU A;  2IVD A;  3F29 A;  1GRB A;  1NAA A;  2XVI A;  3NHO X;  3DA1 A;  4GDP A;  2GF3 A;  1GES A;  4AP1 A;  1CHU A;  2CFY A;  1SP3 A;  4REK A;  4DSH A;  1UKV G;  1EL7 A;  2OAM A;  4JY2 A;  3UKP A;  3LZW A;  2CVJ A;  1KDG A;  3F8D A;  1ZDL A;  3DJE A;  2OLN A;  1QLB A;  2TMD A;  3ALM A;  3AB1 A;  1VRQ B;  1JRY A;  2ARD A;  2C70 A;  2VR0 A;  3S7W A;  3AE3 A;  1K0I A;  2A87 A;  3T31 A;  3KKJ A;  3AE5 A;  3GDN A;  1F6M A;  3AD8 B;  3G5R A;  1L9E A;  2JK6 A;  3SYI A;  4NZH A;  3AE2 A;  2BYB A;  2R0C A;  3CIR A;  3BI5 A;  3NIX A;  3QJ4 A;  1H84 A;  4NNJ A;  2C7G A;  4JNQ A;  4DGK A;  4H4Y A;  3GWF A;  3UOV A;  4EQW A;  2XLS A;  4Z2U A;  2R4E A;  4CCQ A;  4XWZ A;  3SFE A;  2OT4 A;  1IUS A;  1W4X A;  2RGH A;  4FK1 A;  3BNG A;  2YG6 A;  1L0V A;  1Q9I A;  5ER0 A;  5U63 A;  2WDV A;  4OVI A;  3C96 A;  5HXI A;  2GVC A;  5JCI A;  1ONF A;  5EB4 A;  1CJ3 A;  3ICT A;  3O0H A;  1M64 A;  1PBB A;  1ZY8 A;  2YWL A;  3V3O A;  4A5L A;  3AE7 A;  1CJ4 A;  3RP8 A;  4Z25 A;  3SM8 A;  1ELI A;  4GDE A;  1QJD A;  1KSU A;  1NEN A;  2C76 A;  3K7T A;  1MOK A;  2GR2 A;  2VZ2 A;  4Z44 A;  2DKI A;  2QAE A;  1XAN A;  1LQU A;  4ZCC A;  1NEK A;  4GAV A;  3LJP A;  4Z43 A;  4Z24 A;  2WQY A;  3LGQ A;  2BK4 A;  2XLU A;  3GRS A;  1O95 A;  1NHS A;  1REO A;  3LAD A;  3P4S A;  1KFY A;  3AE1 A;  4TM4 A;  2VVM A;  1CF3 A;  2WP5 A;  2XFN A;  3II4 A;  2EQ8 A;  3UU9 A;  3C4A A;  2GQF A;  2NPX A;  4J36 A;  2VOU A;  4CRT A;  3TOR A;  1ZOV A;  3UKA A;  2BXR A;  5EBK A;  5HYM A;  4APN A;  4U2S A;  2WPC A;  2X8G A;  3SZC A;  2GR3 A;  4Q5B A;  2W0H A;  4AT0 A;  1LQT A;  1BKW A;  3DK8 A;  2NVK X;  5FS8 A; 
#chains in the Genus database with same CATH homology
 2WU2 A;  4AP3 A;  4B69 A;  4WJY A;  4I59 A;  4L3Z A;  3NYF A;  1GRF A;  5BRT A;  3BNU A;  1F8S A;  3DME A;  2AR8 A;  3ZDN A;  2R0G A;  5KVH A;  3SZF A;  1PS9 A;  2XLR A;  4UDP A;  3BNH A;  3CGB A;  3BNM A;  3AEC A;  2YLZ A;  1TDK A;  3FPZ A;  4NEW A;  3UTF A;  4JN9 A;  3BI4 A;  3AE9 A;  1BGN A;  1FEC A;  3SXI A;  5M10 A;  4TM1 A;  2XFP A;  2FJE A;  4WCT A;  3SFD A;  4L3X A;  4A9W A;  4JQ9 A;  4YKG A;  3PO7 A;  5JCL A;  4H4P A;  4A65 A;  3SCE A;  3ALL A;  1RYI A;  2C4C A;  2XYO A;  3I6D A;  4FX9 A;  4N9X A;  4C3X A;  5KMS A;  3ISH A;  3D8X A;  4H4R A;  3T2Y A;  1NHR A;  4E0V A;  2F5Z A;  4IA6 A;  2GQW A;  4YTN A;  3KD9 A;  4HA6 A;  3UBR A;  3RHA A;  4B64 A;  1L9D A;  1Y56 B;  2FJB A;  1GPE A;  3QVP A;  4Z26 A;  3SZW A;  2YG7 A;  3EF6 A;  2QCU A;  3QSE A;  2C73 A;  3RKH A;  1GAL A;  3K7Q X;  4H2R A;  1E1K A;  3NH3 X;  1F8W A;  1PBF A;  4XXG A;  4K5R A;  4EMJ A;  2BCG G;  2YLS A;  4G6H A;  4C77 A;  3UKF A;  4BUR A;  4CNJ A;  4PAB A;  5IQ1 A;  2Z5X A;  2WPE A;  2YQU A;  2V60 A;  4CBQ A;  4H4Z A;  2VVL A;  4U8L A;  2JB1 A;  2FJD A;  1JOA A;  4EQX A;  1Q1R A;  4JY3 A;  2X50 A;  1GND A;  3H8I A;  3AEB A;  4H2N A;  3SY4 A;  5BUL A;  2C64 A;  3AEA A;  4CNK A;  3T0K A;  4EQS A;  3ABV A;  2Q7V A;  2FBW A;  4YSX A;  4GR1 A;  4AOS A;  2JKC A;  4ZN0 A;  4U8O A;  2OLO A;  3Q6J A;  2TPR A;  4YTM A;  3NKS A;  2GAG B;  2XCG A;  3NN0 X;  4IVM B;  3SZ0 A;  3DJD A;  5KOW A;  1Y56 A;  2R4J A;  1LTX R;  2BA9 A;  3FIM B;  1PXB A;  1NG3 A;  3AEG A;  1PBD A;  1JU2 A;  2BS2 A;  4G6G A;  5TR3 A;  2CDU A;  3UTE A;  2XFU A;  3FG2 P;  4B67 A;  1LPF A;  1O94 A;  5KNL A;  1S3E A;  3RNM A;  1MO9 A;  1VG9 A;  2BK5 A;  5BUK A;  5KXJ A;  4LII A;  1OJ9 A;  4FDC B;  4I58 A;  4G9K A;  4EIP A;  3QFB A;  2H88 A;  3QFA A;  4C74 A;  1M6I A;  5IPY A;  2EQ7 A;  4J34 A;  3LOV A;  5GRT A;  4AT2 A;  1VG0 A;  3NRN A;  5HHF A;  4H7U A;  1PBC A;  3S61 A;  3L1T A;  3URH A;  2JB2 A;  5KOX A;  1OAH A;  3BNF A;  4Q5C A;  1IUV A;  1K4Q A;  1O5W A;  2UZZ A;  2YVF A;  3AEF A;  4GUV A;  1H86 A;  3L8K A;  5J7X A;  3VQR A;  4A79 A;  1IUT A;  4J33 A;  1GV4 A;  4YTP A;  2YM2 A;  1XHC A;  1GRT A;  1COY A;  2YM1 A;  4JDR A;  1TDN A;  2XVJ A;  3CMM A;  4HB9 A;  4A6N A;  1CC6 A;  1PXA A;  4BK3 A;  3ICR A;  1IUX A;  3K7M X;  1OJT A;  2XLP A;  3NK2 X;  4Z2R A;  4TM0 A;  2APG A;  5U1O A;  4U2T A;  1Y0P A;  4EM4 A;  5HY5 A;  2C3D A;  2WET A;  3H8L A;  2YG5 A;  1JNZ A;  2WOW A;  3QSM A;  4EMW A;  3KA7 A;  4XWR A;  3ADA B;  2VRL A;  4OCG A;  1QO8 A;  4EMI A;  2WHD A;  1FS9 A;  1YY5 A;  4OPL A;  3NGC X;  1D7L A;  3I3L A;  3LZX A;  3M13 A;  3V3N A;  1YQ3 A;  1BGJ A;  2OA1 A;  2YR6 A;  5FS6 A;  2ZBW A;  1GT8 A;  3DJJ A;  1JRZ A;  1TYP A;  4JNA A;  4U8K A;  1ZMD A;  2BC0 A;  2WEU A;  4A99 A;  4OPU A;  1LVL A;  4J2W A;  2CUL A;  2WP9 A;  4B66 A;  1CC2 A;  2XFO A;  4L3Y A;  4II3 A;  1TYT A;  2YLR A;  1FCD A;  3DGZ A;  3EAN A;  3DK9 A;  2JAE A;  3IHG A;  1M1P A;  1PJ7 A;  3KPF A;  1H6V A;  3KU9 A;  2ZZ0 A;  2JB3 A;  3UCL A;  3IHM A;  3GRT A;  3NYE A;  4X4J A;  1PJ5 A;  1DOB A;  2VQB A;  3F8R A;  3GDP A;  3C4N A;  3KPK A;  3UKH A;  3ICS A;  1FS7 A;  2RF7 A;  3SQP A;  1IUW A;  5FMH A;  2EQ9 A;  1TDO A;  3IWA A;  1P2H A;  2BAC A;  1NG4 A;  2YR5 A;  2GV8 A;  1GRH A;  2JBV A;  4H4Q A;  1B4V A;  4BJZ A;  1TDF A;  3AE4 A;  4RG4 A;  1S3B A;  2BS3 A;  1BWC A;  3OZ2 A;  1ZK7 A;  1LJ1 A;  1NHP A;  2A89 A;  1SEZ A;  3IC9 A;  3V76 A;  4RSL A;  1OJC A;  4NTE A;  1PN0 A;  3M12 A;  3CPH G;  4O5U A;  3SXQ A;  4Q0T A;  4Q1O A;  3P4Q A;  1TRB A;  1IUU A;  3H4K A;  1F3P A;  3CGC A;  3P4R A;  1ZP0 A;  3ATR A;  4NTD A;  3WE0 A;  4H4U A;  3DGH A;  4NEV A;  4K22 A;  2YLW A;  1H83 A;  3BHK A;  2XVF A;  4K5S A;  1CL0 A;  1PDH A;  1TDE A;  2WPF A;  3NTA A;  4H4T A;  4Z2T A;  2GB0 A;  2XVE A;  3D1I A;  3EAO A;  1KSS A;  2WOI A;  1DXL A;  2WDR A;  3CPJ G;  4IVO B;  4ZCD A;  3OWM A;  4OPD A;  2C66 A;  2FJA A;  4BK1 A;  4Y4L A;  4WX1 A;  1E1M A;  1K0L A;  3UP4 A;  3NLC A;  1F8R A;  1GOS A;  1V59 A;  2XLT A;  1Q1W A;  3AD7 B;  2ZZB A;  1GRA A;  2C75 A;  1D4C A;  2Y6Q A;  2B7R A;  2VRM A;  4UDR A;  2WBA A;  3GSI A;  4ADW A;  1GET A;  2X8H A;  4LA1 A;  3JSK A;  3NT6 A;  1NDA A;  4YXD A;  1QDB A;  2WU5 A;  3B3R A;  3VR9 A;  3FO3 A;  3KLJ A;  1K0J A;  1EL8 A;  3AYL A;  2Q6U A;  3HYV A;  4J31 A;  3UOY A;  3SGL A;  2R46 A;  4OPC A;  1Z6L A;  2GAH B;  1EL5 A;  1L9C A;  3MMO A;  1EL9 A;  2B76 A;  4OPI A;  5JCN A;  2YVJ A;  1IJH A;  2WDQ A;  1BF3 A;  3CPI G;  2C72 A;  1S2Q A;  5U25 A;  3ITJ A;  5CQF A;  2YG3 A;  4U8I A;  4B68 A;  4H2P A;  2ZO5 A;  3GD3 A;  4YKF A;  4BK2 A;  1PJ6 A;  1GRE A;  2E5V A;  4Q17 A;  5M0Z A;  4J57 A;  4A7A A;  2B9Y A;  1E1N A;  2RGJ A;  1CBO A;  2J7A A;  3AD9 B;  2VQ7 A;  3CGD A;  1FT5 A;  4Y4M A;  3UKL A;  4H4W A;  3G5Q A;  2GEW A;  1FL2 A;  2QA1 A;  4GCM A;  3UKK A;  3RED A;  1VDC A;  3GYI A;  4CCR A;  4GF7 A;  3HZL A;  4KX6 A;  3R9U A;  5EB5 A;  2BXS A;  1M1Q A;  1FEB A;  1GTH A;  3P1W A;  1GER A;  5JCM A;  2GR1 A;  1BVB A;  1CJC A;  3G5S A;  1YQZ A;  4TLX A;  4M52 A;  2V3B A;  4YSZ A;  1GU6 A;  1E7P A;  3HYX A;  5LV9 A;  4NWZ A;  3K30 A;  4TLZ A;  4TM3 A;  1N4W A;  5KWF A;  1JNR A;  1KNR A;  1RP0 A;  3NNE A;  4IV9 A;  4YSY A;  2GMH A;  1BZL A;  1OJA A;  3GM6 A;  3AEE A;  3S5W A;  1S2Y A;  1NHQ A;  5J60 A;  2GRT A;  2ZZC A;  3HYW A;  3FBS A;  2Q0K A;  2E1M A;  4U8M A;  1D4D A;  1DJN A;  2XVH A;  3AED A;  4G74 A;  4RG3 A;  2ACZ A;  4H4X A;  2E81 A;  3LB8 A;  5CKU A;  2WOV A;  3COX A;  2C65 A;  5GSN A;  1N4U A;  4L38 A;  5EOW A;  3VRD B;  1B8S A;  5BVA A;  3IF9 A;  2BS4 A;  2Z5Y A;  4UDQ A;  3UKQ A;  1B37 A;  1GTE A;  1CJ2 A;  3B6D A;  3GYJ A;  2BAB A;  2LFC A;  3CNJ A;  2R45 A;  1OJD A;  2VVL G;  4GRT A;  1DJQ A;  3QVR A;  3T14 A;  1JRX A;  2AAQ A;  3CGE A;  1ZKQ A;  1X31 B;  2WP6 A;  4BJY A;  4Q4U A;  3T2K A;  4B63 A;  4DNA A;  2B9X A;  4P9S A;  4II2 A;  2X8C A;  5IQ4 A;  3NK0 X;  2B9W A;  3GWD A;  3GYX A;  4FK1 C;  4NTC A;  2BC1 A;  5KVI A;  1HYU A;  3DJG X;  1JNI A;  4U2L A;  1D7Y A;  1EBD A;  3BNJ A;  4O5Q A;  3ALJ A;  3NTD A;  1FEA A;  2B7S A;  3EPT A;  4OPT A;  4CY6 A;  4DSG A;  3AE8 A;  3KVE A;  4U8J A;  2IID A;  1D4E A;  2E80 A;  1GRG A;  2PHH A;  4H2Q A;  1N4V A;  3NN6 X;  2XFQ A;  4J56 A;  2PYX A;  2V6O A;  3RP7 A;  1XDI A;  4K7Z A;  1YQ4 A;  3PS9 A;  3BHF A;  3T37 A;  1P2E A;  2E4G A;  4C5O A;  4EQR A;  4USQ A;  1B5Q A;  1DOE A;  2X3N A;  3F8P A;  3GMC A;  3OC4 A;  4H50 A;  4X9N A;  1GSN A;  1ZOY A;  3VRB A;  2XDO A;  4C3Y A;  2K3V A;  3AWI A;  4H4V A;  1FS8 A;  3PVC A;  4PAA A;  1DNC A;  4ECH A;  3DK4 A;  4USR A;  1JEH A;  1ZMC A;  2R0P A;  3CN8 A;  2YVG A;  4AOX A;  4K2X A;  3CNP A;  3AXB A;  1LV0 A;  3DH9 A;  5KMQ A;  4MJW A;  3TTB A;  3CNS A;  4ICY A;  5FS7 A;  3UTH A;  2HQM A;  4BV6 A;  5KMP A;  2RDZ A;  1M1R A;  5KMR A;  3D1C A;  4X9M A;  5FS9 A;  2YLX A;  3UOX A;  1DOD A;  2WES A;  2RGO A;  4EM3 A;  4EIQ A;  4D03 A;  2BK3 A;  1NPX A;  1D5T A;  2IVE A;  2V5Z A;  4K8D A;  4B1B A;  1KNP A;  4CY8 A;  2C67 A;  1N1P A;  2OAL A;  3L1R A;  2YLT A;  3E1T A;  4D04 A;  4YT0 A;  2V61 A;  1RSG A;  2EQ6 A;  3NK1 X;  3FMW A;  2A8X A;  3AYJ A;  4UP3 A;  2Q0L A;  4U8P A;  2WS3 A;  1PBE A;  3AYI A;  1ZX9 A;  3VRA A;  2QA2 A;  1GEU A;  1FOH A;  4G73 A;  5C2T A;  1E1L A;  1MXT A;  3Q9T A;  3M0O A;  5L46 A;  4Y4N A;  2RAB A;  3LXD A;  2YG4 A;  3UP5 A;  3CTY A;  2J3N A;  3SX6 A;  3P4P A;  5KRQ A;  1FT6 A;  1E39 A;  2AQJ A;  4B65 A;  3CNT A;  1GXF A;  1H7X A;  2DKH A;  2O9Z A;  2H89 A;  3ATQ A;  2V3A A;  3AE6 A;  4A6N B;  4YSH A;  1DOC A;  3VR8 A;  3GD4 A;  3T2Z A;  4H4S A;  3CND A;  2R9Z A;  3NG7 X;  1H7W A;  2C3C A;  2BCP A;  3RP6 A;  3UTG A;  5C3J A;  1H81 A;  3UOZ A;  1PXC A;  3BI2 A;  4YWO A;  5JCK A;  1CC4 A;  1PHH A;  2BRA A;  2Y6R A;  3P9U A;  4U8N A;  2YR4 A;  1VQW A;  1KF6 A;  3GMB A;  2X99 A;  1E6E A;  4KPR A;  4GAP A;  2I0Z A;  4IA5 A;  2BRY A;  2GR0 A;  4OPG A;  3NYC A;  1H82 A;  3LG1 A;  1XPQ A;  3QSS A;  4LU6 A;  1YKJ A;  2GH5 A;  5DBJ A;  2GMJ A;  3ZYX A;  1AOG A;  2YAU A;  2IVD A;  3F29 A;  1GRB A;  1NAA A;  2XVI A;  3NHO X;  3DA1 A;  4GDP A;  2GF3 A;  1GES A;  4AP1 A;  1CHU A;  2CFY A;  1SP3 A;  4REK A;  4DSH A;  1UKV G;  1EL7 A;  2OAM A;  4JY2 A;  3UKP A;  3LZW A;  2CVJ A;  1KDG A;  3F8D A;  1ZDL A;  3DJE A;  2OLN A;  1QLB A;  2TMD A;  3ALM A;  3AB1 A;  1VRQ B;  1JRY A;  2ARD A;  2C70 A;  2VR0 A;  3S7W A;  3AE3 A;  1K0I A;  2A87 A;  3T31 A;  3KKJ A;  3AE5 A;  3GDN A;  1F6M A;  3AD8 B;  3G5R A;  1L9E A;  2JK6 A;  3SYI A;  4NZH A;  3AE2 A;  2BYB A;  2R0C A;  3CIR A;  3BI5 A;  3NIX A;  3QJ4 A;  1H84 A;  4NNJ A;  2C7G A;  4JNQ A;  4DGK A;  4H4Y A;  3GWF A;  3UOV A;  4EQW A;  2XLS A;  4Z2U A;  2R4E A;  4CCQ A;  4XWZ A;  3SFE A;  2OT4 A;  1IUS A;  1W4X A;  2RGH A;  4FK1 A;  3BNG A;  2YG6 A;  1L0V A;  1Q9I A;  5ER0 A;  5U63 A;  2WDV A;  4OVI A;  3C96 A;  5HXI A;  2GVC A;  5JCI A;  1ONF A;  5EB4 A;  1CJ3 A;  3ICT A;  3O0H A;  1M64 A;  1PBB A;  1ZY8 A;  2YWL A;  3V3O A;  4A5L A;  3AE7 A;  1CJ4 A;  3RP8 A;  4Z25 A;  3SM8 A;  1ELI A;  4GDE A;  1QJD A;  1KSU A;  1NEN A;  2C76 A;  3K7T A;  1MOK A;  2GR2 A;  2VZ2 A;  4Z44 A;  2DKI A;  2QAE A;  1XAN A;  1LQU A;  4ZCC A;  1NEK A;  4GAV A;  3LJP A;  4Z43 A;  4Z24 A;  2WQY A;  3LGQ A;  2BK4 A;  2XLU A;  3GRS A;  1O95 A;  1NHS A;  1REO A;  3LAD A;  3P4S A;  1KFY A;  3AE1 A;  4TM4 A;  2VVM A;  1CF3 A;  2WP5 A;  2XFN A;  3II4 A;  2EQ8 A;  3UU9 A;  3C4A A;  2GQF A;  2NPX A;  4J36 A;  2VOU A;  4CRT A;  3TOR A;  1ZOV A;  3UKA A;  2BXR A;  5EBK A;  5HYM A;  4APN A;  4U2S A;  2WPC A;  2X8G A;  3SZC A;  2GR3 A;  4Q5B A;  2W0H A;  4AT0 A;  1LQT A;  1BKW A;  3DK8 A;  2NVK X;  5FS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...