1JRYA

Crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTKDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C
publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jryA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jryA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jryA01
3AXBA 4ICYA 2RGOA 3RHAA 2WOWA 2PYXA 3ISHA 4H2NA 1DNCA 2A89A 1UKVG 1ZDLA 3MMOA 3UTHA 3CPHG 4FK1C 1YQ4A 3UOZA 3UTEA 1FEAA 3ZDNA 3RP6A 1OJTA 1ZY8A 1M64A 4K5SA 4RG3A 5C3JA 3AE2A 3QSMA 3ITJA 3NTAA 2GQFA 2YLZA 3TTBA 2J7AA 1SEZA 1KSSA 3AYJA 4A7AA 3B6DA 3GRTA 3K7MX 1X31B 4B64A 2WU5A 2NVKX 5J7XA 2LFCA 2H88A 5IQ4A 1E7PA 2B9WA 3AE7A 4GUVA 1FOHA 2WESA 3UTGA 2NPXA 3AE5A 2GR1A 2TPRA 1K0JA 3II4A 4XWRA 1PJ7A 1PJ5A 4HA6A 4L3YA 1PHHA 4B1BA 1TDFA 4USQA 3CNSA 4C3YA 3NKSA 5FS7A 5U1OA 1H7XA 3AE1A 3I6DA 2FJEA 1Q1WA 1VG9A 2GV8A 1YQZA 1Z6LA 5BULA 3GWFA 2YR5A 2GAGB 1RYIA 4WCTA 2VVLG 3CNTA 1Y56B 3DGZA 1NG3A 2R4EA 1Y56A 4BK1A 5DBJA 2E4GA 4AOSA 1B4VA 2BA9A 2VRLA 4H4RA 3DK8A 2F5ZA 1H7WA 4UDPA 3C4AA 4XWZA 2X8HA 3AYIA 3ICRA 5BUKA 2VQ7A 1AOGA 1GNDA 1GEUA 2E1MA 3IHGA 3BNHA 1B37A 1ZK7A 1KSUA 4TLZA 3OZ2A 2GMHA 5LV9A 3SFDA 3AEEA 2YVGA 2OLOA 2ZZCA 3EAOA 3NRNA 3DJGX 4NEVA 4APNA 4YXDA 4FDCB 1Y0PA 3AE4A 5J60A 1CC2A 2BXRA 3ATRA 1E1KA 2EQ9A 3UKQA 2EQ6A 3B3RA 1XPQA 2XLTA 3AEBA 2O9ZA 3EF6A 1JNZA 2OA1A 4ZCCA 2AQJA 1BGJA 4K7ZA 1VQWA 2EQ7A 4A65A 1PS9A 5JCNA 1GERA 1FT5A 2RGHA 3G5RA 2Y6RA 5BRTA 1M1PA 1GSNA 3FO3A 3AE9A 3LOVA 4K5RA 4USRA 1H81A 3H8IA 2XFNA 4YSYA 4CY6A 1O94A 3DA1A 2WBAA 2C73A 1P2HA 3AD7B 2B7RA 2WQYA 4A79A 1L9CA 3NGCX 1L0VA 1F3PA 4GR1A 3ALMA 3NYCA 5IPYA 3UOXA 3DK4A 3RNMA 2BACA 1QJDA 3LG1A 3AD8B 2B9YA 3KKJA 1FS9A 3PVCA 5KVHA 3NIXA 4KPRA 3SM8A 2JKCA 3KA7A 1GRHA 3VRDB 1B5QA 4ECHA 1CHUA 4H4PA 5M0ZA 1E1LA 1GRBA 1PBDA 2CULA 2WDVA 5EBKA 3SCEA 2YWLA 1H84A 4Z2RA 1W4XA 4J36A 4EQXA 2CFYA 3UKKA 2WU2A 4IA5A 4EM3A 3PS9A 2C66A 4JDRA 3OWMA 5JCMA 3RP7A 2ZO5A 2GB0A 2PHHA 2WDRA 2X99A 1DOCA 1IUSA 3GD3A 4IVMB 1K0LA 1CF3A 4CRTA 4D04A 5KWFA 4C3XA 2Q0KA 3GDPA 1D7YA 1DXLA 3BNMA 4L3ZA 2V3AA 4H4WA 3NHOX 2BYBA 3NYFA 2XFQA 4DNAA 2VVMA 3D1IA 1K0IA 1D5TA 2R0CA 4U2LA 5JCLA 2BS3A 5CKUA 1KNRA 1PBEA 1KFYA 3QSEA 1JU2A 4TM0A 3CGEA 4GF7A 4O5QA 2WP6A 3AEGA 4REKA 4U8OA 3NT6A 1D4DA 1PJ6A 2QAEA 3K7TA 3VQRA 2YLWA 4NTEA 2IIDA 1GESA 3NH3X 2YLRA 1OJCA 1OJ9A 3VRAA 4TM1A 1MO9A 2R45A 1LVLA 2BC0A 2WP9A 1LTXR 1QLBA 3QVPA 1JRZA 5EB5A 2FBWA 3CPJG 2E81A 2WS3A 1VDCA 2YG4A 3IF9A 4H4UA 2XFOA 4H7UA 4EIQA 1OJDA 1JRYA 5KRQA 1TYTA 3NLCA 4BK2A 4BJZA 1ONFA 4OPIA 3S61A 5JCIA 4Z2TA 2EQ8A 3V76A 2R0PA 1GALA 3LZXA 2C70A 2WPEA 2XDOA 3UKAA 3G5SA 1ZOVA 2JB3A 3CGCA 3P9UA 1P2EA 3C96A 2ACZA 4EMWA 1E1MA 2BXSA 2XVEA 3UKHA 1S2YA 3Q6JA 2OAMA 4L3XA 1DOEA 2C3DA 4M52A 2BK4A 2XVHA 3FG2P 2GF3A 3H4KA 3E1TA 5L46A 1REOA 3ABVA 4FX9A 1LQUA 1SP3A 3CIRA 1D4CA 1N4WA 3M12A 4H4ZA 4JNAA 4Y4MA 3VRBA 2Z5YA 2V3BA 2XVIA 1H83A 4IA6A 4YSXA 4J2WA 4AT2A 3GM6A 3AD9B 4UP3A 4K22A 1L9EA 1FECA 2WDQA 4A6NB 3QJ4A 4JN9A 4A6NA 1YY5A 4J31A 2RF7A 2WEUA 4JY3A 4A9WA 4BK3A 2VOUA 4H2RA 1OJAA 4Y4NA 4B67A 4C77A 1RP0A 4FK1A 4C5OA 3CTYA 5TR3A 4LA1A 1BZLA 3FMWA 1CC6A 3UU9A 4GDPA 3GMBA 2RABA 2QCUA 4YSZA 4ZN0A 2GVCA 4OPDA 3NYEA 4D03A 2BCPA 3DK9A 2C7GA 2J3NA 2GR0A 2R9ZA 3S5WA 4B68A 1V59A 5BVAA 4OPUA 1PXAA 3ALJA 1GRAA 4AOXA 3UTFA 1BWCA 1JRXA 3NK2X 4CNKA 3GD4A 1NDAA 3BI2A 3IHMA 3GDNA 3KPFA 2YAUA 4Z24A 4JY2A 5FS6A 3AEAA 1O95A 4YT0A 4TLXA 4B69A 3L1TA 2JBVA 2C64A 4Q5BA 1TYPA 1TDOA 2VQBA 4Y4LA 3UP4A 1GTEA 3AB1A 2YG6A 4RG4A 4EQSA 4J57A 4Z43A 4H4SA 2XLPA 1N1PA 1IUUA 3BI5A 3UKLA 4Q5CA 4U8IA 4I58A 2YQUA 4YTMA 4C74A 5KXJA 4H4QA 1IJHA 1YQ3A 2YG5A 2XLRA 3NG7X 1BF3A 4AP3A 3RKHA 5HXIA 3P1WA 2X8GA 1D7LA 4OPTA 3HZLA 4OPLA 4BV6A 4IV9A 4DSHA 3LB8A 4YKGA 5U25A 3H8LA 2WPCA 3OC4A 3Q9TA 2R4JA 2V6OA 1TDNA 3ADAB 4U2TA 3SGLA 4J33A 4MJWA 4TM3A 1FT6A 1NHQA 3WE0A 1NEKA 2GEWA 1PDHA 2GQWA 2Q0LA 3AEFA 1BGNA 3COXA 1NPXA 4JNQA 1H6VA 4J34A 4KX6A 3CGBA 3NK1X 5HHFA 2BS2A 1DOBA 3PO7A 1VG0A 4H2PA 1N4UA 1F8WA 1LPFA 4CCRA 1CJ2A 1GETA 2DKHA 3LJPA 4H4YA 3TORA 3AWIA 4CY8A 1F6MA 3BNGA 2AR8A 5KVIA 3NN6X 1S3BA 2BK5A 2C67A 3KVEA 3QFAA 4YKFA 3EPTA 4U8JA 2I0ZA 3CNDA 5ER0A 3K30A 2W0HA 2VRMA 1NENA 4OPGA 5C2TA 2BABA 4H4VA 4X9NA 1DODA 3LGQA 2C65A 4LU6A 2OALA 4AT0A 4Z26A 1PN0A 2BCGG 2B76A 3ICTA 3LXDA 1LQTA 4CBQA 1QDBA 3AE3A 3SFEA 2YLXA 4OCGA 4AP1A 1M1RA 1JEHA 2XCGA 1Q1RA 2B9XA 2XFUA 1H82A 1KDGA 4YTNA 2VR0A 4U8KA 3F29A 1EBDA 3BI4A 3JSKA 1CC4A 3BNFA 3CNJA 5EB4A 4Q0TA 3F8RA 2WOVA 4WJYA 3D1CA 3V3NA 3C4NA 3FPZA 4OVIA 2JB1A 3P4RA 5JCKA 4JQ9A 4NTDA 1GPEA 2YLTA 1E6EA 4CCQA 4J56A 1JOAA 1CJ3A 4PABA 3AYLA 2RDZA 3P4SA 4BJYA 1IUTA 3GMCA 3IWAA 2CVJA 3IC9A 1NHSA 2JAEA 2XFPA 1BKWA 2Y6QA 4I59A 2C76A 4EQRA 3DMEA 3P4QA 1PBCA 3AECA 4B66A 3FBSA 3NNEA 2APGA 1CBOA 2B7SA 2BC1A 2YG3A 1GRFA 3BHFA 2E80A 2E5VA 2QA1A 2YM1A 3BNJA 4Q4UA 4LIIA 2OLNA 3F8PA 2DKIA 3GWDA 4N9XA 3URHA 4BURA 1GTHA 1E1NA 3GRSA 4XXGA 1ZMCA 5FMHA 4TM4A 4DSGA 2FJAA 3UOVA 3AEDA 4PAAA 3ZYXA 3QSSA 1LJ1A 2ZBWA 4EMJA 3GYXA 1TDEA 3LZWA 4X9MA 4K2XA 2GR3A 2AAQA 3R9UA 1NHPA 3T37A 3DH9A 4NEWA 2FJDA 2Q6UA 1JNIA 5CQFA 4B63A 1N4VA 2K3VA 1GRTA 4Q1OA 3I3LA 2H89A 2ZZ0A 1BVBA 1XANA 3O0HA 1FS7A 3P4PA 1CL0A 1FL2A 1ZX9A 4U8NA 3GYIA 4K8DA 1IUWA 1GREA 1IUXA 1Q9IA 1PBBA 4EIPA 3D8XA 1FEBA 1NHRA 2GAHB 2RGJA 3F8DA 1IUVA 5KOXA 5M10A 2GH5A 4U8MA 1H86A 2YG7A 1GOSA 2GRTA 3CGDA 1COYA 3REDA 1GXFA 3UBRA 4YSHA 1MXTA 3M13A 2TMDA 3ATQA 3RP8A 1KNPA 1XDIA 2XVFA 4EQWA 1KF6A 4ZCDA 2JB2A 5IQ1A 4Z44A 4RSLA 4Z2UA 4GRTA 2VZ2A 2ARDA 2V61A 1D4EA 1M1QA 1LV0A 2YVFA 1DJQA 2X50A 2JK6A 4L38A 2BS4A 2V5ZA 3QVRA 4GCMA 5GRTA 1ZKQA 3DGHA 2BK3A 1GT8A 1EL9A 2R0GA 2X8CA 2HQMA 4U8LA 2WETA 2XLSA 1B8SA 1RSGA 1GU6A 2Q7VA 1L9DA 4H2QA 2IVDA 4NZHA 4X4JA 5GSNA 3NK0X 3UOYA 3FIMB 1XHCA 3GYJA 3VR9A 4UDRA 2Z5XA 3UP5A 4B65A 2WHDA 2FJBA 2ZZBA 3AE6A 4A99A 1S2QA 1K4QA 1E39A 4WX1A 4DGKA 4UDQA 2YR6A 2YR4A 3LADA 4NTCA 3CN8A 5FS9A 2V60A 4IVOB 1FS8A 5FS8A 4ADWA 3UKPA 1FCDA 2A8XA 3M0OA 4HB9A 4EMIA 5HY5A 4Q17A 2YLSA 3KD9A 3NTDA 2C75A 1PXCA 1VRQB 1M6IA 3L1RA 4YTPA 1CJ4A 4P9SA 2IVEA 4H50A 2XVJA 4U2SA 3ICSA 2WPFA 2OT4A 1MOKA 1ZP0A 3SXQA 1EL8A 3K7QX 1EL5A 3DJDA 1GV4A 1ZOYA 1F8RA 2A87A 2CDUA 2WOIA 1JNRA 2XYOA 4U8PA 4H4XA 3BNUA 3S7WA 1CJCA 1ZMDA 5U63A 1QO8A 3ALLA 2XLUA 2GMJA 2X3NA 4GDEA 3QFBA 3SQPA 4YWOA 3VR8A 1EL7A 2C3CA 2C72A 5EOWA 2QA2A 4A5LA 3UKFA 1NAAA 3KLJA 3KU9A 1TRBA 3GSIA 4EM4A 3EANA 1GRGA 1PBFA 3DJEA 3CNPA 5HYMA 3G5QA 5KOWA 1PXBA 1F8SA 1HYUA 2YM2A 4O5UA 3UCLA 1NG4A 2R46A 4H4TA 4E0VA 3NN0X 3L8KA 2UZZA 1TDKA 1YKJA 2VVLA 4OPCA 4CNJA 1S3EA 1DJNA 2WP5A 3AE8A 2YVJA 3BHKA 4Z25A 1OAHA 1O5WA 3CPIG 1ELIA 2GR2A 3V3OA 3DJJA
chains in the Genus database with same CATH superfamily
3AXBA 4ICYA 2RGOA 3RHAA 2WOWA 2PYXA 3ISHA 4H2NA 1DNCA 2A89A 1UKVG 1ZDLA 3MMOA 3UTHA 3CPHG 4FK1C 1YQ4A 3T0KA 3UOZA 1FEAA 3UTEA 3RP6A 1OJTA 1ZY8A 1M64A 4K5SA 4RG3A 3ZDNA 5C3JA 3AE2A 3QSMA 3ITJA 3NTAA 2GQFA 2YLZA 3TTBA 2J7AA 1SEZA 1KSSA 3AYJA 4A7AA 3B6DA 3GRTA 3K7MX 1X31B 4B64A 2WU5A 2NVKX 5J7XA 2LFCA 2H88A 5IQ4A 1E7PA 2B9WA 3AE7A 4GUVA 1FOHA 2WESA 3UTGA 2NPXA 3AE5A 2GR1A 2TPRA 1K0JA 3II4A 2C4CA 4XWRA 1PJ7A 1PJ5A 4HA6A 4L3YA 1PHHA 4B1BA 1TDFA 4USQA 3CNSA 4C3YA 3NKSA 4NNJA 5FS7A 1H7XA 5U1OA 3AE1A 3I6DA 2FJEA 1Q1WA 1VG9A 2GV8A 1YQZA 1Z6LA 5BULA 3GWFA 2YR5A 2GAGB 1RYIA 4WCTA 2VVLG 3CNTA 4GAPA 1Y56B 2CZSA 3DGZA 3HYVA 1NG3A 2R4EA 1Y56A 4BK1A 5DBJA 2E4GA 4AOSA 1B4VA 2BA9A 2VRLA 4H4RA 3DK8A 2F5ZA 1H7WA 4UDPA 3C4AA 4XWZA 2X8HA 3AYIA 3ICRA 4G6GA 5BUKA 2VQ7A 1AOGA 1GNDA 1GEUA 2E1MA 3IHGA 3BNHA 1B37A 1ZK7A 1KSUA 4TLZA 3OZ2A 2GMHA 5LV9A 3SFDA 3AEEA 2YVGA 2OLOA 2ZZCA 3EAOA 3NRNA 3DJGX 4NEVA 3SXIA 4APNA 4YXDA 4FDCB 1Y0PA 3AE4A 5J60A 1CC2A 2BXRA 3ATRA 1E1KA 2EQ9A 3UKQA 2EQ6A 3B3RA 1XPQA 2XLTA 3AEBA 2O9ZA 3EF6A 1JNZA 2OA1A 4ZCCA 2AQJA 1BGJA 4K7ZA 1VQWA 2EQ7A 4A65A 1PS9A 5JCNA 1GERA 1FT5A 2RGHA 3G5RA 2Y6RA 5BRTA 1M1PA 1GSNA 3FO3A 3AE9A 3LOVA 4K5RA 4USRA 1H81A 3H8IA 2XFNA 4YSYA 4CY6A 1O94A 3DA1A 2WBAA 2C73A 1P2HA 3AD7B 2B7RA 2WQYA 3HYWA 4A79A 1L9CA 3NGCX 1L0VA 1F3PA 4GR1A 3ALMA 3NYCA 5IPYA 3CMMA 3UOXA 3DK4A 3RNMA 2BACA 1QJDA 3LG1A 3AD8B 2B9YA 3KKJA 1FS9A 3SZFA 3PVCA 5KVHA 3NIXA 4KPRA 3SM8A 2JKCA 3KA7A 1GRHA 3VRDB 1B5QA 4ECHA 1CHUA 4H4PA 5M0ZA 1E1LA 1GRBA 1PBDA 2CULA 2WDVA 5EBKA 3SCEA 2YWLA 1H84A 4Z2RA 1W4XA 4J36A 3SZCA 4EQXA 2CFYA 3UKKA 2WU2A 4IA5A 4EM3A 4II2A 3PS9A 2C66A 4JDRA 3OWMA 5JCMA 3RP7A 2ZO5A 2GB0A 2PHHA 2WDRA 2X99A 1DOCA 1IUSA 3GD3A 4IVMB 1K0LA 1CF3A 4CRTA 4D04A 5KWFA 4C3XA 2Q0KA 3GDPA 1D7YA 1DXLA 3BNMA 4L3ZA 2V3AA 4H4WA 3NHOX 2BYBA 3NYFA 2XFQA 4DNAA 2VVMA 3D1IA 1K0IA 1D5TA 2R0CA 4U2LA 5JCLA 5KMQA 2BS3A 5CKUA 1KNRA 3T14A 1PBEA 1KFYA 3QSEA 1JU2A 4TM0A 3CGEA 4GF7A 4O5QA 2WP6A 3AEGA 4REKA 4U8OA 3NT6A 1D4DA 1PJ6A 2QAEA 3K7TA 3VQRA 2YLWA 4NTEA 2IIDA 1GESA 3NH3X 2YLRA 1OJCA 1OJ9A 3VRAA 4TM1A 1MO9A 2R45A 1LVLA 3SYIA 2BC0A 2WP9A 1LTXR 1QLBA 3QVPA 1JRZA 5EB5A 2FBWA 3CPJG 2E81A 2WS3A 1VDCA 2YG4A 3IF9A 4H4UA 2XFOA 4H7UA 4EIQA 1OJDA 1JRYA 5KRQA 1TYTA 3NLCA 4BK2A 4BJZA 1ONFA 4OPIA 3S61A 3T2YA 5JCIA 4Z2TA 2EQ8A 3V76A 2R0PA 1GALA 3LZXA 2C70A 2WPEA 2XDOA 3UKAA 3G5SA 1ZOVA 2JB3A 3CGCA 3P9UA 1P2EA 3C96A 2ACZA 4EMWA 1E1MA 2BXSA 2XVEA 3SZ0A 3UKHA 1S2YA 3Q6JA 2OAMA 4L3XA 1DOEA 2C3DA 4M52A 2BK4A 2XVHA 3FG2P 2GF3A 4II3A 3H4KA 3E1TA 5L46A 1REOA 3ABVA 4FX9A 1LQUA 1SP3A 3CIRA 1D4CA 1N4WA 3M12A 4H4ZA 4JNAA 4Y4MA 3VRBA 2Z5YA 2V3BA 2XVIA 1H83A 4IA6A 4YSXA 4J2WA 4AT2A 3GM6A 3AD9B 4UP3A 4K22A 1L9EA 1FECA 2WDQA 4A6NB 3QJ4A 4JN9A 4A6NA 1YY5A 4J31A 2RF7A 2WEUA 4JY3A 4A9WA 4BK3A 2VOUA 4H2RA 1OJAA 4Y4NA 4B67A 4C77A 1RP0A 4FK1A 4C5OA 3CTYA 5TR3A 4LA1A 4NWZA 1BZLA 3FMWA 1CC6A 3UU9A 4GDPA 3GMBA 2RABA 2QCUA 4YSZA 4ZN0A 2GVCA 4OPDA 3NYEA 4D03A 2BCPA 3DK9A 2C7GA 2J3NA 2GR0A 2R9ZA 4G74A 3S5WA 1V59A 4B68A 5BVAA 4OPUA 1PXAA 3ALJA 1GRAA 4AOXA 3UTFA 1BWCA 1JRXA 3NK2X 3SZWA 4CNKA 3GD4A 1NDAA 3BI2A 5KMPA 3IHMA 3GDNA 3KPFA 2YAUA 4Z24A 4JY2A 5FS6A 3AEAA 1O95A 4YT0A 4TLXA 4B69A 3L1TA 2JBVA 2C64A 4Q5BA 1TYPA 1TDOA 2VQBA 4Y4LA 3UP4A 1GTEA 3AB1A 2YG6A 4RG4A 4EQSA 4J57A 4Z43A 4H4SA 2XLPA 1N1PA 1IUUA 3BI5A 3UKLA 4Q5CA 4U8IA 4I58A 2YQUA 4YTMA 4C74A 4G73A 5KXJA 4H4QA 1IJHA 1YQ3A 2YG5A 2XLRA 3NG7X 1BF3A 4AP3A 3RKHA 5HXIA 3P1WA 2X8GA 1D7LA 4OPTA 3HZLA 4OPLA 4BV6A 4IV9A 4DSHA 3LB8A 4YKGA 5U25A 3H8LA 2WPCA 3OC4A 3Q9TA 2R4JA 2V6OA 1TDNA 3ADAB 4U2TA 3SGLA 4J33A 4MJWA 4TM3A 1FT6A 1NHQA 3WE0A 1NEKA 2GEWA 1PDHA 2GQWA 2Q0LA 3AEFA 1BGNA 3COXA 1NPXA 4JNQA 1H6VA 4J34A 4KX6A 3CGBA 3NK1X 5HHFA 2BS2A 1DOBA 3PO7A 1VG0A 3SY4A 4H2PA 1N4UA 1F8WA 1LPFA 4CCRA 1CJ2A 1GETA 2DKHA 3LJPA 4H4YA 3TORA 3AWIA 4CY8A 1F6MA 3BNGA 2AR8A 5KVIA 3NN6X 1S3BA 2BK5A 2C67A 3KVEA 3QFAA 4YKFA 3EPTA 4U8JA 2I0ZA 3CNDA 5ER0A 3K30A 2W0HA 2VRMA 1NENA 4OPGA 5C2TA 2BABA 4H4VA 4X9NA 1DODA 3LGQA 2C65A 4LU6A 2OALA 4AT0A 4Z26A 1PN0A 2BCGG 2B76A 3ICTA 3LXDA 1LQTA 4CBQA 1QDBA 3AE3A 3SFEA 2YLXA 4OCGA 4AP1A 1M1RA 1JEHA 2XCGA 1Q1RA 2B9XA 2XFUA 1H82A 1KDGA 4YTNA 2VR0A 4U8KA 3F29A 1EBDA 3BI4A 3JSKA 1CC4A 3BNFA 3CNJA 4G9KA 5EB4A 4Q0TA 3F8RA 3T31A 2WOVA 4WJYA 3D1CA 3V3NA 3C4NA 3SX6A 3FPZA 4OVIA 5KMSA 2JB1A 3P4RA 5JCKA 4JQ9A 4NTDA 1GPEA 2YLTA 1E6EA 4CCQA 4J56A 1JOAA 1CJ3A 4PABA 3AYLA 2RDZA 3P4SA 4BJYA 1IUTA 3GMCA 3IWAA 2CVJA 3IC9A 1NHSA 2JAEA 2XFPA 1BKWA 2Y6QA 4I59A 2C76A 4EQRA 3DMEA 3P4QA 1PBCA 3AECA 4B66A 3FBSA 3NNEA 2APGA 1CBOA 2B7SA 2BC1A 2YG3A 1GRFA 3BHFA 2E80A 2E5VA 2QA1A 2YM1A 3BNJA 4Q4UA 4LIIA 2OLNA 5KNLA 3F8PA 2DKIA 3GWDA 4N9XA 3URHA 4BURA 1GTHA 1E1NA 3GRSA 4XXGA 1ZMCA 5FMHA 4TM4A 4DSGA 2FJAA 3UOVA 3AEDA 4PAAA 3ZYXA 3QSSA 1LJ1A 2ZBWA 4EMJA 3GYXA 1TDEA 3LZWA 4X9MA 4K2XA 2GR3A 2AAQA 3R9UA 1NHPA 3T37A 3DH9A 4NEWA 2FJDA 2Q6UA 1JNIA 5CQFA 4B63A 1N4VA 2K3VA 1GRTA 4Q1OA 3I3LA 2H89A 2ZZ0A 1BVBA 1XANA 3O0HA 1FS7A 3P4PA 1CL0A 1FL2A 1ZX9A 4U8NA 3GYIA 4K8DA 1IUWA 2BRYA 1GREA 1IUXA 1Q9IA 1PBBA 4EIPA 3D8XA 1FEBA 1NHRA 2GAHB 2RGJA 3F8DA 1IUVA 5KOXA 5M10A 2GH5A 4U8MA 1H86A 2YG7A 1GOSA 2GRTA 3CGDA 1COYA 3REDA 1GXFA 3UBRA 4YSHA 1MXTA 3M13A 2TMDA 3ATQA 3RP8A 1KNPA 1XDIA 2XVFA 4EQWA 1KF6A 4ZCDA 2JB2A 5IQ1A 4Z44A 4RSLA 4Z2UA 4GRTA 2VZ2A 2ARDA 2V61A 1D4EA 1M1QA 1LV0A 2YVFA 1DJQA 2X50A 2JK6A 4L38A 2BS4A 2V5ZA 3QVRA 4GCMA 5GRTA 1ZKQA 3DGHA 2BK3A 5KMRA 1GT8A 1EL9A 2R0GA 2X8CA 2HQMA 4U8LA 2WETA 2XLSA 3T2ZA 1B8SA 1RSGA 1GU6A 3T2KA 2Q7VA 1L9DA 4H2QA 2IVDA 4NZHA 4X4JA 5GSNA 3NK0X 3UOYA 3FIMB 1XHCA 3GYJA 3VR9A 4UDRA 2Z5XA 3UP5A 4B65A 2WHDA 2FJBA 2ZZBA 3AE6A 4A99A 1S2QA 1K4QA 1E39A 4WX1A 2BRAA 4DGKA 4UDQA 2YR6A 2YR4A 3LADA 4NTCA 3CN8A 5FS9A 2V60A 4IVOB 1FS8A 5FS8A 4GAVA 4ADWA 3UKPA 1FCDA 2A8XA 3M0OA 4HB9A 4EMIA 5HY5A 4Q17A 2YLSA 3KD9A 3NTDA 2C75A 1PXCA 1VRQB 1M6IA 3L1RA 4YTPA 1CJ4A 4P9SA 2IVEA 4H50A 2XVJA 4U2SA 3ICSA 2WPFA 2OT4A 1MOKA 1ZP0A 3SXQA 1EL8A 3K7QX 1EL5A 3HYXA 3DJDA 1GV4A 1ZOYA 1F8RA 2A87A 2CDUA 2WOIA 1JNRA 4G6HA 2XYOA 4U8PA 4H4XA 3BNUA 3KPKA 3S7WA 1CJCA 1ZMDA 5U63A 1QO8A 3ALLA 2XLUA 2GMJA 2X3NA 4GDEA 3QFBA 3SQPA 4YWOA 3VR8A 1EL7A 2C3CA 2C72A 5EOWA 2QA2A 4A5LA 3UKFA 1NAAA 3KLJA 3KU9A 1TRBA 3GSIA 4EM4A 3EANA 1GRGA 1PBFA 3DJEA 3CNPA 5HYMA 3G5QA 5KOWA 1PXBA 1F8SA 1HYUA 2YM2A 4O5UA 3UCLA 1NG4A 2R46A 4H4TA 4E0VA 3NN0X 3L8KA 2UZZA 1TDKA 1YKJA 2VVLA 4OPCA 4CNJA 1S3EA 1DJNA 2WP5A 3AE8A 2YVJA 3BHKA 4Z25A 1OAHA 1O5WA 3CPIG 1ELIA 2GR2A 3V3OA 3DJJA
chains in the Genus database with same CATH topology
3AXBA 4ICYA 2RGOA 3RHAA 2WOWA 2PYXA 3ISHA 4H2NA 1DNCA 2A89A 1UKVG 1ZDLA 3MMOA 3UTHA 3CPHG 4FK1C 1YQ4A 3T0KA 3UOZA 1FEAA 3UTEA 3RP6A 1OJTA 1ZY8A 1M64A 4K5SA 4RG3A 3ZDNA 5C3JA 3AE2A 3QSMA 3ITJA 3NTAA 2GQFA 2YLZA 3TTBA 2J7AA 1SEZA 1KSSA 3AYJA 4A7AA 3B6DA 3GRTA 3K7MX 1X31B 4B64A 2WU5A 2NVKX 5J7XA 2LFCA 2H88A 5IQ4A 1E7PA 2B9WA 3AE7A 4GUVA 1FOHA 2WESA 3UTGA 2NPXA 3AE5A 2GR1A 2TPRA 1K0JA 3II4A 2C4CA 4XWRA 1PJ7A 1PJ5A 4HA6A 4L3YA 1PHHA 4B1BA 1TDFA 4USQA 3CNSA 4C3YA 3NKSA 4NNJA 5FS7A 1H7XA 5U1OA 3AE1A 3I6DA 2FJEA 1Q1WA 1VG9A 2GV8A 1YQZA 1Z6LA 5BULA 3GWFA 2YR5A 2GAGB 1RYIA 4WCTA 2VVLG 3CNTA 4GAPA 1Y56B 3DGZA 3HYVA 1NG3A 2R4EA 1Y56A 4BK1A 5DBJA 2E4GA 4AOSA 1B4VA 2BA9A 2VRLA 4H4RA 3DK8A 2F5ZA 1H7WA 4UDPA 3C4AA 4XWZA 2X8HA 3AYIA 3ICRA 4G6GA 5BUKA 2VQ7A 1AOGA 1GNDA 1GEUA 2E1MA 3IHGA 3BNHA 1B37A 1ZK7A 1KSUA 4TLZA 3OZ2A 2GMHA 5LV9A 3SFDA 3AEEA 2YVGA 2OLOA 2ZZCA 3EAOA 3NRNA 3DJGX 4NEVA 3SXIA 4APNA 4YXDA 4FDCB 1Y0PA 3AE4A 5J60A 1CC2A 2BXRA 3ATRA 1E1KA 2EQ9A 3UKQA 2EQ6A 3B3RA 1XPQA 2XLTA 3AEBA 2O9ZA 3EF6A 1JNZA 2OA1A 4ZCCA 2AQJA 1BGJA 4K7ZA 1VQWA 2EQ7A 4A65A 1PS9A 5JCNA 1GERA 1FT5A 2RGHA 3G5RA 2Y6RA 5BRTA 1M1PA 1GSNA 3FO3A 3AE9A 3LOVA 4K5RA 4USRA 1H81A 3H8IA 2XFNA 4YSYA 4CY6A 1O94A 3DA1A 2WBAA 2C73A 1P2HA 3AD7B 2B7RA 2WQYA 3HYWA 4A79A 1L9CA 3NGCX 1L0VA 1F3PA 4GR1A 3ALMA 3NYCA 5IPYA 3CMMA 3UOXA 3DK4A 3RNMA 2BACA 1QJDA 3LG1A 3AD8B 2B9YA 3KKJA 1FS9A 3SZFA 3PVCA 5KVHA 3NIXA 4KPRA 3SM8A 2JKCA 3KA7A 1GRHA 3VRDB 1B5QA 4ECHA 1CHUA 4H4PA 5M0ZA 1E1LA 1GRBA 1PBDA 2CULA 2WDVA 5EBKA 3SCEA 2YWLA 1H84A 4Z2RA 1W4XA 4J36A 3SZCA 4EQXA 2CFYA 3UKKA 2WU2A 4IA5A 4EM3A 4II2A 3PS9A 2C66A 4JDRA 3OWMA 5JCMA 3RP7A 2ZO5A 2GB0A 2PHHA 2WDRA 2X99A 1DOCA 1IUSA 3GD3A 4IVMB 1K0LA 1CF3A 4CRTA 4D04A 5KWFA 4C3XA 2Q0KA 3GDPA 1D7YA 1DXLA 3BNMA 4L3ZA 2V3AA 4H4WA 3NHOX 2BYBA 3NYFA 2XFQA 4DNAA 2VVMA 3D1IA 1K0IA 1D5TA 2R0CA 4U2LA 5JCLA 5KMQA 2BS3A 5CKUA 1KNRA 3T14A 1PBEA 1KFYA 3QSEA 1JU2A 4TM0A 3CGEA 4GF7A 4O5QA 2WP6A 3AEGA 4REKA 4U8OA 3NT6A 1D4DA 1PJ6A 2QAEA 3K7TA 3VQRA 2YLWA 4NTEA 2IIDA 1GESA 3NH3X 2YLRA 1OJCA 1OJ9A 3VRAA 4TM1A 1MO9A 2R45A 1LVLA 3SYIA 2BC0A 2WP9A 1LTXR 1QLBA 3QVPA 1JRZA 5EB5A 2FBWA 3CPJG 2E81A 2WS3A 1VDCA 2YG4A 3IF9A 4H4UA 2XFOA 4H7UA 4EIQA 1OJDA 1JRYA 5KRQA 1TYTA 3NLCA 4BK2A 4BJZA 1ONFA 4OPIA 3S61A 3T2YA 5JCIA 4Z2TA 2EQ8A 3V76A 2R0PA 1GALA 3LZXA 2C70A 2WPEA 2XDOA 3UKAA 3G5SA 1ZOVA 2JB3A 3CGCA 3P9UA 1P2EA 3C96A 2ACZA 4EMWA 1E1MA 2BXSA 2XVEA 3SZ0A 3UKHA 1S2YA 3Q6JA 2OAMA 4L3XA 1DOEA 2C3DA 4M52A 2BK4A 2XVHA 3FG2P 2GF3A 4II3A 3H4KA 3E1TA 5L46A 1REOA 3ABVA 4FX9A 1LQUA 1SP3A 3CIRA 1D4CA 1N4WA 3M12A 4H4ZA 4JNAA 4Y4MA 3VRBA 2Z5YA 2V3BA 2XVIA 1H83A 4IA6A 4YSXA 4J2WA 4AT2A 3GM6A 3AD9B 4UP3A 4K22A 1L9EA 1FECA 2WDQA 4A6NB 3QJ4A 4JN9A 4A6NA 1YY5A 4J31A 2RF7A 2WEUA 4JY3A 4A9WA 4BK3A 2VOUA 4H2RA 1OJAA 4Y4NA 4B67A 4C77A 1RP0A 4FK1A 4C5OA 3CTYA 5TR3A 4LA1A 4NWZA 1BZLA 3FMWA 1CC6A 3UU9A 4GDPA 3GMBA 2RABA 2QCUA 4YSZA 4ZN0A 2GVCA 4OPDA 3NYEA 4D03A 2BCPA 3DK9A 2C7GA 2J3NA 2GR0A 2R9ZA 4G74A 3S5WA 1V59A 4B68A 5BVAA 4OPUA 1PXAA 3ALJA 1GRAA 4AOXA 3UTFA 1BWCA 1JRXA 3NK2X 3SZWA 4CNKA 3GD4A 1NDAA 3BI2A 5KMPA 3IHMA 3GDNA 3KPFA 2YAUA 4Z24A 4JY2A 5FS6A 3AEAA 1O95A 4YT0A 4TLXA 4B69A 3L1TA 2JBVA 2C64A 4Q5BA 1TYPA 1TDOA 2VQBA 4Y4LA 3UP4A 1GTEA 3AB1A 2YG6A 4RG4A 4EQSA 4J57A 4Z43A 4H4SA 2XLPA 1N1PA 1IUUA 3BI5A 3UKLA 4Q5CA 4U8IA 4I58A 2YQUA 4YTMA 4C74A 4G73A 5KXJA 4H4QA 1IJHA 1YQ3A 2YG5A 2XLRA 3NG7X 1BF3A 4AP3A 3RKHA 5HXIA 3P1WA 2X8GA 1D7LA 4OPTA 3HZLA 4OPLA 4BV6A 4IV9A 4DSHA 3LB8A 4YKGA 5U25A 3H8LA 2WPCA 3OC4A 3Q9TA 2R4JA 2V6OA 1TDNA 3ADAB 4U2TA 3SGLA 4J33A 4MJWA 4TM3A 1FT6A 1NHQA 3WE0A 1NEKA 2GEWA 1PDHA 2GQWA 2Q0LA 3AEFA 1BGNA 3COXA 1NPXA 4JNQA 1H6VA 4J34A 4KX6A 3CGBA 3NK1X 5HHFA 2BS2A 1DOBA 3PO7A 1VG0A 3SY4A 4H2PA 1N4UA 1F8WA 1LPFA 4CCRA 1CJ2A 1GETA 2DKHA 3LJPA 4H4YA 3TORA 3AWIA 4CY8A 1F6MA 3BNGA 2AR8A 5KVIA 3NN6X 1S3BA 2BK5A 2C67A 3KVEA 3QFAA 4YKFA 3EPTA 4U8JA 2I0ZA 3CNDA 5ER0A 3K30A 2W0HA 2VRMA 1NENA 4OPGA 5C2TA 2BABA 4H4VA 4X9NA 1DODA 3LGQA 2C65A 4LU6A 2OALA 4AT0A 4Z26A 1PN0A 2BCGG 2B76A 3ICTA 3LXDA 1LQTA 4CBQA 1QDBA 3AE3A 3SFEA 2YLXA 4OCGA 4AP1A 1M1RA 1JEHA 2XCGA 1Q1RA 2B9XA 2XFUA 1H82A 1KDGA 4YTNA 2VR0A 4U8KA 3F29A 1EBDA 3BI4A 3JSKA 1CC4A 3BNFA 3CNJA 4G9KA 5EB4A 4Q0TA 3F8RA 3T31A 2WOVA 4WJYA 3D1CA 3V3NA 3C4NA 3SX6A 3FPZA 4OVIA 5KMSA 2JB1A 3P4RA 5JCKA 4JQ9A 4NTDA 1GPEA 2YLTA 1E6EA 4CCQA 4J56A 1JOAA 1CJ3A 4PABA 3AYLA 2RDZA 3P4SA 4BJYA 1IUTA 3GMCA 3IWAA 2CVJA 3IC9A 1NHSA 2JAEA 2XFPA 1BKWA 2Y6QA 4I59A 2C76A 4EQRA 3DMEA 3P4QA 1PBCA 3AECA 4B66A 3FBSA 3NNEA 2APGA 1CBOA 2B7SA 2BC1A 2YG3A 1GRFA 3BHFA 2E80A 2E5VA 2QA1A 2YM1A 3BNJA 4Q4UA 4LIIA 2OLNA 5KNLA 3F8PA 2DKIA 3GWDA 4N9XA 3URHA 4BURA 1GTHA 1E1NA 3GRSA 4XXGA 1ZMCA 5FMHA 4TM4A 4DSGA 2FJAA 3UOVA 3AEDA 4PAAA 3ZYXA 3QSSA 1LJ1A 2ZBWA 4EMJA 3GYXA 1TDEA 3LZWA 4X9MA 4K2XA 2GR3A 2AAQA 3R9UA 1NHPA 3T37A 3DH9A 4NEWA 2FJDA 2Q6UA 1JNIA 5CQFA 4B63A 1N4VA 2K3VA 1GRTA 4Q1OA 3I3LA 2H89A 2ZZ0A 1BVBA 1XANA 3O0HA 1FS7A 3P4PA 1CL0A 1FL2A 1ZX9A 4U8NA 3GYIA 4K8DA 1IUWA 2BRYA 1GREA 1IUXA 1Q9IA 1PBBA 4EIPA 3D8XA 1FEBA 1NHRA 2GAHB 2RGJA 3F8DA 1IUVA 5KOXA 5M10A 2GH5A 4U8MA 1H86A 2YG7A 1GOSA 2GRTA 3CGDA 1COYA 3REDA 1GXFA 3UBRA 4YSHA 1MXTA 3M13A 2TMDA 3ATQA 3RP8A 1KNPA 1XDIA 2XVFA 4EQWA 1KF6A 4ZCDA 2JB2A 5IQ1A 4Z44A 4RSLA 4Z2UA 4GRTA 2VZ2A 2ARDA 2V61A 1D4EA 1M1QA 1LV0A 2YVFA 1DJQA 2X50A 2JK6A 4L38A 2BS4A 2V5ZA 3QVRA 4GCMA 5GRTA 1ZKQA 3DGHA 2BK3A 5KMRA 1GT8A 1EL9A 2R0GA 2X8CA 2HQMA 4U8LA 2WETA 2XLSA 3T2ZA 1B8SA 1RSGA 1GU6A 3T2KA 2Q7VA 1L9DA 4H2QA 2IVDA 4NZHA 4X4JA 5GSNA 3NK0X 3UOYA 3FIMB 1XHCA 3GYJA 3VR9A 4UDRA 2Z5XA 3UP5A 4B65A 2WHDA 2FJBA 2ZZBA 3AE6A 4A99A 1S2QA 1K4QA 1E39A 4WX1A 2BRAA 4DGKA 4UDQA 2YR6A 2YR4A 3LADA 4NTCA 3CN8A 5FS9A 2V60A 4IVOB 1FS8A 5FS8A 4GAVA 4ADWA 3UKPA 1FCDA 2A8XA 3M0OA 4HB9A 4EMIA 5HY5A 4Q17A 2YLSA 3KD9A 3NTDA 2C75A 1PXCA 1VRQB 1M6IA 3L1RA 4YTPA 1CJ4A 4P9SA 2IVEA 4H50A 2XVJA 4U2SA 3ICSA 2WPFA 2OT4A 1MOKA 1ZP0A 3SXQA 1EL8A 3K7QX 1EL5A 3HYXA 3DJDA 1GV4A 1ZOYA 1F8RA 2A87A 2CDUA 2WOIA 1JNRA 4G6HA 2XYOA 4U8PA 4H4XA 3BNUA 3KPKA 3S7WA 1CJCA 1ZMDA 5U63A 1QO8A 3ALLA 2XLUA 2GMJA 2X3NA 4GDEA 3QFBA 3SQPA 4YWOA 3VR8A 1EL7A 2C3CA 2C72A 5EOWA 2QA2A 4A5LA 3UKFA 1NAAA 3KLJA 3KU9A 1TRBA 3GSIA 4EM4A 3EANA 1GRGA 1PBFA 3DJEA 3CNPA 5HYMA 3G5QA 5KOWA 1PXBA 1F8SA 1HYUA 2YM2A 4O5UA 3UCLA 1NG4A 2R46A 4H4TA 4E0VA 3NN0X 3L8KA 2UZZA 1TDKA 1YKJA 2VVLA 4OPCA 4CNJA 1S3EA 1DJNA 2WP5A 3AE8A 2YVJA 3BHKA 4Z25A 1OAHA 1O5WA 3CPIG 1ELIA 2GR2A 3V3OA 3DJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AXB A;  4ICY A;  2RGO A;  3RHA A;  2WOW A;  2PYX A;  3ISH A;  4H2N A;  1DNC A;  2A89 A;  1UKV G;  1ZDL A;  3MMO A;  3UTH A;  3CPH G;  4FK1 C;  1YQ4 A;  3UOZ A;  3UTE A;  1FEA A;  3ZDN A;  3RP6 A;  1OJT A;  1ZY8 A;  1M64 A;  4K5S A;  4RG3 A;  5C3J A;  3AE2 A;  3QSM A;  3ITJ A;  3NTA A;  2GQF A;  2YLZ A;  3TTB A;  2J7A A;  1SEZ A;  1KSS A;  3AYJ A;  4A7A A;  3B6D A;  3GRT A;  3K7M X;  1X31 B;  4B64 A;  2WU5 A;  2NVK X;  5J7X A;  2LFC A;  2H88 A;  5IQ4 A;  1E7P A;  2B9W A;  3AE7 A;  4GUV A;  1FOH A;  2WES A;  3UTG A;  2NPX A;  3AE5 A;  2GR1 A;  2TPR A;  1K0J A;  3II4 A;  4XWR A;  1PJ7 A;  1PJ5 A;  4HA6 A;  4L3Y A;  1PHH A;  4B1B A;  1TDF A;  4USQ A;  3CNS A;  4C3Y A;  3NKS A;  5FS7 A;  5U1O A;  1H7X A;  3AE1 A;  3I6D A;  2FJE A;  1Q1W A;  1VG9 A;  2GV8 A;  1YQZ A;  1Z6L A;  5BUL A;  3GWF A;  2YR5 A;  2GAG B;  1RYI A;  4WCT A;  2VVL G;  3CNT A;  1Y56 B;  3DGZ A;  1NG3 A;  2R4E A;  1Y56 A;  4BK1 A;  5DBJ A;  2E4G A;  4AOS A;  1B4V A;  2BA9 A;  2VRL A;  4H4R A;  3DK8 A;  2F5Z A;  1H7W A;  4UDP A;  3C4A A;  4XWZ A;  2X8H A;  3AYI A;  3ICR A;  5BUK A;  2VQ7 A;  1AOG A;  1GND A;  1GEU A;  2E1M A;  3IHG A;  3BNH A;  1B37 A;  1ZK7 A;  1KSU A;  4TLZ A;  3OZ2 A;  2GMH A;  5LV9 A;  3SFD A;  3AEE A;  2YVG A;  2OLO A;  2ZZC A;  3EAO A;  3NRN A;  3DJG X;  4NEV A;  4APN A;  4YXD A;  4FDC B;  1Y0P A;  3AE4 A;  5J60 A;  1CC2 A;  2BXR A;  3ATR A;  1E1K A;  2EQ9 A;  3UKQ A;  2EQ6 A;  3B3R A;  1XPQ A;  2XLT A;  3AEB A;  2O9Z A;  3EF6 A;  1JNZ A;  2OA1 A;  4ZCC A;  2AQJ A;  1BGJ A;  4K7Z A;  1VQW A;  2EQ7 A;  4A65 A;  1PS9 A;  5JCN A;  1GER A;  1FT5 A;  2RGH A;  3G5R A;  2Y6R A;  5BRT A;  1M1P A;  1GSN A;  3FO3 A;  3AE9 A;  3LOV A;  4K5R A;  4USR A;  1H81 A;  3H8I A;  2XFN A;  4YSY A;  4CY6 A;  1O94 A;  3DA1 A;  2WBA A;  2C73 A;  1P2H A;  3AD7 B;  2B7R A;  2WQY A;  4A79 A;  1L9C A;  3NGC X;  1L0V A;  1F3P A;  4GR1 A;  3ALM A;  3NYC A;  5IPY A;  3UOX A;  3DK4 A;  3RNM A;  2BAC A;  1QJD A;  3LG1 A;  3AD8 B;  2B9Y A;  3KKJ A;  1FS9 A;  3PVC A;  5KVH A;  3NIX A;  4KPR A;  3SM8 A;  2JKC A;  3KA7 A;  1GRH A;  3VRD B;  1B5Q A;  4ECH A;  1CHU A;  4H4P A;  5M0Z A;  1E1L A;  1GRB A;  1PBD A;  2CUL A;  2WDV A;  5EBK A;  3SCE A;  2YWL A;  1H84 A;  4Z2R A;  1W4X A;  4J36 A;  4EQX A;  2CFY A;  3UKK A;  2WU2 A;  4IA5 A;  4EM3 A;  3PS9 A;  2C66 A;  4JDR A;  3OWM A;  5JCM A;  3RP7 A;  2ZO5 A;  2GB0 A;  2PHH A;  2WDR A;  2X99 A;  1DOC A;  1IUS A;  3GD3 A;  4IVM B;  1K0L A;  1CF3 A;  4CRT A;  4D04 A;  5KWF A;  4C3X A;  2Q0K A;  3GDP A;  1D7Y A;  1DXL A;  3BNM A;  4L3Z A;  2V3A A;  4H4W A;  3NHO X;  2BYB A;  3NYF A;  2XFQ A;  4DNA A;  2VVM A;  3D1I A;  1K0I A;  1D5T A;  2R0C A;  4U2L A;  5JCL A;  2BS3 A;  5CKU A;  1KNR A;  1PBE A;  1KFY A;  3QSE A;  1JU2 A;  4TM0 A;  3CGE A;  4GF7 A;  4O5Q A;  2WP6 A;  3AEG A;  4REK A;  4U8O A;  3NT6 A;  1D4D A;  1PJ6 A;  2QAE A;  3K7T A;  3VQR A;  2YLW A;  4NTE A;  2IID A;  1GES A;  3NH3 X;  2YLR A;  1OJC A;  1OJ9 A;  3VRA A;  4TM1 A;  1MO9 A;  2R45 A;  1LVL A;  2BC0 A;  2WP9 A;  1LTX R;  1QLB A;  3QVP A;  1JRZ A;  5EB5 A;  2FBW A;  3CPJ G;  2E81 A;  2WS3 A;  1VDC A;  2YG4 A;  3IF9 A;  4H4U A;  2XFO A;  4H7U A;  4EIQ A;  1OJD A;  1JRY A;  5KRQ A;  1TYT A;  3NLC A;  4BK2 A;  4BJZ A;  1ONF A;  4OPI A;  3S61 A;  5JCI A;  4Z2T A;  2EQ8 A;  3V76 A;  2R0P A;  1GAL A;  3LZX A;  2C70 A;  2WPE A;  2XDO A;  3UKA A;  3G5S A;  1ZOV A;  2JB3 A;  3CGC A;  3P9U A;  1P2E A;  3C96 A;  2ACZ A;  4EMW A;  1E1M A;  2BXS A;  2XVE A;  3UKH A;  1S2Y A;  3Q6J A;  2OAM A;  4L3X A;  1DOE A;  2C3D A;  4M52 A;  2BK4 A;  2XVH A;  3FG2 P;  2GF3 A;  3H4K A;  3E1T A;  5L46 A;  1REO A;  3ABV A;  4FX9 A;  1LQU A;  1SP3 A;  3CIR A;  1D4C A;  1N4W A;  3M12 A;  4H4Z A;  4JNA A;  4Y4M A;  3VRB A;  2Z5Y A;  2V3B A;  2XVI A;  1H83 A;  4IA6 A;  4YSX A;  4J2W A;  4AT2 A;  3GM6 A;  3AD9 B;  4UP3 A;  4K22 A;  1L9E A;  1FEC A;  2WDQ A;  4A6N B;  3QJ4 A;  4JN9 A;  4A6N A;  1YY5 A;  4J31 A;  2RF7 A;  2WEU A;  4JY3 A;  4A9W A;  4BK3 A;  2VOU A;  4H2R A;  1OJA A;  4Y4N A;  4B67 A;  4C77 A;  1RP0 A;  4FK1 A;  4C5O A;  3CTY A;  5TR3 A;  4LA1 A;  1BZL A;  3FMW A;  1CC6 A;  3UU9 A;  4GDP A;  3GMB A;  2RAB A;  2QCU A;  4YSZ A;  4ZN0 A;  2GVC A;  4OPD A;  3NYE A;  4D03 A;  2BCP A;  3DK9 A;  2C7G A;  2J3N A;  2GR0 A;  2R9Z A;  3S5W A;  4B68 A;  1V59 A;  5BVA A;  4OPU A;  1PXA A;  3ALJ A;  1GRA A;  4AOX A;  3UTF A;  1BWC A;  1JRX A;  3NK2 X;  4CNK A;  3GD4 A;  1NDA A;  3BI2 A;  3IHM A;  3GDN A;  3KPF A;  2YAU A;  4Z24 A;  4JY2 A;  5FS6 A;  3AEA A;  1O95 A;  4YT0 A;  4TLX A;  4B69 A;  3L1T A;  2JBV A;  2C64 A;  4Q5B A;  1TYP A;  1TDO A;  2VQB A;  4Y4L A;  3UP4 A;  1GTE A;  3AB1 A;  2YG6 A;  4RG4 A;  4EQS A;  4J57 A;  4Z43 A;  4H4S A;  2XLP A;  1N1P A;  1IUU A;  3BI5 A;  3UKL A;  4Q5C A;  4U8I A;  4I58 A;  2YQU A;  4YTM A;  4C74 A;  5KXJ A;  4H4Q A;  1IJH A;  1YQ3 A;  2YG5 A;  2XLR A;  3NG7 X;  1BF3 A;  4AP3 A;  3RKH A;  5HXI A;  3P1W A;  2X8G A;  1D7L A;  4OPT A;  3HZL A;  4OPL A;  4BV6 A;  4IV9 A;  4DSH A;  3LB8 A;  4YKG A;  5U25 A;  3H8L A;  2WPC A;  3OC4 A;  3Q9T A;  2R4J A;  2V6O A;  1TDN A;  3ADA B;  4U2T A;  3SGL A;  4J33 A;  4MJW A;  4TM3 A;  1FT6 A;  1NHQ A;  3WE0 A;  1NEK A;  2GEW A;  1PDH A;  2GQW A;  2Q0L A;  3AEF A;  1BGN A;  3COX A;  1NPX A;  4JNQ A;  1H6V A;  4J34 A;  4KX6 A;  3CGB A;  3NK1 X;  5HHF A;  2BS2 A;  1DOB A;  3PO7 A;  1VG0 A;  4H2P A;  1N4U A;  1F8W A;  1LPF A;  4CCR A;  1CJ2 A;  1GET A;  2DKH A;  3LJP A;  4H4Y A;  3TOR A;  3AWI A;  4CY8 A;  1F6M A;  3BNG A;  2AR8 A;  5KVI A;  3NN6 X;  1S3B A;  2BK5 A;  2C67 A;  3KVE A;  3QFA A;  4YKF A;  3EPT A;  4U8J A;  2I0Z A;  3CND A;  5ER0 A;  3K30 A;  2W0H A;  2VRM A;  1NEN A;  4OPG A;  5C2T A;  2BAB A;  4H4V A;  4X9N A;  1DOD A;  3LGQ A;  2C65 A;  4LU6 A;  2OAL A;  4AT0 A;  4Z26 A;  1PN0 A;  2BCG G;  2B76 A;  3ICT A;  3LXD A;  1LQT A;  4CBQ A;  1QDB A;  3AE3 A;  3SFE A;  2YLX A;  4OCG A;  4AP1 A;  1M1R A;  1JEH A;  2XCG A;  1Q1R A;  2B9X A;  2XFU A;  1H82 A;  1KDG A;  4YTN A;  2VR0 A;  4U8K A;  3F29 A;  1EBD A;  3BI4 A;  3JSK A;  1CC4 A;  3BNF A;  3CNJ A;  5EB4 A;  4Q0T A;  3F8R A;  2WOV A;  4WJY A;  3D1C A;  3V3N A;  3C4N A;  3FPZ A;  4OVI A;  2JB1 A;  3P4R A;  5JCK A;  4JQ9 A;  4NTD A;  1GPE A;  2YLT A;  1E6E A;  4CCQ A;  4J56 A;  1JOA A;  1CJ3 A;  4PAB A;  3AYL A;  2RDZ A;  3P4S A;  4BJY A;  1IUT A;  3GMC A;  3IWA A;  2CVJ A;  3IC9 A;  1NHS A;  2JAE A;  2XFP A;  1BKW A;  2Y6Q A;  4I59 A;  2C76 A;  4EQR A;  3DME A;  3P4Q A;  1PBC A;  3AEC A;  4B66 A;  3FBS A;  3NNE A;  2APG A;  1CBO A;  2B7S A;  2BC1 A;  2YG3 A;  1GRF A;  3BHF A;  2E80 A;  2E5V A;  2QA1 A;  2YM1 A;  3BNJ A;  4Q4U A;  4LII A;  2OLN A;  3F8P A;  2DKI A;  3GWD A;  4N9X A;  3URH A;  4BUR A;  1GTH A;  1E1N A;  3GRS A;  4XXG A;  1ZMC A;  5FMH A;  4TM4 A;  4DSG A;  2FJA A;  3UOV A;  3AED A;  4PAA A;  3ZYX A;  3QSS A;  1LJ1 A;  2ZBW A;  4EMJ A;  3GYX A;  1TDE A;  3LZW A;  4X9M A;  4K2X A;  2GR3 A;  2AAQ A;  3R9U A;  1NHP A;  3T37 A;  3DH9 A;  4NEW A;  2FJD A;  2Q6U A;  1JNI A;  5CQF A;  4B63 A;  1N4V A;  2K3V A;  1GRT A;  4Q1O A;  3I3L A;  2H89 A;  2ZZ0 A;  1BVB A;  1XAN A;  3O0H A;  1FS7 A;  3P4P A;  1CL0 A;  1FL2 A;  1ZX9 A;  4U8N A;  3GYI A;  4K8D A;  1IUW A;  1GRE A;  1IUX A;  1Q9I A;  1PBB A;  4EIP A;  3D8X A;  1FEB A;  1NHR A;  2GAH B;  2RGJ A;  3F8D A;  1IUV A;  5KOX A;  5M10 A;  2GH5 A;  4U8M A;  1H86 A;  2YG7 A;  1GOS A;  2GRT A;  3CGD A;  1COY A;  3RED A;  1GXF A;  3UBR A;  4YSH A;  1MXT A;  3M13 A;  2TMD A;  3ATQ A;  3RP8 A;  1KNP A;  1XDI A;  2XVF A;  4EQW A;  1KF6 A;  4ZCD A;  2JB2 A;  5IQ1 A;  4Z44 A;  4RSL A;  4Z2U A;  4GRT A;  2VZ2 A;  2ARD A;  2V61 A;  1D4E A;  1M1Q A;  1LV0 A;  2YVF A;  1DJQ A;  2X50 A;  2JK6 A;  4L38 A;  2BS4 A;  2V5Z A;  3QVR A;  4GCM A;  5GRT A;  1ZKQ A;  3DGH A;  2BK3 A;  1GT8 A;  1EL9 A;  2R0G A;  2X8C A;  2HQM A;  4U8L A;  2WET A;  2XLS A;  1B8S A;  1RSG A;  1GU6 A;  2Q7V A;  1L9D A;  4H2Q A;  2IVD A;  4NZH A;  4X4J A;  5GSN A;  3NK0 X;  3UOY A;  3FIM B;  1XHC A;  3GYJ A;  3VR9 A;  4UDR A;  2Z5X A;  3UP5 A;  4B65 A;  2WHD A;  2FJB A;  2ZZB A;  3AE6 A;  4A99 A;  1S2Q A;  1K4Q A;  1E39 A;  4WX1 A;  4DGK A;  4UDQ A;  2YR6 A;  2YR4 A;  3LAD A;  4NTC A;  3CN8 A;  5FS9 A;  2V60 A;  4IVO B;  1FS8 A;  5FS8 A;  4ADW A;  3UKP A;  1FCD A;  2A8X A;  3M0O A;  4HB9 A;  4EMI A;  5HY5 A;  4Q17 A;  2YLS A;  3KD9 A;  3NTD A;  2C75 A;  1PXC A;  1VRQ B;  1M6I A;  3L1R A;  4YTP A;  1CJ4 A;  4P9S A;  2IVE A;  4H50 A;  2XVJ A;  4U2S A;  3ICS A;  2WPF A;  2OT4 A;  1MOK A;  1ZP0 A;  3SXQ A;  1EL8 A;  3K7Q X;  1EL5 A;  3DJD A;  1GV4 A;  1ZOY A;  1F8R A;  2A87 A;  2CDU A;  2WOI A;  1JNR A;  2XYO A;  4U8P A;  4H4X A;  3BNU A;  3S7W A;  1CJC A;  1ZMD A;  5U63 A;  1QO8 A;  3ALL A;  2XLU A;  2GMJ A;  2X3N A;  4GDE A;  3QFB A;  3SQP A;  4YWO A;  3VR8 A;  1EL7 A;  2C3C A;  2C72 A;  5EOW A;  2QA2 A;  4A5L A;  3UKF A;  1NAA A;  3KLJ A;  3KU9 A;  1TRB A;  3GSI A;  4EM4 A;  3EAN A;  1GRG A;  1PBF A;  3DJE A;  3CNP A;  5HYM A;  3G5Q A;  5KOW A;  1PXB A;  1F8S A;  1HYU A;  2YM2 A;  4O5U A;  3UCL A;  1NG4 A;  2R46 A;  4H4T A;  4E0V A;  3NN0 X;  3L8K A;  2UZZ A;  1TDK A;  1YKJ A;  2VVL A;  4OPC A;  4CNJ A;  1S3E A;  1DJN A;  2WP5 A;  3AE8 A;  2YVJ A;  3BHK A;  4Z25 A;  1OAH A;  1O5W A;  3CPI G;  1ELI A;  2GR2 A;  3V3O A;  3DJJ A; 
#chains in the Genus database with same CATH topology
 3AXB A;  4ICY A;  2RGO A;  3RHA A;  2WOW A;  2PYX A;  3ISH A;  4H2N A;  1DNC A;  2A89 A;  1UKV G;  1ZDL A;  3MMO A;  3UTH A;  3CPH G;  4FK1 C;  1YQ4 A;  3T0K A;  3UOZ A;  1FEA A;  3UTE A;  3RP6 A;  1OJT A;  1ZY8 A;  1M64 A;  4K5S A;  4RG3 A;  3ZDN A;  5C3J A;  3AE2 A;  3QSM A;  3ITJ A;  3NTA A;  2GQF A;  2YLZ A;  3TTB A;  2J7A A;  1SEZ A;  1KSS A;  3AYJ A;  4A7A A;  3B6D A;  3GRT A;  3K7M X;  1X31 B;  4B64 A;  2WU5 A;  2NVK X;  5J7X A;  2LFC A;  2H88 A;  5IQ4 A;  1E7P A;  2B9W A;  3AE7 A;  4GUV A;  1FOH A;  2WES A;  3UTG A;  2NPX A;  3AE5 A;  2GR1 A;  2TPR A;  1K0J A;  3II4 A;  2C4C A;  4XWR A;  1PJ7 A;  1PJ5 A;  4HA6 A;  4L3Y A;  1PHH A;  4B1B A;  1TDF A;  4USQ A;  3CNS A;  4C3Y A;  3NKS A;  4NNJ A;  5FS7 A;  1H7X A;  5U1O A;  3AE1 A;  3I6D A;  2FJE A;  1Q1W A;  1VG9 A;  2GV8 A;  1YQZ A;  1Z6L A;  5BUL A;  3GWF A;  2YR5 A;  2GAG B;  1RYI A;  4WCT A;  2VVL G;  3CNT A;  4GAP A;  1Y56 B;  2CZS A;  3DGZ A;  3HYV A;  1NG3 A;  2R4E A;  1Y56 A;  4BK1 A;  5DBJ A;  2E4G A;  4AOS A;  1B4V A;  2BA9 A;  2VRL A;  4H4R A;  3DK8 A;  2F5Z A;  1H7W A;  4UDP A;  3C4A A;  4XWZ A;  2X8H A;  3AYI A;  3ICR A;  4G6G A;  5BUK A;  2VQ7 A;  1AOG A;  1GND A;  1GEU A;  2E1M A;  3IHG A;  3BNH A;  1B37 A;  1ZK7 A;  1KSU A;  4TLZ A;  3OZ2 A;  2GMH A;  5LV9 A;  3SFD A;  3AEE A;  2YVG A;  2OLO A;  2ZZC A;  3EAO A;  3NRN A;  3DJG X;  4NEV A;  3SXI A;  4APN A;  4YXD A;  4FDC B;  1Y0P A;  3AE4 A;  5J60 A;  1CC2 A;  2BXR A;  3ATR A;  1E1K A;  2EQ9 A;  3UKQ A;  2EQ6 A;  3B3R A;  1XPQ A;  2XLT A;  3AEB A;  2O9Z A;  3EF6 A;  1JNZ A;  2OA1 A;  4ZCC A;  2AQJ A;  1BGJ A;  4K7Z A;  1VQW A;  2EQ7 A;  4A65 A;  1PS9 A;  5JCN A;  1GER A;  1FT5 A;  2RGH A;  3G5R A;  2Y6R A;  5BRT A;  1M1P A;  1GSN A;  3FO3 A;  3AE9 A;  3LOV A;  4K5R A;  4USR A;  1H81 A;  3H8I A;  2XFN A;  4YSY A;  4CY6 A;  1O94 A;  3DA1 A;  2WBA A;  2C73 A;  1P2H A;  3AD7 B;  2B7R A;  2WQY A;  3HYW A;  4A79 A;  1L9C A;  3NGC X;  1L0V A;  1F3P A;  4GR1 A;  3ALM A;  3NYC A;  5IPY A;  3CMM A;  3UOX A;  3DK4 A;  3RNM A;  2BAC A;  1QJD A;  3LG1 A;  3AD8 B;  2B9Y A;  3KKJ A;  1FS9 A;  3SZF A;  3PVC A;  5KVH A;  3NIX A;  4KPR A;  3SM8 A;  2JKC A;  3KA7 A;  1GRH A;  3VRD B;  1B5Q A;  4ECH A;  1CHU A;  4H4P A;  5M0Z A;  1E1L A;  1GRB A;  1PBD A;  2CUL A;  2WDV A;  5EBK A;  3SCE A;  2YWL A;  1H84 A;  4Z2R A;  1W4X A;  4J36 A;  3SZC A;  4EQX A;  2CFY A;  3UKK A;  2WU2 A;  4IA5 A;  4EM3 A;  4II2 A;  3PS9 A;  2C66 A;  4JDR A;  3OWM A;  5JCM A;  3RP7 A;  2ZO5 A;  2GB0 A;  2PHH A;  2WDR A;  2X99 A;  1DOC A;  1IUS A;  3GD3 A;  4IVM B;  1K0L A;  1CF3 A;  4CRT A;  4D04 A;  5KWF A;  4C3X A;  2Q0K A;  3GDP A;  1D7Y A;  1DXL A;  3BNM A;  4L3Z A;  2V3A A;  4H4W A;  3NHO X;  2BYB A;  3NYF A;  2XFQ A;  4DNA A;  2VVM A;  3D1I A;  1K0I A;  1D5T A;  2R0C A;  4U2L A;  5JCL A;  5KMQ A;  2BS3 A;  5CKU A;  1KNR A;  3T14 A;  1PBE A;  1KFY A;  3QSE A;  1JU2 A;  4TM0 A;  3CGE A;  4GF7 A;  4O5Q A;  2WP6 A;  3AEG A;  4REK A;  4U8O A;  3NT6 A;  1D4D A;  1PJ6 A;  2QAE A;  3K7T A;  3VQR A;  2YLW A;  4NTE A;  2IID A;  1GES A;  3NH3 X;  2YLR A;  1OJC A;  1OJ9 A;  3VRA A;  4TM1 A;  1MO9 A;  2R45 A;  1LVL A;  3SYI A;  2BC0 A;  2WP9 A;  1LTX R;  1QLB A;  3QVP A;  1JRZ A;  5EB5 A;  2FBW A;  3CPJ G;  2E81 A;  2WS3 A;  1VDC A;  2YG4 A;  3IF9 A;  4H4U A;  2XFO A;  4H7U A;  4EIQ A;  1OJD A;  1JRY A;  5KRQ A;  1TYT A;  3NLC A;  4BK2 A;  4BJZ A;  1ONF A;  4OPI A;  3S61 A;  3T2Y A;  5JCI A;  4Z2T A;  2EQ8 A;  3V76 A;  2R0P A;  1GAL A;  3LZX A;  2C70 A;  2WPE A;  2XDO A;  3UKA A;  3G5S A;  1ZOV A;  2JB3 A;  3CGC A;  3P9U A;  1P2E A;  3C96 A;  2ACZ A;  4EMW A;  1E1M A;  2BXS A;  2XVE A;  3SZ0 A;  3UKH A;  1S2Y A;  3Q6J A;  2OAM A;  4L3X A;  1DOE A;  2C3D A;  4M52 A;  2BK4 A;  2XVH A;  3FG2 P;  2GF3 A;  4II3 A;  3H4K A;  3E1T A;  5L46 A;  1REO A;  3ABV A;  4FX9 A;  1LQU A;  1SP3 A;  3CIR A;  1D4C A;  1N4W A;  3M12 A;  4H4Z A;  4JNA A;  4Y4M A;  3VRB A;  2Z5Y A;  2V3B A;  2XVI A;  1H83 A;  4IA6 A;  4YSX A;  4J2W A;  4AT2 A;  3GM6 A;  3AD9 B;  4UP3 A;  4K22 A;  1L9E A;  1FEC A;  2WDQ A;  4A6N B;  3QJ4 A;  4JN9 A;  4A6N A;  1YY5 A;  4J31 A;  2RF7 A;  2WEU A;  4JY3 A;  4A9W A;  4BK3 A;  2VOU A;  4H2R A;  1OJA A;  4Y4N A;  4B67 A;  4C77 A;  1RP0 A;  4FK1 A;  4C5O A;  3CTY A;  5TR3 A;  4LA1 A;  4NWZ A;  1BZL A;  3FMW A;  1CC6 A;  3UU9 A;  4GDP A;  3GMB A;  2RAB A;  2QCU A;  4YSZ A;  4ZN0 A;  2GVC A;  4OPD A;  3NYE A;  4D03 A;  2BCP A;  3DK9 A;  2C7G A;  2J3N A;  2GR0 A;  2R9Z A;  4G74 A;  3S5W A;  1V59 A;  4B68 A;  5BVA A;  4OPU A;  1PXA A;  3ALJ A;  1GRA A;  4AOX A;  3UTF A;  1BWC A;  1JRX A;  3NK2 X;  3SZW A;  4CNK A;  3GD4 A;  1NDA A;  3BI2 A;  5KMP A;  3IHM A;  3GDN A;  3KPF A;  2YAU A;  4Z24 A;  4JY2 A;  5FS6 A;  3AEA A;  1O95 A;  4YT0 A;  4TLX A;  4B69 A;  3L1T A;  2JBV A;  2C64 A;  4Q5B A;  1TYP A;  1TDO A;  2VQB A;  4Y4L A;  3UP4 A;  1GTE A;  3AB1 A;  2YG6 A;  4RG4 A;  4EQS A;  4J57 A;  4Z43 A;  4H4S A;  2XLP A;  1N1P A;  1IUU A;  3BI5 A;  3UKL A;  4Q5C A;  4U8I A;  4I58 A;  2YQU A;  4YTM A;  4C74 A;  4G73 A;  5KXJ A;  4H4Q A;  1IJH A;  1YQ3 A;  2YG5 A;  2XLR A;  3NG7 X;  1BF3 A;  4AP3 A;  3RKH A;  5HXI A;  3P1W A;  2X8G A;  1D7L A;  4OPT A;  3HZL A;  4OPL A;  4BV6 A;  4IV9 A;  4DSH A;  3LB8 A;  4YKG A;  5U25 A;  3H8L A;  2WPC A;  3OC4 A;  3Q9T A;  2R4J A;  2V6O A;  1TDN A;  3ADA B;  4U2T A;  3SGL A;  4J33 A;  4MJW A;  4TM3 A;  1FT6 A;  1NHQ A;  3WE0 A;  1NEK A;  2GEW A;  1PDH A;  2GQW A;  2Q0L A;  3AEF A;  1BGN A;  3COX A;  1NPX A;  4JNQ A;  1H6V A;  4J34 A;  4KX6 A;  3CGB A;  3NK1 X;  5HHF A;  2BS2 A;  1DOB A;  3PO7 A;  1VG0 A;  3SY4 A;  4H2P A;  1N4U A;  1F8W A;  1LPF A;  4CCR A;  1CJ2 A;  1GET A;  2DKH A;  3LJP A;  4H4Y A;  3TOR A;  3AWI A;  4CY8 A;  1F6M A;  3BNG A;  2AR8 A;  5KVI A;  3NN6 X;  1S3B A;  2BK5 A;  2C67 A;  3KVE A;  3QFA A;  4YKF A;  3EPT A;  4U8J A;  2I0Z A;  3CND A;  5ER0 A;  3K30 A;  2W0H A;  2VRM A;  1NEN A;  4OPG A;  5C2T A;  2BAB A;  4H4V A;  4X9N A;  1DOD A;  3LGQ A;  2C65 A;  4LU6 A;  2OAL A;  4AT0 A;  4Z26 A;  1PN0 A;  2BCG G;  2B76 A;  3ICT A;  3LXD A;  1LQT A;  4CBQ A;  1QDB A;  3AE3 A;  3SFE A;  2YLX A;  4OCG A;  4AP1 A;  1M1R A;  1JEH A;  2XCG A;  1Q1R A;  2B9X A;  2XFU A;  1H82 A;  1KDG A;  4YTN A;  2VR0 A;  4U8K A;  3F29 A;  1EBD A;  3BI4 A;  3JSK A;  1CC4 A;  3BNF A;  3CNJ A;  4G9K A;  5EB4 A;  4Q0T A;  3F8R A;  3T31 A;  2WOV A;  4WJY A;  3D1C A;  3V3N A;  3C4N A;  3SX6 A;  3FPZ A;  4OVI A;  5KMS A;  2JB1 A;  3P4R A;  5JCK A;  4JQ9 A;  4NTD A;  1GPE A;  2YLT A;  1E6E A;  4CCQ A;  4J56 A;  1JOA A;  1CJ3 A;  4PAB A;  3AYL A;  2RDZ A;  3P4S A;  4BJY A;  1IUT A;  3GMC A;  3IWA A;  2CVJ A;  3IC9 A;  1NHS A;  2JAE A;  2XFP A;  1BKW A;  2Y6Q A;  4I59 A;  2C76 A;  4EQR A;  3DME A;  3P4Q A;  1PBC A;  3AEC A;  4B66 A;  3FBS A;  3NNE A;  2APG A;  1CBO A;  2B7S A;  2BC1 A;  2YG3 A;  1GRF A;  3BHF A;  2E80 A;  2E5V A;  2QA1 A;  2YM1 A;  3BNJ A;  4Q4U A;  4LII A;  2OLN A;  5KNL A;  3F8P A;  2DKI A;  3GWD A;  4N9X A;  3URH A;  4BUR A;  1GTH A;  1E1N A;  3GRS A;  4XXG A;  1ZMC A;  5FMH A;  4TM4 A;  4DSG A;  2FJA A;  3UOV A;  3AED A;  4PAA A;  3ZYX A;  3QSS A;  1LJ1 A;  2ZBW A;  4EMJ A;  3GYX A;  1TDE A;  3LZW A;  4X9M A;  4K2X A;  2GR3 A;  2AAQ A;  3R9U A;  1NHP A;  3T37 A;  3DH9 A;  4NEW A;  2FJD A;  2Q6U A;  1JNI A;  5CQF A;  4B63 A;  1N4V A;  2K3V A;  1GRT A;  4Q1O A;  3I3L A;  2H89 A;  2ZZ0 A;  1BVB A;  1XAN A;  3O0H A;  1FS7 A;  3P4P A;  1CL0 A;  1FL2 A;  1ZX9 A;  4U8N A;  3GYI A;  4K8D A;  1IUW A;  2BRY A;  1GRE A;  1IUX A;  1Q9I A;  1PBB A;  4EIP A;  3D8X A;  1FEB A;  1NHR A;  2GAH B;  2RGJ A;  3F8D A;  1IUV A;  5KOX A;  5M10 A;  2GH5 A;  4U8M A;  1H86 A;  2YG7 A;  1GOS A;  2GRT A;  3CGD A;  1COY A;  3RED A;  1GXF A;  3UBR A;  4YSH A;  1MXT A;  3M13 A;  2TMD A;  3ATQ A;  3RP8 A;  1KNP A;  1XDI A;  2XVF A;  4EQW A;  1KF6 A;  4ZCD A;  2JB2 A;  5IQ1 A;  4Z44 A;  4RSL A;  4Z2U A;  4GRT A;  2VZ2 A;  2ARD A;  2V61 A;  1D4E A;  1M1Q A;  1LV0 A;  2YVF A;  1DJQ A;  2X50 A;  2JK6 A;  4L38 A;  2BS4 A;  2V5Z A;  3QVR A;  4GCM A;  5GRT A;  1ZKQ A;  3DGH A;  2BK3 A;  5KMR A;  1GT8 A;  1EL9 A;  2R0G A;  2X8C A;  2HQM A;  4U8L A;  2WET A;  2XLS A;  3T2Z A;  1B8S A;  1RSG A;  1GU6 A;  3T2K A;  2Q7V A;  1L9D A;  4H2Q A;  2IVD A;  4NZH A;  4X4J A;  5GSN A;  3NK0 X;  3UOY A;  3FIM B;  1XHC A;  3GYJ A;  3VR9 A;  4UDR A;  2Z5X A;  3UP5 A;  4B65 A;  2WHD A;  2FJB A;  2ZZB A;  3AE6 A;  4A99 A;  1S2Q A;  1K4Q A;  1E39 A;  4WX1 A;  2BRA A;  4DGK A;  4UDQ A;  2YR6 A;  2YR4 A;  3LAD A;  4NTC A;  3CN8 A;  5FS9 A;  2V60 A;  4IVO B;  1FS8 A;  5FS8 A;  4GAV A;  4ADW A;  3UKP A;  1FCD A;  2A8X A;  3M0O A;  4HB9 A;  4EMI A;  5HY5 A;  4Q17 A;  2YLS A;  3KD9 A;  3NTD A;  2C75 A;  1PXC A;  1VRQ B;  1M6I A;  3L1R A;  4YTP A;  1CJ4 A;  4P9S A;  2IVE A;  4H50 A;  2XVJ A;  4U2S A;  3ICS A;  2WPF A;  2OT4 A;  1MOK A;  1ZP0 A;  3SXQ A;  1EL8 A;  3K7Q X;  1EL5 A;  3HYX A;  3DJD A;  1GV4 A;  1ZOY A;  1F8R A;  2A87 A;  2CDU A;  2WOI A;  1JNR A;  4G6H A;  2XYO A;  4U8P A;  4H4X A;  3BNU A;  3KPK A;  3S7W A;  1CJC A;  1ZMD A;  5U63 A;  1QO8 A;  3ALL A;  2XLU A;  2GMJ A;  2X3N A;  4GDE A;  3QFB A;  3SQP A;  4YWO A;  3VR8 A;  1EL7 A;  2C3C A;  2C72 A;  5EOW A;  2QA2 A;  4A5L A;  3UKF A;  1NAA A;  3KLJ A;  3KU9 A;  1TRB A;  3GSI A;  4EM4 A;  3EAN A;  1GRG A;  1PBF A;  3DJE A;  3CNP A;  5HYM A;  3G5Q A;  5KOW A;  1PXB A;  1F8S A;  1HYU A;  2YM2 A;  4O5U A;  3UCL A;  1NG4 A;  2R46 A;  4H4T A;  4E0V A;  3NN0 X;  3L8K A;  2UZZ A;  1TDK A;  1YKJ A;  2VVL A;  4OPC A;  4CNJ A;  1S3E A;  1DJN A;  2WP5 A;  3AE8 A;  2YVJ A;  3BHK A;  4Z25 A;  1OAH A;  1O5W A;  3CPI G;  1ELI A;  2GR2 A;  3V3O A;  3DJJ A; 
#chains in the Genus database with same CATH homology
 3AXB A;  4ICY A;  2RGO A;  3RHA A;  2WOW A;  2PYX A;  3ISH A;  4H2N A;  1DNC A;  2A89 A;  1UKV G;  1ZDL A;  3MMO A;  3UTH A;  3CPH G;  4FK1 C;  1YQ4 A;  3T0K A;  3UOZ A;  1FEA A;  3UTE A;  3RP6 A;  1OJT A;  1ZY8 A;  1M64 A;  4K5S A;  4RG3 A;  3ZDN A;  5C3J A;  3AE2 A;  3QSM A;  3ITJ A;  3NTA A;  2GQF A;  2YLZ A;  3TTB A;  2J7A A;  1SEZ A;  1KSS A;  3AYJ A;  4A7A A;  3B6D A;  3GRT A;  3K7M X;  1X31 B;  4B64 A;  2WU5 A;  2NVK X;  5J7X A;  2LFC A;  2H88 A;  5IQ4 A;  1E7P A;  2B9W A;  3AE7 A;  4GUV A;  1FOH A;  2WES A;  3UTG A;  2NPX A;  3AE5 A;  2GR1 A;  2TPR A;  1K0J A;  3II4 A;  2C4C A;  4XWR A;  1PJ7 A;  1PJ5 A;  4HA6 A;  4L3Y A;  1PHH A;  4B1B A;  1TDF A;  4USQ A;  3CNS A;  4C3Y A;  3NKS A;  4NNJ A;  5FS7 A;  1H7X A;  5U1O A;  3AE1 A;  3I6D A;  2FJE A;  1Q1W A;  1VG9 A;  2GV8 A;  1YQZ A;  1Z6L A;  5BUL A;  3GWF A;  2YR5 A;  2GAG B;  1RYI A;  4WCT A;  2VVL G;  3CNT A;  4GAP A;  1Y56 B;  3DGZ A;  3HYV A;  1NG3 A;  2R4E A;  1Y56 A;  4BK1 A;  5DBJ A;  2E4G A;  4AOS A;  1B4V A;  2BA9 A;  2VRL A;  4H4R A;  3DK8 A;  2F5Z A;  1H7W A;  4UDP A;  3C4A A;  4XWZ A;  2X8H A;  3AYI A;  3ICR A;  4G6G A;  5BUK A;  2VQ7 A;  1AOG A;  1GND A;  1GEU A;  2E1M A;  3IHG A;  3BNH A;  1B37 A;  1ZK7 A;  1KSU A;  4TLZ A;  3OZ2 A;  2GMH A;  5LV9 A;  3SFD A;  3AEE A;  2YVG A;  2OLO A;  2ZZC A;  3EAO A;  3NRN A;  3DJG X;  4NEV A;  3SXI A;  4APN A;  4YXD A;  4FDC B;  1Y0P A;  3AE4 A;  5J60 A;  1CC2 A;  2BXR A;  3ATR A;  1E1K A;  2EQ9 A;  3UKQ A;  2EQ6 A;  3B3R A;  1XPQ A;  2XLT A;  3AEB A;  2O9Z A;  3EF6 A;  1JNZ A;  2OA1 A;  4ZCC A;  2AQJ A;  1BGJ A;  4K7Z A;  1VQW A;  2EQ7 A;  4A65 A;  1PS9 A;  5JCN A;  1GER A;  1FT5 A;  2RGH A;  3G5R A;  2Y6R A;  5BRT A;  1M1P A;  1GSN A;  3FO3 A;  3AE9 A;  3LOV A;  4K5R A;  4USR A;  1H81 A;  3H8I A;  2XFN A;  4YSY A;  4CY6 A;  1O94 A;  3DA1 A;  2WBA A;  2C73 A;  1P2H A;  3AD7 B;  2B7R A;  2WQY A;  3HYW A;  4A79 A;  1L9C A;  3NGC X;  1L0V A;  1F3P A;  4GR1 A;  3ALM A;  3NYC A;  5IPY A;  3CMM A;  3UOX A;  3DK4 A;  3RNM A;  2BAC A;  1QJD A;  3LG1 A;  3AD8 B;  2B9Y A;  3KKJ A;  1FS9 A;  3SZF A;  3PVC A;  5KVH A;  3NIX A;  4KPR A;  3SM8 A;  2JKC A;  3KA7 A;  1GRH A;  3VRD B;  1B5Q A;  4ECH A;  1CHU A;  4H4P A;  5M0Z A;  1E1L A;  1GRB A;  1PBD A;  2CUL A;  2WDV A;  5EBK A;  3SCE A;  2YWL A;  1H84 A;  4Z2R A;  1W4X A;  4J36 A;  3SZC A;  4EQX A;  2CFY A;  3UKK A;  2WU2 A;  4IA5 A;  4EM3 A;  4II2 A;  3PS9 A;  2C66 A;  4JDR A;  3OWM A;  5JCM A;  3RP7 A;  2ZO5 A;  2GB0 A;  2PHH A;  2WDR A;  2X99 A;  1DOC A;  1IUS A;  3GD3 A;  4IVM B;  1K0L A;  1CF3 A;  4CRT A;  4D04 A;  5KWF A;  4C3X A;  2Q0K A;  3GDP A;  1D7Y A;  1DXL A;  3BNM A;  4L3Z A;  2V3A A;  4H4W A;  3NHO X;  2BYB A;  3NYF A;  2XFQ A;  4DNA A;  2VVM A;  3D1I A;  1K0I A;  1D5T A;  2R0C A;  4U2L A;  5JCL A;  5KMQ A;  2BS3 A;  5CKU A;  1KNR A;  3T14 A;  1PBE A;  1KFY A;  3QSE A;  1JU2 A;  4TM0 A;  3CGE A;  4GF7 A;  4O5Q A;  2WP6 A;  3AEG A;  4REK A;  4U8O A;  3NT6 A;  1D4D A;  1PJ6 A;  2QAE A;  3K7T A;  3VQR A;  2YLW A;  4NTE A;  2IID A;  1GES A;  3NH3 X;  2YLR A;  1OJC A;  1OJ9 A;  3VRA A;  4TM1 A;  1MO9 A;  2R45 A;  1LVL A;  3SYI A;  2BC0 A;  2WP9 A;  1LTX R;  1QLB A;  3QVP A;  1JRZ A;  5EB5 A;  2FBW A;  3CPJ G;  2E81 A;  2WS3 A;  1VDC A;  2YG4 A;  3IF9 A;  4H4U A;  2XFO A;  4H7U A;  4EIQ A;  1OJD A;  1JRY A;  5KRQ A;  1TYT A;  3NLC A;  4BK2 A;  4BJZ A;  1ONF A;  4OPI A;  3S61 A;  3T2Y A;  5JCI A;  4Z2T A;  2EQ8 A;  3V76 A;  2R0P A;  1GAL A;  3LZX A;  2C70 A;  2WPE A;  2XDO A;  3UKA A;  3G5S A;  1ZOV A;  2JB3 A;  3CGC A;  3P9U A;  1P2E A;  3C96 A;  2ACZ A;  4EMW A;  1E1M A;  2BXS A;  2XVE A;  3SZ0 A;  3UKH A;  1S2Y A;  3Q6J A;  2OAM A;  4L3X A;  1DOE A;  2C3D A;  4M52 A;  2BK4 A;  2XVH A;  3FG2 P;  2GF3 A;  4II3 A;  3H4K A;  3E1T A;  5L46 A;  1REO A;  3ABV A;  4FX9 A;  1LQU A;  1SP3 A;  3CIR A;  1D4C A;  1N4W A;  3M12 A;  4H4Z A;  4JNA A;  4Y4M A;  3VRB A;  2Z5Y A;  2V3B A;  2XVI A;  1H83 A;  4IA6 A;  4YSX A;  4J2W A;  4AT2 A;  3GM6 A;  3AD9 B;  4UP3 A;  4K22 A;  1L9E A;  1FEC A;  2WDQ A;  4A6N B;  3QJ4 A;  4JN9 A;  4A6N A;  1YY5 A;  4J31 A;  2RF7 A;  2WEU A;  4JY3 A;  4A9W A;  4BK3 A;  2VOU A;  4H2R A;  1OJA A;  4Y4N A;  4B67 A;  4C77 A;  1RP0 A;  4FK1 A;  4C5O A;  3CTY A;  5TR3 A;  4LA1 A;  4NWZ A;  1BZL A;  3FMW A;  1CC6 A;  3UU9 A;  4GDP A;  3GMB A;  2RAB A;  2QCU A;  4YSZ A;  4ZN0 A;  2GVC A;  4OPD A;  3NYE A;  4D03 A;  2BCP A;  3DK9 A;  2C7G A;  2J3N A;  2GR0 A;  2R9Z A;  4G74 A;  3S5W A;  1V59 A;  4B68 A;  5BVA A;  4OPU A;  1PXA A;  3ALJ A;  1GRA A;  4AOX A;  3UTF A;  1BWC A;  1JRX A;  3NK2 X;  3SZW A;  4CNK A;  3GD4 A;  1NDA A;  3BI2 A;  5KMP A;  3IHM A;  3GDN A;  3KPF A;  2YAU A;  4Z24 A;  4JY2 A;  5FS6 A;  3AEA A;  1O95 A;  4YT0 A;  4TLX A;  4B69 A;  3L1T A;  2JBV A;  2C64 A;  4Q5B A;  1TYP A;  1TDO A;  2VQB A;  4Y4L A;  3UP4 A;  1GTE A;  3AB1 A;  2YG6 A;  4RG4 A;  4EQS A;  4J57 A;  4Z43 A;  4H4S A;  2XLP A;  1N1P A;  1IUU A;  3BI5 A;  3UKL A;  4Q5C A;  4U8I A;  4I58 A;  2YQU A;  4YTM A;  4C74 A;  4G73 A;  5KXJ A;  4H4Q A;  1IJH A;  1YQ3 A;  2YG5 A;  2XLR A;  3NG7 X;  1BF3 A;  4AP3 A;  3RKH A;  5HXI A;  3P1W A;  2X8G A;  1D7L A;  4OPT A;  3HZL A;  4OPL A;  4BV6 A;  4IV9 A;  4DSH A;  3LB8 A;  4YKG A;  5U25 A;  3H8L A;  2WPC A;  3OC4 A;  3Q9T A;  2R4J A;  2V6O A;  1TDN A;  3ADA B;  4U2T A;  3SGL A;  4J33 A;  4MJW A;  4TM3 A;  1FT6 A;  1NHQ A;  3WE0 A;  1NEK A;  2GEW A;  1PDH A;  2GQW A;  2Q0L A;  3AEF A;  1BGN A;  3COX A;  1NPX A;  4JNQ A;  1H6V A;  4J34 A;  4KX6 A;  3CGB A;  3NK1 X;  5HHF A;  2BS2 A;  1DOB A;  3PO7 A;  1VG0 A;  3SY4 A;  4H2P A;  1N4U A;  1F8W A;  1LPF A;  4CCR A;  1CJ2 A;  1GET A;  2DKH A;  3LJP A;  4H4Y A;  3TOR A;  3AWI A;  4CY8 A;  1F6M A;  3BNG A;  2AR8 A;  5KVI A;  3NN6 X;  1S3B A;  2BK5 A;  2C67 A;  3KVE A;  3QFA A;  4YKF A;  3EPT A;  4U8J A;  2I0Z A;  3CND A;  5ER0 A;  3K30 A;  2W0H A;  2VRM A;  1NEN A;  4OPG A;  5C2T A;  2BAB A;  4H4V A;  4X9N A;  1DOD A;  3LGQ A;  2C65 A;  4LU6 A;  2OAL A;  4AT0 A;  4Z26 A;  1PN0 A;  2BCG G;  2B76 A;  3ICT A;  3LXD A;  1LQT A;  4CBQ A;  1QDB A;  3AE3 A;  3SFE A;  2YLX A;  4OCG A;  4AP1 A;  1M1R A;  1JEH A;  2XCG A;  1Q1R A;  2B9X A;  2XFU A;  1H82 A;  1KDG A;  4YTN A;  2VR0 A;  4U8K A;  3F29 A;  1EBD A;  3BI4 A;  3JSK A;  1CC4 A;  3BNF A;  3CNJ A;  4G9K A;  5EB4 A;  4Q0T A;  3F8R A;  3T31 A;  2WOV A;  4WJY A;  3D1C A;  3V3N A;  3C4N A;  3SX6 A;  3FPZ A;  4OVI A;  5KMS A;  2JB1 A;  3P4R A;  5JCK A;  4JQ9 A;  4NTD A;  1GPE A;  2YLT A;  1E6E A;  4CCQ A;  4J56 A;  1JOA A;  1CJ3 A;  4PAB A;  3AYL A;  2RDZ A;  3P4S A;  4BJY A;  1IUT A;  3GMC A;  3IWA A;  2CVJ A;  3IC9 A;  1NHS A;  2JAE A;  2XFP A;  1BKW A;  2Y6Q A;  4I59 A;  2C76 A;  4EQR A;  3DME A;  3P4Q A;  1PBC A;  3AEC A;  4B66 A;  3FBS A;  3NNE A;  2APG A;  1CBO A;  2B7S A;  2BC1 A;  2YG3 A;  1GRF A;  3BHF A;  2E80 A;  2E5V A;  2QA1 A;  2YM1 A;  3BNJ A;  4Q4U A;  4LII A;  2OLN A;  5KNL A;  3F8P A;  2DKI A;  3GWD A;  4N9X A;  3URH A;  4BUR A;  1GTH A;  1E1N A;  3GRS A;  4XXG A;  1ZMC A;  5FMH A;  4TM4 A;  4DSG A;  2FJA A;  3UOV A;  3AED A;  4PAA A;  3ZYX A;  3QSS A;  1LJ1 A;  2ZBW A;  4EMJ A;  3GYX A;  1TDE A;  3LZW A;  4X9M A;  4K2X A;  2GR3 A;  2AAQ A;  3R9U A;  1NHP A;  3T37 A;  3DH9 A;  4NEW A;  2FJD A;  2Q6U A;  1JNI A;  5CQF A;  4B63 A;  1N4V A;  2K3V A;  1GRT A;  4Q1O A;  3I3L A;  2H89 A;  2ZZ0 A;  1BVB A;  1XAN A;  3O0H A;  1FS7 A;  3P4P A;  1CL0 A;  1FL2 A;  1ZX9 A;  4U8N A;  3GYI A;  4K8D A;  1IUW A;  2BRY A;  1GRE A;  1IUX A;  1Q9I A;  1PBB A;  4EIP A;  3D8X A;  1FEB A;  1NHR A;  2GAH B;  2RGJ A;  3F8D A;  1IUV A;  5KOX A;  5M10 A;  2GH5 A;  4U8M A;  1H86 A;  2YG7 A;  1GOS A;  2GRT A;  3CGD A;  1COY A;  3RED A;  1GXF A;  3UBR A;  4YSH A;  1MXT A;  3M13 A;  2TMD A;  3ATQ A;  3RP8 A;  1KNP A;  1XDI A;  2XVF A;  4EQW A;  1KF6 A;  4ZCD A;  2JB2 A;  5IQ1 A;  4Z44 A;  4RSL A;  4Z2U A;  4GRT A;  2VZ2 A;  2ARD A;  2V61 A;  1D4E A;  1M1Q A;  1LV0 A;  2YVF A;  1DJQ A;  2X50 A;  2JK6 A;  4L38 A;  2BS4 A;  2V5Z A;  3QVR A;  4GCM A;  5GRT A;  1ZKQ A;  3DGH A;  2BK3 A;  5KMR A;  1GT8 A;  1EL9 A;  2R0G A;  2X8C A;  2HQM A;  4U8L A;  2WET A;  2XLS A;  3T2Z A;  1B8S A;  1RSG A;  1GU6 A;  3T2K A;  2Q7V A;  1L9D A;  4H2Q A;  2IVD A;  4NZH A;  4X4J A;  5GSN A;  3NK0 X;  3UOY A;  3FIM B;  1XHC A;  3GYJ A;  3VR9 A;  4UDR A;  2Z5X A;  3UP5 A;  4B65 A;  2WHD A;  2FJB A;  2ZZB A;  3AE6 A;  4A99 A;  1S2Q A;  1K4Q A;  1E39 A;  4WX1 A;  2BRA A;  4DGK A;  4UDQ A;  2YR6 A;  2YR4 A;  3LAD A;  4NTC A;  3CN8 A;  5FS9 A;  2V60 A;  4IVO B;  1FS8 A;  5FS8 A;  4GAV A;  4ADW A;  3UKP A;  1FCD A;  2A8X A;  3M0O A;  4HB9 A;  4EMI A;  5HY5 A;  4Q17 A;  2YLS A;  3KD9 A;  3NTD A;  2C75 A;  1PXC A;  1VRQ B;  1M6I A;  3L1R A;  4YTP A;  1CJ4 A;  4P9S A;  2IVE A;  4H50 A;  2XVJ A;  4U2S A;  3ICS A;  2WPF A;  2OT4 A;  1MOK A;  1ZP0 A;  3SXQ A;  1EL8 A;  3K7Q X;  1EL5 A;  3HYX A;  3DJD A;  1GV4 A;  1ZOY A;  1F8R A;  2A87 A;  2CDU A;  2WOI A;  1JNR A;  4G6H A;  2XYO A;  4U8P A;  4H4X A;  3BNU A;  3KPK A;  3S7W A;  1CJC A;  1ZMD A;  5U63 A;  1QO8 A;  3ALL A;  2XLU A;  2GMJ A;  2X3N A;  4GDE A;  3QFB A;  3SQP A;  4YWO A;  3VR8 A;  1EL7 A;  2C3C A;  2C72 A;  5EOW A;  2QA2 A;  4A5L A;  3UKF A;  1NAA A;  3KLJ A;  3KU9 A;  1TRB A;  3GSI A;  4EM4 A;  3EAN A;  1GRG A;  1PBF A;  3DJE A;  3CNP A;  5HYM A;  3G5Q A;  5KOW A;  1PXB A;  1F8S A;  1HYU A;  2YM2 A;  4O5U A;  3UCL A;  1NG4 A;  2R46 A;  4H4T A;  4E0V A;  3NN0 X;  3L8K A;  2UZZ A;  1TDK A;  1YKJ A;  2VVL A;  4OPC A;  4CNJ A;  1S3E A;  1DJN A;  2WP5 A;  3AE8 A;  2YVJ A;  3BHK A;  4Z25 A;  1OAH A;  1O5W A;  3CPI G;  1ELI A;  2GR2 A;  3V3O A;  3DJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...