1JRYA

Crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTKDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jryA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jryA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jryA01
1CJ3A 1OJTA 1PBCA 3VR8A 3ALLA 2YG5A 3GDPA 2YLZA 1TDOA 3GRTA 1RP0A 4AT2A 3ITJA 3UTGA 4TM1A 3GYXA 4H2NA 2A8XA 3LADA 1B4VA 3UTFA 1EBDA 4K5SA 2GAGB 3L1RA 2GB0A 4GDEA 2V6OA 4FDCB 3SFEA 4Z25A 2BC0A 1EL9A 1FEAA 1BVBA 2GQFA 1QJDA 3AD7B 1CJ4A 3FPZA 3Q6JA 1GRTA 4U8LA 3KA7A 3DK9A 3QVPA 1CC4A 2H89A 2WQYA 4JNAA 3NK1X 2A87A 4K22A 1D4CA 1KF6A 2TPRA 3DA1A 3GMBA 2XLPA 3QJ4A 3CNTA 1JU2A 4CBQA 1QDBA 3KVEA 3UBRA 4CNKA 2C64A 2Y6QA 1PJ7A 2GH5A 1HYUA 4UDPA 4U8PA 2GEWA 2VZ2A 2NVKX 2A89A 5FS8A 5CKUA 4A6NA 1KSUA 4EMWA 1GETA 4U8NA 3CNPA 3NK2X 5L46A 2E81A 1F8RA 2C67A 2YWLA 1CC6A 3H8IA 3UCLA 1LPFA 3R9UA 1CC2A 1QLBA 1GU6A 3OWMA 1XANA 1K0LA 3QVRA 1CJCA 3CIRA 1MOKA 1ZDLA 2E4GA 2R4JA 3DK4A 4YKGA 2BYBA 4GCMA 2E80A 2V3BA 4Z43A 1LQUA 2R0PA 2WESA 3EF6A 5TR3A 3VRDB 4OPDA 4B68A 1FT6A 1CF3A 1SEZA 4I58A 4J34A 3UOYA 4NTCA 1P2EA 1K0JA 2HQMA 4A79A 4C74A 1F6MA 1EL7A 2BK3A 4X9MA 3ABVA 4H2RA 3GYIA 3AEGA 3MMOA 1FL2A 2XLRA 3P4RA 3BNFA 4LA1A 2R9ZA 1PHHA 2RF7A 3UP4A 2ACZA 2Q0LA 3BNGA 3S7WA 2QA1A 4J31A 5J7XA 4ADWA 4Z2RA 1FECA 1NG4A 3UKKA 3I6DA 3LZWA 3TORA 5FS6A 3P9UA 3VRAA 1KDGA 4IA6A 1B37A 1IUUA 4X4JA 3RP6A 1FT5A 3AYLA 4OCGA 3BI2A 3F8PA 2JB1A 2C73A 2X3NA 2EQ8A 3AD9B 3ALMA 3BI5A 4B65A 1N4VA 4DGKA 2Q0KA 2AAQA 2WPEA 4RG4A 1L0VA 4YSHA 1ZMCA 3D1IA 3GSIA 4H4QA 2YQUA 3V3OA 1BF3A 1E1KA 1MO9A 4A7AA 1JRYA 2H88A 1ZOVA 4EMJA 2OAMA 1B8SA 2XYOA 4JY3A 4TM0A 3RP7A 5IQ4A 2O9ZA 3G5QA 1JNIA 5JCKA 1NPXA 3C96A 1GXFA 4TM4A 3OZ2A 4HA6A 3ZYXA 1K4QA 2QAEA 1BGNA 2EQ6A 4C3XA 1D4EA 3LJPA 3M13A 3P1WA 2XVFA 4X9NA 1H83A 4UDQA 2B9WA 4Y4LA 2I0ZA 1GRAA 5C3JA 1GTEA 5C2TA 1PJ6A 5FS9A 4Z26A 2GRTA 1YQ4A 4EQWA 4JDRA 4H4ZA 3AE4A 1VG9A 3RP8A 4A65A 5BULA 5HYMA 2YLTA 5GSNA 3F29A 4CY6A 3B6DA 2GR3A 3GMCA 1DOEA 2BK5A 2WDVA 4CCQA 1M1RA 2YG3A 3DGZA 2E1MA 1BWCA 2VVLA 2GR1A 2APGA 4IVOB 1PXAA 2IIDA 1TYPA 5U25A 2WPFA 1TDFA 1YQ3A 1CL0A 4JQ9A 4BK1A 1XHCA 1PBEA 3C4NA 1GALA 4L3ZA 2BA9A 3K7QX 1H6VA 1GREA 3GWFA 4U8OA 4U8JA 5U1OA 3EANA 1TYTA 3M0OA 5ER0A 4Q4UA 4OVIA 5JCNA 1LJ1A 4ZCCA 3GD3A 2B9XA 4AOXA 1QO8A 1XPQA 3S5WA 1ZY8A 4J2WA 4EIPA 2YVFA 4B67A 4JNQA 3SCEA 5J60A 2X8GA 1S3EA 3KU9A 2XVEA 4BV6A 4H7UA 5BVAA 3GYJA 1DNCA 4TLXA 4L3XA 4FK1A 1KNRA 3DJGX 1E1LA 2AQJA 5BUKA 1ZP0A 3NYEA 4K7ZA 4AP3A 3DJEA 3P4PA 4REKA 2CDUA 1VG0A 5DBJA 1NAAA 2WPCA 4YXDA 2WDQA 4KX6A 1IJHA 2X50A 2C7GA 5KRQA 3DMEA 3KKJA 1DJQA 1N4WA 3AXBA 1S2YA 4A99A 4Z44A 3DH9A 5IPYA 2XFPA 1EL5A 1F8SA 3IHGA 4A9WA 3SM8A 1OAHA 1GT8A 3I3LA 1ZMDA 4K5RA 4U2LA 4L3YA 3AEFA 4NEVA 4C3YA 3ICSA 3K30A 2XDOA 1JNRA 3CN8A 4GR1A 3EAOA 2OALA 1B5QA 1K0IA 2OLNA 2YR5A 4P9SA 3LB8A 1L9DA 3H4KA 1PXBA 2XVJA 2NPXA 2RGHA 4AOSA 1GRHA 4ECHA 3COXA 4B66A 3E1TA 4PABA 3AE5A 3CTYA 2R45A 3AYJA 3NYCA 1TDKA 4DSHA 3LXDA 3UTHA 2YAUA 2XLTA 3AE2A 1GV4A 2GR2A 3F8RA 4NEWA 4AP1A 1NEKA 2VOUA 3HZLA 3ALJA 2BCPA 4U8KA 2VQ7A 1D4DA 1YKJA 4U2SA 4Q5CA 2K3VA 3LG1A 3SXQA 2RGJA 1M1QA 4I59A 4J56A 2YLRA 4Q1OA 2BS3A 3NT6A 2UZZA 1GTHA 2YG7A 3AE8A 4J36A 3UKQA 2ZBWA 2BXSA 2EQ9A 1GEUA 1O5WA 2BS4A 3S61A 1H7XA 1X31B 3AE9A 5JCMA 3B3RA 1SP3A 4WX1A 1YY5A 3P4QA 3UKAA 1NHPA 4CY8A 3AECA 1IUTA 2PYXA 4N9XA 1M1PA 2WOVA 3ADAB 3AE1A 4GF7A 3AEEA 2IVEA 2JBVA 2WOWA 2ZZCA 3URHA 5HY5A 5JCIA 2VQBA 3JSKA 4Q17A 2ARDA 4LIIA 2R0CA 4USRA 3CPJG 1DODA 3NTAA 4H4RA 4JN9A 4USQA 4DSGA 3ATRA 2B7SA 1D7YA 1VQWA 4L38A 3UU9A 1DOBA 2WP6A 4D04A 2FJDA 4Z2UA 4Q0TA 3NN0X 4Y4MA 3UOZA 1E1MA 3KPFA 5U63A 5KWFA 3AE3A 2GAHB 1IUVA 4KPRA 1P2HA 4OPCA 2BXRA 3FO3A 1PN0A 4EIQA 3D8XA 1FCDA 1E7PA 1F3PA 1ZKQA 3REDA 1OJDA 1XDIA 2XLUA 1VDCA 2GR0A 2BACA 2VVLG 4K2XA 4Z2TA 2R0GA 2C66A 5HXIA 3BNUA 3SQPA 2J3NA 2XVHA 3GDNA 1JEHA 4EM4A 3VQRA 3L1TA 4XWRA 3BHFA 2XLSA 1TDNA 4YTMA 3CGCA 3KLJA 4UP3A 1ONFA 4FK1C 2RABA 4EMIA 2JB3A 2YM2A 5HHFA 3RNMA 4OPIA 4RG3A 2FJBA 4YWOA 4B64A 4YSZA 3BNMA 1NHRA 2AR8A 4EQXA 4A6NB 2V60A 2BABA 3PO7A 4RSLA 2ZZ0A 3QFBA 4J33A 2GV8A 2CVJA 1GERA 5M0ZA 2GF3A 3VRBA 1AOGA 2VRMA 4OPUA 1ELIA 2C65A 1LQTA 4H4PA 3RHAA 2IVDA 1BGJA 2JB2A 2WHDA 4ZCDA 2WOIA 2C70A 2E5VA 3AB1A 1D7LA 2Z5YA 4IVMB 1GRFA 1D5TA 3CGEA 2XCGA 3ICTA 4BK2A 4B69A 2VR0A 1VRQB 4H4YA 3UKFA 4A5LA 4EQRA 2J7AA 5LV9A 4GUVA 1DJNA 3DK8A 3QSSA 2XVIA 3CPIG 3O0HA 2FJEA 3PS9A 3PVCA 4H4VA 3RKHA 4H4SA 1Y0PA 1NG3A 3WE0A 1RSGA 3L8KA 1S2QA 1Z6LA 3QSMA 2JAEA 1FS7A 2JKCA 5BRTA 1Y56A 3NLCA 2X8CA 5EB4A 1O95A 3NKSA 2OA1A 3ICRA 4AT0A 1PBFA 1UKVG 1YQZA 3UOXA 3AE6A 1GSNA 2R46A 1JRZA 1L9EA 1Q1WA 2QCUA 3GRSA 1Q1RA 4EM3A 4LU6A 2DKHA 3NNEA 4IA5A 1DOCA 4CCRA 2TMDA 2ZZBA 3D1CA 3AE7A 1BZLA 3ATQA 2X99A 3II4A 4U8MA 1H82A 1GPEA 1ZK7A 2FBWA 3FBSA 4MJWA 4YTNA 5KVHA 1IUWA 1GRBA 4J57A 2CFYA 3OC4A 3ISHA 4O5QA 3M12A 4XXGA 4WJYA 2RGOA 4ICYA 3UOVA 3AEBA 3CGDA 5KVIA 1FOHA 3G5RA 4Z24A 5EBKA 2B7RA 2LFCA 4Y4NA 2C3DA 3VR9A 3AD8B 2BK4A 3DJJA 1Q9IA 1IUXA 2BCGG 2YG6A 2YLSA 4OPLA 4YKFA 2YLXA 5EB5A 3F8DA 5KXJA 1KSSA 3BNJA 1H84A 2WP5A 1PXCA 3NYFA 4TLZA 3Q9TA 1Y56B 3NRNA 2YVJA 4E0VA 1O94A 2DKIA 2YR4A 3FIMB 2GQWA 3CNDA 1LVLA 1PDHA 3NN6X 4IV9A 3KD9A 1PBDA 2C72A 1OJAA 1FEBA 5GRTA 4U2TA 4BJZA 4U8IA 3CNJA 4H4UA 3DGHA 3NH3X 1GESA 1NDAA 3NHOX 3T37A 3AEAA 1TRBA 4OPGA 3NIXA 1L9CA 5FMHA 2YR6A 4C5OA 2B9YA 3IHMA 3V3NA 2WU2A 2YVGA 1V59A 2WU5A 2VRLA 4YSXA 1E1NA 4H4WA 4H4TA 4FX9A 5CQFA 4B63A 4DNAA 4BJYA 1KNPA 4O5UA 4GRTA 1TDEA 4NZHA 1N4UA 1GNDA 2R4EA 1CHUA 2OLOA 2YM1A 4APNA 3IC9A 4BK3A 3LGQA 1PS9A 4WCTA 3IWAA 2WETA 4CRTA 3FMWA 3K7TA 4JY2A 1M6IA 1NHQA 2GMJA 1MXTA 2V61A 4PAAA 1LTXR 4CNJA 2WBAA 3CNSA 3V76A 1FS8A 2XFNA 3BHKA 4TM3A 2Y6RA 4H2PA 4NTDA 1CJ2A 3IF9A 1OJCA 2C76A 4Q5BA 1ZX9A 3CPHG 4NTEA 1E39A 2GVCA 4ZN0A 2C3CA 1H81A 4M52A 1RYIA 1JOAA 3GWDA 3DJDA 2QA2A 3GD4A 3UKPA 4BURA 3K7MX 4XWZA 2C75A 2WP9A 3LOVA 5JCLA 5M10A 3NGCX 3BNHA 1REOA 4K8DA 1DXLA 3NTDA 3C4AA 1PBBA 3UP5A 1BKWA 5IQ1A 2X8HA 3G5SA 4B1BA 3GM6A 3AWIA 3CGBA 5FS7A 2CULA 1PJ5A 1W4XA 3BI4A 3UKHA 1NHSA 2JK6A 1JRXA 2EQ7A 2Q6UA 2WS3A 1GRGA 2YLWA 2Z5XA 3EPTA 3NK0X 2W0HA 4H50A 4YTPA 2XFUA 4H2QA 1JNZA 4GDPA 1GOSA 3UKLA 4YT0A 1N1PA 3AEDA 3H8LA 1F8WA 3NG7X 2B76A 1KFYA 1E6EA 3SGLA 5KOWA 2VVMA 4H4XA 1NENA 1COYA 2F5ZA 2XFOA 3ZDNA 2OT4A 2FJAA 3QFAA 5KOXA 5EOWA 4HB9A 4OPTA 3AYIA 3LZXA 2V3AA 2RDZA 1EL8A 2BC1A 2Q7VA 3P4SA 2WEUA 4YSYA 2V5ZA 3SFDA 3UTEA 4D03A 1ZOYA 3QSEA 1M64A 2GMHA 3TTBA 4C77A 2PHHA 1IUSA 1S3BA 1CBOA 4EQSA 2ZO5A 2BS2A 1H86A 1FS9A 2YG4A 1OJ9A 1LV0A 1H7WA 3FG2P 2XFQA 2WDRA 4UDRA
chains in the Genus database with same CATH superfamily
1CJ3A 1OJTA 1PBCA 3VR8A 3ALLA 2YG5A 3GDPA 2YLZA 1TDOA 3GRTA 1RP0A 4AT2A 3ITJA 3UTGA 3GYXA 4TM1A 4H2NA 2A8XA 3LADA 1B4VA 3UTFA 1EBDA 4K5SA 2GAGB 3L1RA 2GB0A 4GDEA 2V6OA 4FDCB 3SFEA 4Z25A 2BC0A 1EL9A 1FEAA 1BVBA 2GQFA 1QJDA 3AD7B 1CJ4A 3FPZA 3Q6JA 1GRTA 4U8LA 3KA7A 3DK9A 3QVPA 1CC4A 2H89A 2WQYA 4JNAA 3NK1X 2A87A 4K22A 1D4CA 1KF6A 2TPRA 3DA1A 3GMBA 2XLPA 3QJ4A 3CNTA 3T2ZA 1JU2A 4CBQA 1QDBA 3KVEA 3UBRA 4CNKA 2C64A 2Y6QA 1PJ7A 2GH5A 1HYUA 4UDPA 4U8PA 2GEWA 2VZ2A 2NVKX 2A89A 5FS8A 5CKUA 4A6NA 1KSUA 4EMWA 1GETA 4U8NA 3CNPA 3NK2X 4II2A 5L46A 2E81A 1F8RA 2C67A 2YWLA 1CC6A 3H8IA 3UCLA 1LPFA 3R9UA 1CC2A 1QLBA 1GU6A 3OWMA 1XANA 1K0LA 3QVRA 1CJCA 3CIRA 1MOKA 1ZDLA 2E4GA 2R4JA 3DK4A 4YKGA 2BYBA 4GCMA 2E80A 2V3BA 4Z43A 1LQUA 2R0PA 2WESA 3EF6A 5TR3A 3VRDB 4OPDA 4B68A 1FT6A 1CF3A 1SEZA 4GAVA 4I58A 4J34A 3UOYA 4NTCA 1P2EA 1K0JA 2HQMA 4A79A 4C74A 1F6MA 1EL7A 2BK3A 4X9MA 3ABVA 4H2RA 3GYIA 3AEGA 3MMOA 1FL2A 2XLRA 3P4RA 3BNFA 4G9KA 4G74A 3SZWA 4LA1A 3T14A 2R9ZA 1PHHA 2RF7A 3UP4A 2ACZA 2Q0LA 3BNGA 3S7WA 2QA1A 4J31A 5J7XA 4ADWA 4Z2RA 1FECA 1NG4A 3UKKA 3I6DA 3LZWA 3TORA 5FS6A 3P9UA 3VRAA 1KDGA 4IA6A 1B37A 1IUUA 4X4JA 3RP6A 1FT5A 3AYLA 4OCGA 3BI2A 3F8PA 2JB1A 2C73A 2X3NA 2EQ8A 3AD9B 3ALMA 3BI5A 4B65A 1N4VA 4DGKA 2Q0KA 2AAQA 2WPEA 4RG4A 1L0VA 4YSHA 1ZMCA 3D1IA 3GSIA 4H4QA 2YQUA 3V3OA 1BF3A 1E1KA 1MO9A 4II3A 3SYIA 1JRYA 2H88A 1ZOVA 4EMJA 2OAMA 1B8SA 2XYOA 4JY3A 4TM0A 3RP7A 5IQ4A 2O9ZA 3G5QA 1JNIA 5JCKA 1NPXA 3C96A 1GXFA 4TM4A 3OZ2A 4HA6A 3ZYXA 1K4QA 2QAEA 1BGNA 2EQ6A 4C3XA 1D4EA 3LJPA 3M13A 3P1WA 2XVFA 4X9NA 1H83A 4UDQA 2B9WA 4Y4LA 2I0ZA 1GRAA 5C3JA 1GTEA 5C2TA 1PJ6A 5FS9A 4Z26A 2GRTA 1YQ4A 4EQWA 4JDRA 4H4ZA 3AE4A 1VG9A 3RP8A 4A65A 5BULA 5HYMA 2YLTA 5GSNA 3F29A 4CY6A 3B6DA 2GR3A 3GMCA 1DOEA 2BK5A 2WDVA 3SZCA 4CCQA 3KPKA 1M1RA 2YG3A 3DGZA 2E1MA 1BWCA 2VVLA 2GR1A 2APGA 4IVOB 1PXAA 2IIDA 1TYPA 5U25A 2WPFA 1TDFA 1YQ3A 1CL0A 4JQ9A 4BK1A 1XHCA 1PBEA 3C4NA 1GALA 4L3ZA 2BA9A 3K7QX 1H6VA 1GREA 3GWFA 4U8OA 4U8JA 5U1OA 3EANA 1TYTA 3M0OA 5ER0A 4Q4UA 4OVIA 5JCNA 1LJ1A 4ZCCA 3GD3A 2B9XA 4AOXA 1QO8A 1XPQA 3S5WA 1ZY8A 4J2WA 4EIPA 2YVFA 4B67A 4JNQA 3SCEA 5J60A 2X8GA 1S3EA 3KU9A 2XVEA 4BV6A 4H7UA 5BVAA 3GYJA 1DNCA 4TLXA 4L3XA 4FK1A 1KNRA 3DJGX 1E1LA 2AQJA 5BUKA 1ZP0A 3NYEA 4K7ZA 4AP3A 3DJEA 3P4PA 4REKA 2CDUA 1VG0A 5DBJA 1NAAA 2WPCA 4YXDA 2WDQA 4KX6A 1IJHA 2X50A 2C7GA 5KRQA 3DMEA 3KKJA 1DJQA 1N4WA 3AXBA 4G6GA 1S2YA 3T31A 4Z44A 3DH9A 4A99A 5IPYA 2XFPA 1EL5A 1F8SA 3IHGA 4A9WA 3SM8A 1OAHA 1GT8A 3I3LA 1ZMDA 4K5RA 4U2LA 4L3YA 3AEFA 4NEVA 4C3YA 3ICSA 3K30A 2XDOA 1JNRA 3CN8A 4GR1A 3EAOA 2OALA 3T0KA 1B5QA 1K0IA 2OLNA 2YR5A 4P9SA 3LB8A 1L9DA 3H4KA 1PXBA 2XVJA 2NPXA 2RGHA 4AOSA 1GRHA 4ECHA 3COXA 4B66A 3E1TA 4PABA 3AE5A 3CTYA 3CMMA 2R45A 3AYJA 3NYCA 1TDKA 4DSHA 3LXDA 3UTHA 2YAUA 2XLTA 3AE2A 1GV4A 2GR2A 3F8RA 4NEWA 4AP1A 1NEKA 2VOUA 3HZLA 3ALJA 2BCPA 4U8KA 2VQ7A 1D4DA 1YKJA 4U2SA 4Q5CA 2K3VA 3LG1A 3SXQA 2RGJA 1M1QA 3SX6A 4I59A 4J56A 2YLRA 4Q1OA 2BS3A 3NT6A 2UZZA 1GTHA 2YG7A 3AE8A 4J36A 2CZSA 3UKQA 2ZBWA 2BXSA 2EQ9A 1GEUA 1O5WA 2BS4A 3S61A 1H7XA 1X31B 3AE9A 5JCMA 3B3RA 1SP3A 4WX1A 1YY5A 3P4QA 3UKAA 1NHPA 4CY8A 3AECA 1IUTA 2PYXA 4N9XA 1M1PA 2WOVA 3ADAB 3AE1A 3HYWA 3AEEA 2IVEA 2JBVA 2WOWA 2ZZCA 4GF7A 3URHA 5HY5A 2VQBA 3JSKA 5JCIA 4Q17A 2ARDA 4LIIA 2R0CA 4USRA 3CPJG 1DODA 3NTAA 4H4RA 4JN9A 4USQA 4DSGA 3ATRA 2B7SA 1D7YA 1VQWA 4L38A 3UU9A 1DOBA 2WP6A 4D04A 2FJDA 4Z2UA 4Q0TA 3NN0X 4Y4MA 3UOZA 1E1MA 3KPFA 5U63A 5KWFA 3AE3A 2GAHB 1IUVA 4KPRA 1P2HA 4OPCA 2BXRA 3FO3A 1PN0A 4EIQA 2C4CA 3D8XA 1FCDA 1E7PA 1F3PA 1ZKQA 3REDA 1OJDA 1XDIA 2XLUA 1VDCA 2GR0A 2BACA 2VVLG 4K2XA 4Z2TA 2R0GA 2C66A 5HXIA 3BNUA 3SQPA 2J3NA 2XVHA 3GDNA 1JEHA 4EM4A 3VQRA 3L1TA 4XWRA 3BHFA 2XLSA 1TDNA 4YTMA 3CGCA 3KLJA 4UP3A 1ONFA 4FK1C 2RABA 4EMIA 2JB3A 2YM2A 5HHFA 3RNMA 4OPIA 4RG3A 2FJBA 4YWOA 4B64A 4YSZA 3BNMA 1NHRA 2AR8A 4EQXA 4A6NB 2V60A 2BABA 3T2YA 3PO7A 4RSLA 2ZZ0A 3QFBA 4J33A 2GV8A 2CVJA 1GERA 5M0ZA 2GF3A 3VRBA 1AOGA 2VRMA 4OPUA 1ELIA 2C65A 1LQTA 3HYVA 4H4PA 3RHAA 2IVDA 1BGJA 2JB2A 2WHDA 4ZCDA 2WOIA 2C70A 2E5VA 3AB1A 1D7LA 2Z5YA 4IVMB 1GRFA 1D5TA 3CGEA 2XCGA 3ICTA 4BK2A 4B69A 2VR0A 1VRQB 4H4YA 3UKFA 4A5LA 4EQRA 2J7AA 2BRAA 4GUVA 5LV9A 1DJNA 3DK8A 3QSSA 2XVIA 3CPIG 3O0HA 2FJEA 3PS9A 3PVCA 4H4VA 3RKHA 4H4SA 1Y0PA 1NG3A 3WE0A 1RSGA 3L8KA 1S2QA 1Z6LA 3QSMA 2JAEA 1FS7A 2JKCA 5BRTA 1Y56A 3NLCA 2X8CA 5EB4A 1O95A 3NKSA 2OA1A 3ICRA 4AT0A 1PBFA 1UKVG 1YQZA 3UOXA 3AE6A 1GSNA 2R46A 1JRZA 1L9EA 1Q1WA 2QCUA 3GRSA 3SZFA 1Q1RA 4EM3A 4LU6A 2DKHA 3NNEA 4IA5A 1DOCA 4G73A 4CCRA 2TMDA 2ZZBA 3D1CA 3AE7A 1BZLA 3ATQA 2X99A 3II4A 4NNJA 1H82A 4U8MA 1GPEA 2BRYA 1ZK7A 2FBWA 4NWZA 3FBSA 4MJWA 4YTNA 5KVHA 1IUWA 1GRBA 4J57A 2CFYA 3OC4A 3SXIA 5KNLA 3ISHA 4O5QA 3M12A 4XXGA 4WJYA 2RGOA 4ICYA 3UOVA 3AEBA 3CGDA 5KVIA 1FOHA 4G6HA 5KMSA 3G5RA 4Z24A 5EBKA 3T2KA 2B7RA 2LFCA 4Y4NA 2C3DA 3VR9A 3AD8B 2BK4A 3DJJA 1Q9IA 1IUXA 2BCGG 2YG6A 3SY4A 2YLSA 4OPLA 4YKFA 2YLXA 5EB5A 3F8DA 5KXJA 1KSSA 3BNJA 1H84A 2WP5A 1PXCA 3NYFA 4TLZA 3Q9TA 1Y56B 3NRNA 2YVJA 4E0VA 1O94A 2DKIA 2YR4A 3FIMB 2GQWA 3CNDA 1LVLA 1PDHA 3NN6X 4IV9A 3KD9A 1PBDA 2C72A 5KMPA 1OJAA 1FEBA 5GRTA 4U2TA 4BJZA 4U8IA 3CNJA 4H4UA 3DGHA 3NH3X 1GESA 1NDAA 3NHOX 3T37A 3AEAA 4A7AA 1TRBA 4OPGA 3NIXA 1L9CA 5FMHA 2YR6A 4C5OA 2B9YA 3IHMA 3V3NA 2WU2A 2YVGA 1V59A 2WU5A 2VRLA 4YSXA 1E1NA 4H4WA 4H4TA 4FX9A 5CQFA 4B63A 4DNAA 5KMRA 4BJYA 1KNPA 4O5UA 4GRTA 1TDEA 4NZHA 1N4UA 1GNDA 2R4EA 1CHUA 2OLOA 2YM1A 4APNA 3IC9A 4BK3A 3LGQA 1PS9A 4WCTA 3IWAA 2WETA 4CRTA 3FMWA 3K7TA 4JY2A 1M6IA 1NHQA 2GMJA 1MXTA 2V61A 4PAAA 1LTXR 4CNJA 2WBAA 5KMQA 3CNSA 3V76A 1FS8A 2XFNA 3BHKA 4TM3A 2Y6RA 4H2PA 4NTDA 1CJ2A 3IF9A 1OJCA 2C76A 4Q5BA 1ZX9A 3CPHG 4NTEA 1E39A 2GVCA 4ZN0A 2C3CA 1H81A 4M52A 1RYIA 1JOAA 3GWDA 3DJDA 2QA2A 3GD4A 3UKPA 4BURA 3K7MX 4XWZA 2C75A 2WP9A 3LOVA 5JCLA 5M10A 3NGCX 3BNHA 1REOA 4K8DA 1DXLA 3NTDA 3C4AA 1PBBA 3UP5A 1BKWA 5IQ1A 2X8HA 3G5SA 4B1BA 3GM6A 3AWIA 3CGBA 5FS7A 2CULA 1PJ5A 1W4XA 3BI4A 3UKHA 1NHSA 2JK6A 1JRXA 2EQ7A 2Q6UA 2WS3A 1GRGA 2YLWA 2Z5XA 3EPTA 3NK0X 2W0HA 4H50A 4YTPA 2XFUA 4H2QA 1JNZA 4GDPA 1GOSA 3UKLA 4YT0A 1N1PA 3AEDA 3H8LA 1F8WA 3NG7X 2B76A 1KFYA 1E6EA 3SGLA 5KOWA 2VVMA 4H4XA 1NENA 1COYA 2F5ZA 2XFOA 3ZDNA 2OT4A 2FJAA 3QFAA 5KOXA 5EOWA 4HB9A 4OPTA 3AYIA 3LZXA 2V3AA 2RDZA 1EL8A 2BC1A 2Q7VA 3HYXA 3P4SA 2WEUA 4YSYA 4GAPA 2V5ZA 3SFDA 3UTEA 4D03A 1ZOYA 3QSEA 1M64A 2GMHA 3TTBA 4C77A 2PHHA 1IUSA 1S3BA 1CBOA 3SZ0A 4EQSA 2ZO5A 2BS2A 1H86A 1FS9A 2YG4A 1OJ9A 1LV0A 1H7WA 3FG2P 2XFQA 2WDRA 4UDRA
chains in the Genus database with same CATH topology
1CJ3A 1OJTA 1PBCA 3VR8A 3ALLA 2YG5A 3GDPA 2YLZA 1TDOA 3GRTA 1RP0A 4AT2A 3ITJA 3UTGA 3GYXA 4TM1A 4H2NA 2A8XA 3LADA 1B4VA 3UTFA 1EBDA 4K5SA 2GAGB 3L1RA 2GB0A 4GDEA 2V6OA 4FDCB 3SFEA 4Z25A 2BC0A 1EL9A 1FEAA 1BVBA 2GQFA 1QJDA 3AD7B 1CJ4A 3FPZA 3Q6JA 1GRTA 4U8LA 3KA7A 3DK9A 3QVPA 1CC4A 2H89A 2WQYA 4JNAA 3NK1X 2A87A 4K22A 1D4CA 1KF6A 2TPRA 3DA1A 3GMBA 2XLPA 3QJ4A 3CNTA 3T2ZA 1JU2A 4CBQA 1QDBA 3KVEA 3UBRA 4CNKA 2C64A 2Y6QA 1PJ7A 2GH5A 1HYUA 4UDPA 4U8PA 2GEWA 2VZ2A 2NVKX 2A89A 5FS8A 5CKUA 4A6NA 1KSUA 4EMWA 1GETA 4U8NA 3CNPA 3NK2X 4II2A 5L46A 2E81A 1F8RA 2C67A 2YWLA 1CC6A 3H8IA 3UCLA 1LPFA 3R9UA 1CC2A 1QLBA 1GU6A 3OWMA 1XANA 1K0LA 3QVRA 1CJCA 3CIRA 1MOKA 1ZDLA 2E4GA 2R4JA 3DK4A 4YKGA 2BYBA 4GCMA 2E80A 2V3BA 4Z43A 1LQUA 2R0PA 2WESA 3EF6A 5TR3A 3VRDB 4OPDA 4B68A 1FT6A 1CF3A 1SEZA 4GAVA 4I58A 4J34A 3UOYA 4NTCA 1P2EA 1K0JA 2HQMA 4A79A 4C74A 1F6MA 1EL7A 2BK3A 4X9MA 3ABVA 4H2RA 3GYIA 3AEGA 3MMOA 1FL2A 2XLRA 3P4RA 3BNFA 4G9KA 4G74A 3SZWA 4LA1A 3T14A 2R9ZA 1PHHA 2RF7A 3UP4A 2ACZA 2Q0LA 3BNGA 3S7WA 2QA1A 4J31A 5J7XA 4ADWA 4Z2RA 1FECA 1NG4A 3UKKA 3I6DA 3LZWA 3TORA 5FS6A 3P9UA 3VRAA 1KDGA 4IA6A 1B37A 1IUUA 4X4JA 3RP6A 1FT5A 3AYLA 4OCGA 3BI2A 3F8PA 2JB1A 2C73A 2X3NA 2EQ8A 3AD9B 3ALMA 3BI5A 4B65A 1N4VA 4DGKA 2Q0KA 2AAQA 2WPEA 4RG4A 1L0VA 4YSHA 1ZMCA 3D1IA 3GSIA 4H4QA 2YQUA 3V3OA 1BF3A 1E1KA 1MO9A 4II3A 3SYIA 1JRYA 2H88A 1ZOVA 4EMJA 2OAMA 1B8SA 2XYOA 4JY3A 4TM0A 3RP7A 5IQ4A 2O9ZA 3G5QA 1JNIA 5JCKA 1NPXA 3C96A 1GXFA 4TM4A 3OZ2A 4HA6A 3ZYXA 1K4QA 2QAEA 1BGNA 2EQ6A 4C3XA 1D4EA 3LJPA 3M13A 3P1WA 2XVFA 4X9NA 1H83A 4UDQA 2B9WA 4Y4LA 2I0ZA 1GRAA 5C3JA 1GTEA 5C2TA 1PJ6A 5FS9A 4Z26A 2GRTA 1YQ4A 4EQWA 4JDRA 4H4ZA 3AE4A 1VG9A 3RP8A 4A65A 5BULA 5HYMA 2YLTA 5GSNA 3F29A 4CY6A 3B6DA 2GR3A 3GMCA 1DOEA 2BK5A 2WDVA 3SZCA 4CCQA 3KPKA 1M1RA 2YG3A 3DGZA 2E1MA 1BWCA 2VVLA 2GR1A 2APGA 4IVOB 1PXAA 2IIDA 1TYPA 5U25A 2WPFA 1TDFA 1YQ3A 1CL0A 4JQ9A 4BK1A 1XHCA 1PBEA 3C4NA 1GALA 4L3ZA 2BA9A 3K7QX 1H6VA 1GREA 3GWFA 4U8OA 4U8JA 5U1OA 3EANA 1TYTA 3M0OA 5ER0A 4Q4UA 4OVIA 5JCNA 1LJ1A 4ZCCA 3GD3A 2B9XA 4AOXA 1QO8A 1XPQA 3S5WA 1ZY8A 4J2WA 4EIPA 2YVFA 4B67A 4JNQA 3SCEA 5J60A 2X8GA 1S3EA 3KU9A 2XVEA 4BV6A 4H7UA 5BVAA 3GYJA 1DNCA 4TLXA 4L3XA 4FK1A 1KNRA 3DJGX 1E1LA 2AQJA 5BUKA 1ZP0A 3NYEA 4K7ZA 4AP3A 3DJEA 3P4PA 4REKA 2CDUA 1VG0A 5DBJA 1NAAA 2WPCA 4YXDA 2WDQA 4KX6A 1IJHA 2X50A 2C7GA 5KRQA 3DMEA 3KKJA 1DJQA 1N4WA 3AXBA 4G6GA 1S2YA 3T31A 4Z44A 3DH9A 4A99A 5IPYA 2XFPA 1EL5A 1F8SA 3IHGA 4A9WA 3SM8A 1OAHA 1GT8A 3I3LA 1ZMDA 4K5RA 4U2LA 4L3YA 3AEFA 4NEVA 4C3YA 3ICSA 3K30A 2XDOA 1JNRA 3CN8A 4GR1A 3EAOA 2OALA 3T0KA 1B5QA 1K0IA 2OLNA 2YR5A 4P9SA 3LB8A 1L9DA 3H4KA 1PXBA 2XVJA 2NPXA 2RGHA 4AOSA 1GRHA 4ECHA 3COXA 4B66A 3E1TA 4PABA 3AE5A 3CTYA 3CMMA 2R45A 3AYJA 3NYCA 1TDKA 4DSHA 3LXDA 3UTHA 2YAUA 2XLTA 3AE2A 1GV4A 2GR2A 3F8RA 4NEWA 4AP1A 1NEKA 2VOUA 3HZLA 3ALJA 2BCPA 4U8KA 2VQ7A 1D4DA 1YKJA 4U2SA 4Q5CA 2K3VA 3LG1A 3SXQA 2RGJA 1M1QA 3SX6A 4I59A 4J56A 2YLRA 4Q1OA 2BS3A 3NT6A 2UZZA 1GTHA 2YG7A 3AE8A 4J36A 3UKQA 2ZBWA 2BXSA 2EQ9A 1GEUA 1O5WA 2BS4A 3S61A 1H7XA 1X31B 3AE9A 5JCMA 3B3RA 1SP3A 4WX1A 1YY5A 3P4QA 3UKAA 1NHPA 4CY8A 3AECA 1IUTA 2PYXA 4N9XA 1M1PA 2WOVA 3ADAB 3AE1A 3HYWA 3AEEA 2IVEA 2JBVA 2WOWA 2ZZCA 4GF7A 3URHA 5HY5A 2VQBA 3JSKA 5JCIA 4Q17A 2ARDA 4LIIA 2R0CA 4USRA 3CPJG 1DODA 3NTAA 4H4RA 4JN9A 4USQA 4DSGA 3ATRA 2B7SA 1D7YA 1VQWA 4L38A 3UU9A 1DOBA 2WP6A 4D04A 2FJDA 4Z2UA 4Q0TA 3NN0X 4Y4MA 3UOZA 1E1MA 3KPFA 5U63A 5KWFA 3AE3A 2GAHB 1IUVA 4KPRA 1P2HA 4OPCA 2BXRA 3FO3A 1PN0A 4EIQA 2C4CA 3D8XA 1FCDA 1E7PA 1F3PA 1ZKQA 3REDA 1OJDA 1XDIA 2XLUA 1VDCA 2GR0A 2BACA 2VVLG 4K2XA 4Z2TA 2R0GA 2C66A 5HXIA 3BNUA 3SQPA 2J3NA 2XVHA 3GDNA 1JEHA 4EM4A 3VQRA 3L1TA 4XWRA 3BHFA 2XLSA 1TDNA 4YTMA 3CGCA 3KLJA 4UP3A 1ONFA 4FK1C 2RABA 4EMIA 2JB3A 2YM2A 5HHFA 3RNMA 4OPIA 4RG3A 2FJBA 4YWOA 4B64A 4YSZA 3BNMA 1NHRA 2AR8A 4EQXA 4A6NB 2V60A 2BABA 3T2YA 3PO7A 4RSLA 2ZZ0A 3QFBA 4J33A 2GV8A 2CVJA 1GERA 5M0ZA 2GF3A 3VRBA 1AOGA 2VRMA 4OPUA 1ELIA 2C65A 1LQTA 3HYVA 4H4PA 3RHAA 2IVDA 1BGJA 2JB2A 2WHDA 4ZCDA 2WOIA 2C70A 2E5VA 3AB1A 1D7LA 2Z5YA 4IVMB 1GRFA 1D5TA 3CGEA 2XCGA 3ICTA 4BK2A 4B69A 2VR0A 1VRQB 4H4YA 3UKFA 4A5LA 4EQRA 2J7AA 2BRAA 4GUVA 5LV9A 1DJNA 3DK8A 3QSSA 2XVIA 3CPIG 3O0HA 2FJEA 3PS9A 3PVCA 4H4VA 3RKHA 4H4SA 1Y0PA 1NG3A 3WE0A 1RSGA 3L8KA 1S2QA 1Z6LA 3QSMA 2JAEA 1FS7A 2JKCA 5BRTA 1Y56A 3NLCA 2X8CA 5EB4A 1O95A 3NKSA 2OA1A 3ICRA 4AT0A 1PBFA 1UKVG 1YQZA 3UOXA 3AE6A 1GSNA 2R46A 1JRZA 1L9EA 1Q1WA 2QCUA 3GRSA 3SZFA 1Q1RA 4EM3A 4LU6A 2DKHA 3NNEA 4IA5A 1DOCA 4G73A 4CCRA 2TMDA 2ZZBA 3D1CA 3AE7A 1BZLA 3ATQA 2X99A 3II4A 4NNJA 1H82A 4U8MA 1GPEA 2BRYA 1ZK7A 2FBWA 4NWZA 3FBSA 4MJWA 4YTNA 5KVHA 1IUWA 1GRBA 4J57A 2CFYA 3OC4A 3SXIA 5KNLA 3ISHA 4O5QA 3M12A 4XXGA 4WJYA 2RGOA 4ICYA 3UOVA 3AEBA 3CGDA 5KVIA 1FOHA 4G6HA 5KMSA 3G5RA 4Z24A 5EBKA 3T2KA 2B7RA 2LFCA 4Y4NA 2C3DA 3VR9A 3AD8B 2BK4A 3DJJA 1Q9IA 1IUXA 2BCGG 2YG6A 3SY4A 2YLSA 4OPLA 4YKFA 2YLXA 5EB5A 3F8DA 5KXJA 1KSSA 3BNJA 1H84A 2WP5A 1PXCA 3NYFA 4TLZA 3Q9TA 1Y56B 3NRNA 2YVJA 4E0VA 1O94A 2DKIA 2YR4A 3FIMB 2GQWA 3CNDA 1LVLA 1PDHA 3NN6X 4IV9A 3KD9A 1PBDA 2C72A 5KMPA 1OJAA 1FEBA 5GRTA 4U2TA 4BJZA 4U8IA 3CNJA 4H4UA 3DGHA 3NH3X 1GESA 1NDAA 3NHOX 3T37A 3AEAA 4A7AA 1TRBA 4OPGA 3NIXA 1L9CA 5FMHA 2YR6A 4C5OA 2B9YA 3IHMA 3V3NA 2WU2A 2YVGA 1V59A 2WU5A 2VRLA 4YSXA 1E1NA 4H4WA 4H4TA 4FX9A 5CQFA 4B63A 4DNAA 5KMRA 4BJYA 1KNPA 4O5UA 4GRTA 1TDEA 4NZHA 1N4UA 1GNDA 2R4EA 1CHUA 2OLOA 2YM1A 4APNA 3IC9A 4BK3A 3LGQA 1PS9A 4WCTA 3IWAA 2WETA 4CRTA 3FMWA 3K7TA 4JY2A 1M6IA 1NHQA 2GMJA 1MXTA 2V61A 4PAAA 1LTXR 4CNJA 2WBAA 5KMQA 3CNSA 3V76A 1FS8A 2XFNA 3BHKA 4TM3A 2Y6RA 4H2PA 4NTDA 1CJ2A 3IF9A 1OJCA 2C76A 4Q5BA 1ZX9A 3CPHG 4NTEA 1E39A 2GVCA 4ZN0A 2C3CA 1H81A 4M52A 1RYIA 1JOAA 3GWDA 3DJDA 2QA2A 3GD4A 3UKPA 4BURA 3K7MX 4XWZA 2C75A 2WP9A 3LOVA 5JCLA 5M10A 3NGCX 3BNHA 1REOA 4K8DA 1DXLA 3NTDA 3C4AA 1PBBA 3UP5A 1BKWA 5IQ1A 2X8HA 3G5SA 4B1BA 3GM6A 3AWIA 3CGBA 5FS7A 2CULA 1PJ5A 1W4XA 3BI4A 3UKHA 1NHSA 2JK6A 1JRXA 2EQ7A 2Q6UA 2WS3A 1GRGA 2YLWA 2Z5XA 3EPTA 3NK0X 2W0HA 4H50A 4YTPA 2XFUA 4H2QA 1JNZA 4GDPA 1GOSA 3UKLA 4YT0A 1N1PA 3AEDA 3H8LA 1F8WA 3NG7X 2B76A 1KFYA 1E6EA 3SGLA 5KOWA 2VVMA 4H4XA 1NENA 1COYA 2F5ZA 2XFOA 3ZDNA 2OT4A 2FJAA 3QFAA 5KOXA 5EOWA 4HB9A 4OPTA 3AYIA 3LZXA 2V3AA 2RDZA 1EL8A 2BC1A 2Q7VA 3HYXA 3P4SA 2WEUA 4YSYA 4GAPA 2V5ZA 3SFDA 3UTEA 4D03A 1ZOYA 3QSEA 1M64A 2GMHA 3TTBA 4C77A 2PHHA 1IUSA 1S3BA 1CBOA 3SZ0A 4EQSA 2ZO5A 2BS2A 1H86A 1FS9A 2YG4A 1OJ9A 1LV0A 1H7WA 3FG2P 2XFQA 2WDRA 4UDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJ3 A;  1OJT A;  1PBC A;  3VR8 A;  3ALL A;  2YG5 A;  3GDP A;  2YLZ A;  1TDO A;  3GRT A;  1RP0 A;  4AT2 A;  3ITJ A;  3UTG A;  4TM1 A;  3GYX A;  4H2N A;  2A8X A;  3LAD A;  1B4V A;  3UTF A;  1EBD A;  4K5S A;  2GAG B;  3L1R A;  2GB0 A;  4GDE A;  2V6O A;  4FDC B;  3SFE A;  4Z25 A;  2BC0 A;  1EL9 A;  1FEA A;  1BVB A;  2GQF A;  1QJD A;  3AD7 B;  1CJ4 A;  3FPZ A;  3Q6J A;  1GRT A;  4U8L A;  3KA7 A;  3DK9 A;  3QVP A;  1CC4 A;  2H89 A;  2WQY A;  4JNA A;  3NK1 X;  2A87 A;  4K22 A;  1D4C A;  1KF6 A;  2TPR A;  3DA1 A;  3GMB A;  2XLP A;  3QJ4 A;  3CNT A;  1JU2 A;  4CBQ A;  1QDB A;  3KVE A;  3UBR A;  4CNK A;  2C64 A;  2Y6Q A;  1PJ7 A;  2GH5 A;  1HYU A;  4UDP A;  4U8P A;  2GEW A;  2VZ2 A;  2NVK X;  2A89 A;  5FS8 A;  5CKU A;  4A6N A;  1KSU A;  4EMW A;  1GET A;  4U8N A;  3CNP A;  3NK2 X;  5L46 A;  2E81 A;  1F8R A;  2C67 A;  2YWL A;  1CC6 A;  3H8I A;  3UCL A;  1LPF A;  3R9U A;  1CC2 A;  1QLB A;  1GU6 A;  3OWM A;  1XAN A;  1K0L A;  3QVR A;  1CJC A;  3CIR A;  1MOK A;  1ZDL A;  2E4G A;  2R4J A;  3DK4 A;  4YKG A;  2BYB A;  4GCM A;  2E80 A;  2V3B A;  4Z43 A;  1LQU A;  2R0P A;  2WES A;  3EF6 A;  5TR3 A;  3VRD B;  4OPD A;  4B68 A;  1FT6 A;  1CF3 A;  1SEZ A;  4I58 A;  4J34 A;  3UOY A;  4NTC A;  1P2E A;  1K0J A;  2HQM A;  4A79 A;  4C74 A;  1F6M A;  1EL7 A;  2BK3 A;  4X9M A;  3ABV A;  4H2R A;  3GYI A;  3AEG A;  3MMO A;  1FL2 A;  2XLR A;  3P4R A;  3BNF A;  4LA1 A;  2R9Z A;  1PHH A;  2RF7 A;  3UP4 A;  2ACZ A;  2Q0L A;  3BNG A;  3S7W A;  2QA1 A;  4J31 A;  5J7X A;  4ADW A;  4Z2R A;  1FEC A;  1NG4 A;  3UKK A;  3I6D A;  3LZW A;  3TOR A;  5FS6 A;  3P9U A;  3VRA A;  1KDG A;  4IA6 A;  1B37 A;  1IUU A;  4X4J A;  3RP6 A;  1FT5 A;  3AYL A;  4OCG A;  3BI2 A;  3F8P A;  2JB1 A;  2C73 A;  2X3N A;  2EQ8 A;  3AD9 B;  3ALM A;  3BI5 A;  4B65 A;  1N4V A;  4DGK A;  2Q0K A;  2AAQ A;  2WPE A;  4RG4 A;  1L0V A;  4YSH A;  1ZMC A;  3D1I A;  3GSI A;  4H4Q A;  2YQU A;  3V3O A;  1BF3 A;  1E1K A;  1MO9 A;  4A7A A;  1JRY A;  2H88 A;  1ZOV A;  4EMJ A;  2OAM A;  1B8S A;  2XYO A;  4JY3 A;  4TM0 A;  3RP7 A;  5IQ4 A;  2O9Z A;  3G5Q A;  1JNI A;  5JCK A;  1NPX A;  3C96 A;  1GXF A;  4TM4 A;  3OZ2 A;  4HA6 A;  3ZYX A;  1K4Q A;  2QAE A;  1BGN A;  2EQ6 A;  4C3X A;  1D4E A;  3LJP A;  3M13 A;  3P1W A;  2XVF A;  4X9N A;  1H83 A;  4UDQ A;  2B9W A;  4Y4L A;  2I0Z A;  1GRA A;  5C3J A;  1GTE A;  5C2T A;  1PJ6 A;  5FS9 A;  4Z26 A;  2GRT A;  1YQ4 A;  4EQW A;  4JDR A;  4H4Z A;  3AE4 A;  1VG9 A;  3RP8 A;  4A65 A;  5BUL A;  5HYM A;  2YLT A;  5GSN A;  3F29 A;  4CY6 A;  3B6D A;  2GR3 A;  3GMC A;  1DOE A;  2BK5 A;  2WDV A;  4CCQ A;  1M1R A;  2YG3 A;  3DGZ A;  2E1M A;  1BWC A;  2VVL A;  2GR1 A;  2APG A;  4IVO B;  1PXA A;  2IID A;  1TYP A;  5U25 A;  2WPF A;  1TDF A;  1YQ3 A;  1CL0 A;  4JQ9 A;  4BK1 A;  1XHC A;  1PBE A;  3C4N A;  1GAL A;  4L3Z A;  2BA9 A;  3K7Q X;  1H6V A;  1GRE A;  3GWF A;  4U8O A;  4U8J A;  5U1O A;  3EAN A;  1TYT A;  3M0O A;  5ER0 A;  4Q4U A;  4OVI A;  5JCN A;  1LJ1 A;  4ZCC A;  3GD3 A;  2B9X A;  4AOX A;  1QO8 A;  1XPQ A;  3S5W A;  1ZY8 A;  4J2W A;  4EIP A;  2YVF A;  4B67 A;  4JNQ A;  3SCE A;  5J60 A;  2X8G A;  1S3E A;  3KU9 A;  2XVE A;  4BV6 A;  4H7U A;  5BVA A;  3GYJ A;  1DNC A;  4TLX A;  4L3X A;  4FK1 A;  1KNR A;  3DJG X;  1E1L A;  2AQJ A;  5BUK A;  1ZP0 A;  3NYE A;  4K7Z A;  4AP3 A;  3DJE A;  3P4P A;  4REK A;  2CDU A;  1VG0 A;  5DBJ A;  1NAA A;  2WPC A;  4YXD A;  2WDQ A;  4KX6 A;  1IJH A;  2X50 A;  2C7G A;  5KRQ A;  3DME A;  3KKJ A;  1DJQ A;  1N4W A;  3AXB A;  1S2Y A;  4A99 A;  4Z44 A;  3DH9 A;  5IPY A;  2XFP A;  1EL5 A;  1F8S A;  3IHG A;  4A9W A;  3SM8 A;  1OAH A;  1GT8 A;  3I3L A;  1ZMD A;  4K5R A;  4U2L A;  4L3Y A;  3AEF A;  4NEV A;  4C3Y A;  3ICS A;  3K30 A;  2XDO A;  1JNR A;  3CN8 A;  4GR1 A;  3EAO A;  2OAL A;  1B5Q A;  1K0I A;  2OLN A;  2YR5 A;  4P9S A;  3LB8 A;  1L9D A;  3H4K A;  1PXB A;  2XVJ A;  2NPX A;  2RGH A;  4AOS A;  1GRH A;  4ECH A;  3COX A;  4B66 A;  3E1T A;  4PAB A;  3AE5 A;  3CTY A;  2R45 A;  3AYJ A;  3NYC A;  1TDK A;  4DSH A;  3LXD A;  3UTH A;  2YAU A;  2XLT A;  3AE2 A;  1GV4 A;  2GR2 A;  3F8R A;  4NEW A;  4AP1 A;  1NEK A;  2VOU A;  3HZL A;  3ALJ A;  2BCP A;  4U8K A;  2VQ7 A;  1D4D A;  1YKJ A;  4U2S A;  4Q5C A;  2K3V A;  3LG1 A;  3SXQ A;  2RGJ A;  1M1Q A;  4I59 A;  4J56 A;  2YLR A;  4Q1O A;  2BS3 A;  3NT6 A;  2UZZ A;  1GTH A;  2YG7 A;  3AE8 A;  4J36 A;  3UKQ A;  2ZBW A;  2BXS A;  2EQ9 A;  1GEU A;  1O5W A;  2BS4 A;  3S61 A;  1H7X A;  1X31 B;  3AE9 A;  5JCM A;  3B3R A;  1SP3 A;  4WX1 A;  1YY5 A;  3P4Q A;  3UKA A;  1NHP A;  4CY8 A;  3AEC A;  1IUT A;  2PYX A;  4N9X A;  1M1P A;  2WOV A;  3ADA B;  3AE1 A;  4GF7 A;  3AEE A;  2IVE A;  2JBV A;  2WOW A;  2ZZC A;  3URH A;  5HY5 A;  5JCI A;  2VQB A;  3JSK A;  4Q17 A;  2ARD A;  4LII A;  2R0C A;  4USR A;  3CPJ G;  1DOD A;  3NTA A;  4H4R A;  4JN9 A;  4USQ A;  4DSG A;  3ATR A;  2B7S A;  1D7Y A;  1VQW A;  4L38 A;  3UU9 A;  1DOB A;  2WP6 A;  4D04 A;  2FJD A;  4Z2U A;  4Q0T A;  3NN0 X;  4Y4M A;  3UOZ A;  1E1M A;  3KPF A;  5U63 A;  5KWF A;  3AE3 A;  2GAH B;  1IUV A;  4KPR A;  1P2H A;  4OPC A;  2BXR A;  3FO3 A;  1PN0 A;  4EIQ A;  3D8X A;  1FCD A;  1E7P A;  1F3P A;  1ZKQ A;  3RED A;  1OJD A;  1XDI A;  2XLU A;  1VDC A;  2GR0 A;  2BAC A;  2VVL G;  4K2X A;  4Z2T A;  2R0G A;  2C66 A;  5HXI A;  3BNU A;  3SQP A;  2J3N A;  2XVH A;  3GDN A;  1JEH A;  4EM4 A;  3VQR A;  3L1T A;  4XWR A;  3BHF A;  2XLS A;  1TDN A;  4YTM A;  3CGC A;  3KLJ A;  4UP3 A;  1ONF A;  4FK1 C;  2RAB A;  4EMI A;  2JB3 A;  2YM2 A;  5HHF A;  3RNM A;  4OPI A;  4RG3 A;  2FJB A;  4YWO A;  4B64 A;  4YSZ A;  3BNM A;  1NHR A;  2AR8 A;  4EQX A;  4A6N B;  2V60 A;  2BAB A;  3PO7 A;  4RSL A;  2ZZ0 A;  3QFB A;  4J33 A;  2GV8 A;  2CVJ A;  1GER A;  5M0Z A;  2GF3 A;  3VRB A;  1AOG A;  2VRM A;  4OPU A;  1ELI A;  2C65 A;  1LQT A;  4H4P A;  3RHA A;  2IVD A;  1BGJ A;  2JB2 A;  2WHD A;  4ZCD A;  2WOI A;  2C70 A;  2E5V A;  3AB1 A;  1D7L A;  2Z5Y A;  4IVM B;  1GRF A;  1D5T A;  3CGE A;  2XCG A;  3ICT A;  4BK2 A;  4B69 A;  2VR0 A;  1VRQ B;  4H4Y A;  3UKF A;  4A5L A;  4EQR A;  2J7A A;  5LV9 A;  4GUV A;  1DJN A;  3DK8 A;  3QSS A;  2XVI A;  3CPI G;  3O0H A;  2FJE A;  3PS9 A;  3PVC A;  4H4V A;  3RKH A;  4H4S A;  1Y0P A;  1NG3 A;  3WE0 A;  1RSG A;  3L8K A;  1S2Q A;  1Z6L A;  3QSM A;  2JAE A;  1FS7 A;  2JKC A;  5BRT A;  1Y56 A;  3NLC A;  2X8C A;  5EB4 A;  1O95 A;  3NKS A;  2OA1 A;  3ICR A;  4AT0 A;  1PBF A;  1UKV G;  1YQZ A;  3UOX A;  3AE6 A;  1GSN A;  2R46 A;  1JRZ A;  1L9E A;  1Q1W A;  2QCU A;  3GRS A;  1Q1R A;  4EM3 A;  4LU6 A;  2DKH A;  3NNE A;  4IA5 A;  1DOC A;  4CCR A;  2TMD A;  2ZZB A;  3D1C A;  3AE7 A;  1BZL A;  3ATQ A;  2X99 A;  3II4 A;  4U8M A;  1H82 A;  1GPE A;  1ZK7 A;  2FBW A;  3FBS A;  4MJW A;  4YTN A;  5KVH A;  1IUW A;  1GRB A;  4J57 A;  2CFY A;  3OC4 A;  3ISH A;  4O5Q A;  3M12 A;  4XXG A;  4WJY A;  2RGO A;  4ICY A;  3UOV A;  3AEB A;  3CGD A;  5KVI A;  1FOH A;  3G5R A;  4Z24 A;  5EBK A;  2B7R A;  2LFC A;  4Y4N A;  2C3D A;  3VR9 A;  3AD8 B;  2BK4 A;  3DJJ A;  1Q9I A;  1IUX A;  2BCG G;  2YG6 A;  2YLS A;  4OPL A;  4YKF A;  2YLX A;  5EB5 A;  3F8D A;  5KXJ A;  1KSS A;  3BNJ A;  1H84 A;  2WP5 A;  1PXC A;  3NYF A;  4TLZ A;  3Q9T A;  1Y56 B;  3NRN A;  2YVJ A;  4E0V A;  1O94 A;  2DKI A;  2YR4 A;  3FIM B;  2GQW A;  3CND A;  1LVL A;  1PDH A;  3NN6 X;  4IV9 A;  3KD9 A;  1PBD A;  2C72 A;  1OJA A;  1FEB A;  5GRT A;  4U2T A;  4BJZ A;  4U8I A;  3CNJ A;  4H4U A;  3DGH A;  3NH3 X;  1GES A;  1NDA A;  3NHO X;  3T37 A;  3AEA A;  1TRB A;  4OPG A;  3NIX A;  1L9C A;  5FMH A;  2YR6 A;  4C5O A;  2B9Y A;  3IHM A;  3V3N A;  2WU2 A;  2YVG A;  1V59 A;  2WU5 A;  2VRL A;  4YSX A;  1E1N A;  4H4W A;  4H4T A;  4FX9 A;  5CQF A;  4B63 A;  4DNA A;  4BJY A;  1KNP A;  4O5U A;  4GRT A;  1TDE A;  4NZH A;  1N4U A;  1GND A;  2R4E A;  1CHU A;  2OLO A;  2YM1 A;  4APN A;  3IC9 A;  4BK3 A;  3LGQ A;  1PS9 A;  4WCT A;  3IWA A;  2WET A;  4CRT A;  3FMW A;  3K7T A;  4JY2 A;  1M6I A;  1NHQ A;  2GMJ A;  1MXT A;  2V61 A;  4PAA A;  1LTX R;  4CNJ A;  2WBA A;  3CNS A;  3V76 A;  1FS8 A;  2XFN A;  3BHK A;  4TM3 A;  2Y6R A;  4H2P A;  4NTD A;  1CJ2 A;  3IF9 A;  1OJC A;  2C76 A;  4Q5B A;  1ZX9 A;  3CPH G;  4NTE A;  1E39 A;  2GVC A;  4ZN0 A;  2C3C A;  1H81 A;  4M52 A;  1RYI A;  1JOA A;  3GWD A;  3DJD A;  2QA2 A;  3GD4 A;  3UKP A;  4BUR A;  3K7M X;  4XWZ A;  2C75 A;  2WP9 A;  3LOV A;  5JCL A;  5M10 A;  3NGC X;  3BNH A;  1REO A;  4K8D A;  1DXL A;  3NTD A;  3C4A A;  1PBB A;  3UP5 A;  1BKW A;  5IQ1 A;  2X8H A;  3G5S A;  4B1B A;  3GM6 A;  3AWI A;  3CGB A;  5FS7 A;  2CUL A;  1PJ5 A;  1W4X A;  3BI4 A;  3UKH A;  1NHS A;  2JK6 A;  1JRX A;  2EQ7 A;  2Q6U A;  2WS3 A;  1GRG A;  2YLW A;  2Z5X A;  3EPT A;  3NK0 X;  2W0H A;  4H50 A;  4YTP A;  2XFU A;  4H2Q A;  1JNZ A;  4GDP A;  1GOS A;  3UKL A;  4YT0 A;  1N1P A;  3AED A;  3H8L A;  1F8W A;  3NG7 X;  2B76 A;  1KFY A;  1E6E A;  3SGL A;  5KOW A;  2VVM A;  4H4X A;  1NEN A;  1COY A;  2F5Z A;  2XFO A;  3ZDN A;  2OT4 A;  2FJA A;  3QFA A;  5KOX A;  5EOW A;  4HB9 A;  4OPT A;  3AYI A;  3LZX A;  2V3A A;  2RDZ A;  1EL8 A;  2BC1 A;  2Q7V A;  3P4S A;  2WEU A;  4YSY A;  2V5Z A;  3SFD A;  3UTE A;  4D03 A;  1ZOY A;  3QSE A;  1M64 A;  2GMH A;  3TTB A;  4C77 A;  2PHH A;  1IUS A;  1S3B A;  1CBO A;  4EQS A;  2ZO5 A;  2BS2 A;  1H86 A;  1FS9 A;  2YG4 A;  1OJ9 A;  1LV0 A;  1H7W A;  3FG2 P;  2XFQ A;  2WDR A;  4UDR A; 
#chains in the Genus database with same CATH topology
 1CJ3 A;  1OJT A;  1PBC A;  3VR8 A;  3ALL A;  2YG5 A;  3GDP A;  2YLZ A;  1TDO A;  3GRT A;  1RP0 A;  4AT2 A;  3ITJ A;  3UTG A;  3GYX A;  4TM1 A;  4H2N A;  2A8X A;  3LAD A;  1B4V A;  3UTF A;  1EBD A;  4K5S A;  2GAG B;  3L1R A;  2GB0 A;  4GDE A;  2V6O A;  4FDC B;  3SFE A;  4Z25 A;  2BC0 A;  1EL9 A;  1FEA A;  1BVB A;  2GQF A;  1QJD A;  3AD7 B;  1CJ4 A;  3FPZ A;  3Q6J A;  1GRT A;  4U8L A;  3KA7 A;  3DK9 A;  3QVP A;  1CC4 A;  2H89 A;  2WQY A;  4JNA A;  3NK1 X;  2A87 A;  4K22 A;  1D4C A;  1KF6 A;  2TPR A;  3DA1 A;  3GMB A;  2XLP A;  3QJ4 A;  3CNT A;  3T2Z A;  1JU2 A;  4CBQ A;  1QDB A;  3KVE A;  3UBR A;  4CNK A;  2C64 A;  2Y6Q A;  1PJ7 A;  2GH5 A;  1HYU A;  4UDP A;  4U8P A;  2GEW A;  2VZ2 A;  2NVK X;  2A89 A;  5FS8 A;  5CKU A;  4A6N A;  1KSU A;  4EMW A;  1GET A;  4U8N A;  3CNP A;  3NK2 X;  4II2 A;  5L46 A;  2E81 A;  1F8R A;  2C67 A;  2YWL A;  1CC6 A;  3H8I A;  3UCL A;  1LPF A;  3R9U A;  1CC2 A;  1QLB A;  1GU6 A;  3OWM A;  1XAN A;  1K0L A;  3QVR A;  1CJC A;  3CIR A;  1MOK A;  1ZDL A;  2E4G A;  2R4J A;  3DK4 A;  4YKG A;  2BYB A;  4GCM A;  2E80 A;  2V3B A;  4Z43 A;  1LQU A;  2R0P A;  2WES A;  3EF6 A;  5TR3 A;  3VRD B;  4OPD A;  4B68 A;  1FT6 A;  1CF3 A;  1SEZ A;  4GAV A;  4I58 A;  4J34 A;  3UOY A;  4NTC A;  1P2E A;  1K0J A;  2HQM A;  4A79 A;  4C74 A;  1F6M A;  1EL7 A;  2BK3 A;  4X9M A;  3ABV A;  4H2R A;  3GYI A;  3AEG A;  3MMO A;  1FL2 A;  2XLR A;  3P4R A;  3BNF A;  4G9K A;  4G74 A;  3SZW A;  4LA1 A;  3T14 A;  2R9Z A;  1PHH A;  2RF7 A;  3UP4 A;  2ACZ A;  2Q0L A;  3BNG A;  3S7W A;  2QA1 A;  4J31 A;  5J7X A;  4ADW A;  4Z2R A;  1FEC A;  1NG4 A;  3UKK A;  3I6D A;  3LZW A;  3TOR A;  5FS6 A;  3P9U A;  3VRA A;  1KDG A;  4IA6 A;  1B37 A;  1IUU A;  4X4J A;  3RP6 A;  1FT5 A;  3AYL A;  4OCG A;  3BI2 A;  3F8P A;  2JB1 A;  2C73 A;  2X3N A;  2EQ8 A;  3AD9 B;  3ALM A;  3BI5 A;  4B65 A;  1N4V A;  4DGK A;  2Q0K A;  2AAQ A;  2WPE A;  4RG4 A;  1L0V A;  4YSH A;  1ZMC A;  3D1I A;  3GSI A;  4H4Q A;  2YQU A;  3V3O A;  1BF3 A;  1E1K A;  1MO9 A;  4II3 A;  3SYI A;  1JRY A;  2H88 A;  1ZOV A;  4EMJ A;  2OAM A;  1B8S A;  2XYO A;  4JY3 A;  4TM0 A;  3RP7 A;  5IQ4 A;  2O9Z A;  3G5Q A;  1JNI A;  5JCK A;  1NPX A;  3C96 A;  1GXF A;  4TM4 A;  3OZ2 A;  4HA6 A;  3ZYX A;  1K4Q A;  2QAE A;  1BGN A;  2EQ6 A;  4C3X A;  1D4E A;  3LJP A;  3M13 A;  3P1W A;  2XVF A;  4X9N A;  1H83 A;  4UDQ A;  2B9W A;  4Y4L A;  2I0Z A;  1GRA A;  5C3J A;  1GTE A;  5C2T A;  1PJ6 A;  5FS9 A;  4Z26 A;  2GRT A;  1YQ4 A;  4EQW A;  4JDR A;  4H4Z A;  3AE4 A;  1VG9 A;  3RP8 A;  4A65 A;  5BUL A;  5HYM A;  2YLT A;  5GSN A;  3F29 A;  4CY6 A;  3B6D A;  2GR3 A;  3GMC A;  1DOE A;  2BK5 A;  2WDV A;  3SZC A;  4CCQ A;  3KPK A;  1M1R A;  2YG3 A;  3DGZ A;  2E1M A;  1BWC A;  2VVL A;  2GR1 A;  2APG A;  4IVO B;  1PXA A;  2IID A;  1TYP A;  5U25 A;  2WPF A;  1TDF A;  1YQ3 A;  1CL0 A;  4JQ9 A;  4BK1 A;  1XHC A;  1PBE A;  3C4N A;  1GAL A;  4L3Z A;  2BA9 A;  3K7Q X;  1H6V A;  1GRE A;  3GWF A;  4U8O A;  4U8J A;  5U1O A;  3EAN A;  1TYT A;  3M0O A;  5ER0 A;  4Q4U A;  4OVI A;  5JCN A;  1LJ1 A;  4ZCC A;  3GD3 A;  2B9X A;  4AOX A;  1QO8 A;  1XPQ A;  3S5W A;  1ZY8 A;  4J2W A;  4EIP A;  2YVF A;  4B67 A;  4JNQ A;  3SCE A;  5J60 A;  2X8G A;  1S3E A;  3KU9 A;  2XVE A;  4BV6 A;  4H7U A;  5BVA A;  3GYJ A;  1DNC A;  4TLX A;  4L3X A;  4FK1 A;  1KNR A;  3DJG X;  1E1L A;  2AQJ A;  5BUK A;  1ZP0 A;  3NYE A;  4K7Z A;  4AP3 A;  3DJE A;  3P4P A;  4REK A;  2CDU A;  1VG0 A;  5DBJ A;  1NAA A;  2WPC A;  4YXD A;  2WDQ A;  4KX6 A;  1IJH A;  2X50 A;  2C7G A;  5KRQ A;  3DME A;  3KKJ A;  1DJQ A;  1N4W A;  3AXB A;  4G6G A;  1S2Y A;  3T31 A;  4Z44 A;  3DH9 A;  4A99 A;  5IPY A;  2XFP A;  1EL5 A;  1F8S A;  3IHG A;  4A9W A;  3SM8 A;  1OAH A;  1GT8 A;  3I3L A;  1ZMD A;  4K5R A;  4U2L A;  4L3Y A;  3AEF A;  4NEV A;  4C3Y A;  3ICS A;  3K30 A;  2XDO A;  1JNR A;  3CN8 A;  4GR1 A;  3EAO A;  2OAL A;  3T0K A;  1B5Q A;  1K0I A;  2OLN A;  2YR5 A;  4P9S A;  3LB8 A;  1L9D A;  3H4K A;  1PXB A;  2XVJ A;  2NPX A;  2RGH A;  4AOS A;  1GRH A;  4ECH A;  3COX A;  4B66 A;  3E1T A;  4PAB A;  3AE5 A;  3CTY A;  3CMM A;  2R45 A;  3AYJ A;  3NYC A;  1TDK A;  4DSH A;  3LXD A;  3UTH A;  2YAU A;  2XLT A;  3AE2 A;  1GV4 A;  2GR2 A;  3F8R A;  4NEW A;  4AP1 A;  1NEK A;  2VOU A;  3HZL A;  3ALJ A;  2BCP A;  4U8K A;  2VQ7 A;  1D4D A;  1YKJ A;  4U2S A;  4Q5C A;  2K3V A;  3LG1 A;  3SXQ A;  2RGJ A;  1M1Q A;  3SX6 A;  4I59 A;  4J56 A;  2YLR A;  4Q1O A;  2BS3 A;  3NT6 A;  2UZZ A;  1GTH A;  2YG7 A;  3AE8 A;  4J36 A;  2CZS A;  3UKQ A;  2ZBW A;  2BXS A;  2EQ9 A;  1GEU A;  1O5W A;  2BS4 A;  3S61 A;  1H7X A;  1X31 B;  3AE9 A;  5JCM A;  3B3R A;  1SP3 A;  4WX1 A;  1YY5 A;  3P4Q A;  3UKA A;  1NHP A;  4CY8 A;  3AEC A;  1IUT A;  2PYX A;  4N9X A;  1M1P A;  2WOV A;  3ADA B;  3AE1 A;  3HYW A;  3AEE A;  2IVE A;  2JBV A;  2WOW A;  2ZZC A;  4GF7 A;  3URH A;  5HY5 A;  2VQB A;  3JSK A;  5JCI A;  4Q17 A;  2ARD A;  4LII A;  2R0C A;  4USR A;  3CPJ G;  1DOD A;  3NTA A;  4H4R A;  4JN9 A;  4USQ A;  4DSG A;  3ATR A;  2B7S A;  1D7Y A;  1VQW A;  4L38 A;  3UU9 A;  1DOB A;  2WP6 A;  4D04 A;  2FJD A;  4Z2U A;  4Q0T A;  3NN0 X;  4Y4M A;  3UOZ A;  1E1M A;  3KPF A;  5U63 A;  5KWF A;  3AE3 A;  2GAH B;  1IUV A;  4KPR A;  1P2H A;  4OPC A;  2BXR A;  3FO3 A;  1PN0 A;  4EIQ A;  2C4C A;  3D8X A;  1FCD A;  1E7P A;  1F3P A;  1ZKQ A;  3RED A;  1OJD A;  1XDI A;  2XLU A;  1VDC A;  2GR0 A;  2BAC A;  2VVL G;  4K2X A;  4Z2T A;  2R0G A;  2C66 A;  5HXI A;  3BNU A;  3SQP A;  2J3N A;  2XVH A;  3GDN A;  1JEH A;  4EM4 A;  3VQR A;  3L1T A;  4XWR A;  3BHF A;  2XLS A;  1TDN A;  4YTM A;  3CGC A;  3KLJ A;  4UP3 A;  1ONF A;  4FK1 C;  2RAB A;  4EMI A;  2JB3 A;  2YM2 A;  5HHF A;  3RNM A;  4OPI A;  4RG3 A;  2FJB A;  4YWO A;  4B64 A;  4YSZ A;  3BNM A;  1NHR A;  2AR8 A;  4EQX A;  4A6N B;  2V60 A;  2BAB A;  3T2Y A;  3PO7 A;  4RSL A;  2ZZ0 A;  3QFB A;  4J33 A;  2GV8 A;  2CVJ A;  1GER A;  5M0Z A;  2GF3 A;  3VRB A;  1AOG A;  2VRM A;  4OPU A;  1ELI A;  2C65 A;  1LQT A;  3HYV A;  4H4P A;  3RHA A;  2IVD A;  1BGJ A;  2JB2 A;  2WHD A;  4ZCD A;  2WOI A;  2C70 A;  2E5V A;  3AB1 A;  1D7L A;  2Z5Y A;  4IVM B;  1GRF A;  1D5T A;  3CGE A;  2XCG A;  3ICT A;  4BK2 A;  4B69 A;  2VR0 A;  1VRQ B;  4H4Y A;  3UKF A;  4A5L A;  4EQR A;  2J7A A;  2BRA A;  4GUV A;  5LV9 A;  1DJN A;  3DK8 A;  3QSS A;  2XVI A;  3CPI G;  3O0H A;  2FJE A;  3PS9 A;  3PVC A;  4H4V A;  3RKH A;  4H4S A;  1Y0P A;  1NG3 A;  3WE0 A;  1RSG A;  3L8K A;  1S2Q A;  1Z6L A;  3QSM A;  2JAE A;  1FS7 A;  2JKC A;  5BRT A;  1Y56 A;  3NLC A;  2X8C A;  5EB4 A;  1O95 A;  3NKS A;  2OA1 A;  3ICR A;  4AT0 A;  1PBF A;  1UKV G;  1YQZ A;  3UOX A;  3AE6 A;  1GSN A;  2R46 A;  1JRZ A;  1L9E A;  1Q1W A;  2QCU A;  3GRS A;  3SZF A;  1Q1R A;  4EM3 A;  4LU6 A;  2DKH A;  3NNE A;  4IA5 A;  1DOC A;  4G73 A;  4CCR A;  2TMD A;  2ZZB A;  3D1C A;  3AE7 A;  1BZL A;  3ATQ A;  2X99 A;  3II4 A;  4NNJ A;  1H82 A;  4U8M A;  1GPE A;  2BRY A;  1ZK7 A;  2FBW A;  4NWZ A;  3FBS A;  4MJW A;  4YTN A;  5KVH A;  1IUW A;  1GRB A;  4J57 A;  2CFY A;  3OC4 A;  3SXI A;  5KNL A;  3ISH A;  4O5Q A;  3M12 A;  4XXG A;  4WJY A;  2RGO A;  4ICY A;  3UOV A;  3AEB A;  3CGD A;  5KVI A;  1FOH A;  4G6H A;  5KMS A;  3G5R A;  4Z24 A;  5EBK A;  3T2K A;  2B7R A;  2LFC A;  4Y4N A;  2C3D A;  3VR9 A;  3AD8 B;  2BK4 A;  3DJJ A;  1Q9I A;  1IUX A;  2BCG G;  2YG6 A;  3SY4 A;  2YLS A;  4OPL A;  4YKF A;  2YLX A;  5EB5 A;  3F8D A;  5KXJ A;  1KSS A;  3BNJ A;  1H84 A;  2WP5 A;  1PXC A;  3NYF A;  4TLZ A;  3Q9T A;  1Y56 B;  3NRN A;  2YVJ A;  4E0V A;  1O94 A;  2DKI A;  2YR4 A;  3FIM B;  2GQW A;  3CND A;  1LVL A;  1PDH A;  3NN6 X;  4IV9 A;  3KD9 A;  1PBD A;  2C72 A;  5KMP A;  1OJA A;  1FEB A;  5GRT A;  4U2T A;  4BJZ A;  4U8I A;  3CNJ A;  4H4U A;  3DGH A;  3NH3 X;  1GES A;  1NDA A;  3NHO X;  3T37 A;  3AEA A;  4A7A A;  1TRB A;  4OPG A;  3NIX A;  1L9C A;  5FMH A;  2YR6 A;  4C5O A;  2B9Y A;  3IHM A;  3V3N A;  2WU2 A;  2YVG A;  1V59 A;  2WU5 A;  2VRL A;  4YSX A;  1E1N A;  4H4W A;  4H4T A;  4FX9 A;  5CQF A;  4B63 A;  4DNA A;  5KMR A;  4BJY A;  1KNP A;  4O5U A;  4GRT A;  1TDE A;  4NZH A;  1N4U A;  1GND A;  2R4E A;  1CHU A;  2OLO A;  2YM1 A;  4APN A;  3IC9 A;  4BK3 A;  3LGQ A;  1PS9 A;  4WCT A;  3IWA A;  2WET A;  4CRT A;  3FMW A;  3K7T A;  4JY2 A;  1M6I A;  1NHQ A;  2GMJ A;  1MXT A;  2V61 A;  4PAA A;  1LTX R;  4CNJ A;  2WBA A;  5KMQ A;  3CNS A;  3V76 A;  1FS8 A;  2XFN A;  3BHK A;  4TM3 A;  2Y6R A;  4H2P A;  4NTD A;  1CJ2 A;  3IF9 A;  1OJC A;  2C76 A;  4Q5B A;  1ZX9 A;  3CPH G;  4NTE A;  1E39 A;  2GVC A;  4ZN0 A;  2C3C A;  1H81 A;  4M52 A;  1RYI A;  1JOA A;  3GWD A;  3DJD A;  2QA2 A;  3GD4 A;  3UKP A;  4BUR A;  3K7M X;  4XWZ A;  2C75 A;  2WP9 A;  3LOV A;  5JCL A;  5M10 A;  3NGC X;  3BNH A;  1REO A;  4K8D A;  1DXL A;  3NTD A;  3C4A A;  1PBB A;  3UP5 A;  1BKW A;  5IQ1 A;  2X8H A;  3G5S A;  4B1B A;  3GM6 A;  3AWI A;  3CGB A;  5FS7 A;  2CUL A;  1PJ5 A;  1W4X A;  3BI4 A;  3UKH A;  1NHS A;  2JK6 A;  1JRX A;  2EQ7 A;  2Q6U A;  2WS3 A;  1GRG A;  2YLW A;  2Z5X A;  3EPT A;  3NK0 X;  2W0H A;  4H50 A;  4YTP A;  2XFU A;  4H2Q A;  1JNZ A;  4GDP A;  1GOS A;  3UKL A;  4YT0 A;  1N1P A;  3AED A;  3H8L A;  1F8W A;  3NG7 X;  2B76 A;  1KFY A;  1E6E A;  3SGL A;  5KOW A;  2VVM A;  4H4X A;  1NEN A;  1COY A;  2F5Z A;  2XFO A;  3ZDN A;  2OT4 A;  2FJA A;  3QFA A;  5KOX A;  5EOW A;  4HB9 A;  4OPT A;  3AYI A;  3LZX A;  2V3A A;  2RDZ A;  1EL8 A;  2BC1 A;  2Q7V A;  3HYX A;  3P4S A;  2WEU A;  4YSY A;  4GAP A;  2V5Z A;  3SFD A;  3UTE A;  4D03 A;  1ZOY A;  3QSE A;  1M64 A;  2GMH A;  3TTB A;  4C77 A;  2PHH A;  1IUS A;  1S3B A;  1CBO A;  3SZ0 A;  4EQS A;  2ZO5 A;  2BS2 A;  1H86 A;  1FS9 A;  2YG4 A;  1OJ9 A;  1LV0 A;  1H7W A;  3FG2 P;  2XFQ A;  2WDR A;  4UDR A; 
#chains in the Genus database with same CATH homology
 1CJ3 A;  1OJT A;  1PBC A;  3VR8 A;  3ALL A;  2YG5 A;  3GDP A;  2YLZ A;  1TDO A;  3GRT A;  1RP0 A;  4AT2 A;  3ITJ A;  3UTG A;  3GYX A;  4TM1 A;  4H2N A;  2A8X A;  3LAD A;  1B4V A;  3UTF A;  1EBD A;  4K5S A;  2GAG B;  3L1R A;  2GB0 A;  4GDE A;  2V6O A;  4FDC B;  3SFE A;  4Z25 A;  2BC0 A;  1EL9 A;  1FEA A;  1BVB A;  2GQF A;  1QJD A;  3AD7 B;  1CJ4 A;  3FPZ A;  3Q6J A;  1GRT A;  4U8L A;  3KA7 A;  3DK9 A;  3QVP A;  1CC4 A;  2H89 A;  2WQY A;  4JNA A;  3NK1 X;  2A87 A;  4K22 A;  1D4C A;  1KF6 A;  2TPR A;  3DA1 A;  3GMB A;  2XLP A;  3QJ4 A;  3CNT A;  3T2Z A;  1JU2 A;  4CBQ A;  1QDB A;  3KVE A;  3UBR A;  4CNK A;  2C64 A;  2Y6Q A;  1PJ7 A;  2GH5 A;  1HYU A;  4UDP A;  4U8P A;  2GEW A;  2VZ2 A;  2NVK X;  2A89 A;  5FS8 A;  5CKU A;  4A6N A;  1KSU A;  4EMW A;  1GET A;  4U8N A;  3CNP A;  3NK2 X;  4II2 A;  5L46 A;  2E81 A;  1F8R A;  2C67 A;  2YWL A;  1CC6 A;  3H8I A;  3UCL A;  1LPF A;  3R9U A;  1CC2 A;  1QLB A;  1GU6 A;  3OWM A;  1XAN A;  1K0L A;  3QVR A;  1CJC A;  3CIR A;  1MOK A;  1ZDL A;  2E4G A;  2R4J A;  3DK4 A;  4YKG A;  2BYB A;  4GCM A;  2E80 A;  2V3B A;  4Z43 A;  1LQU A;  2R0P A;  2WES A;  3EF6 A;  5TR3 A;  3VRD B;  4OPD A;  4B68 A;  1FT6 A;  1CF3 A;  1SEZ A;  4GAV A;  4I58 A;  4J34 A;  3UOY A;  4NTC A;  1P2E A;  1K0J A;  2HQM A;  4A79 A;  4C74 A;  1F6M A;  1EL7 A;  2BK3 A;  4X9M A;  3ABV A;  4H2R A;  3GYI A;  3AEG A;  3MMO A;  1FL2 A;  2XLR A;  3P4R A;  3BNF A;  4G9K A;  4G74 A;  3SZW A;  4LA1 A;  3T14 A;  2R9Z A;  1PHH A;  2RF7 A;  3UP4 A;  2ACZ A;  2Q0L A;  3BNG A;  3S7W A;  2QA1 A;  4J31 A;  5J7X A;  4ADW A;  4Z2R A;  1FEC A;  1NG4 A;  3UKK A;  3I6D A;  3LZW A;  3TOR A;  5FS6 A;  3P9U A;  3VRA A;  1KDG A;  4IA6 A;  1B37 A;  1IUU A;  4X4J A;  3RP6 A;  1FT5 A;  3AYL A;  4OCG A;  3BI2 A;  3F8P A;  2JB1 A;  2C73 A;  2X3N A;  2EQ8 A;  3AD9 B;  3ALM A;  3BI5 A;  4B65 A;  1N4V A;  4DGK A;  2Q0K A;  2AAQ A;  2WPE A;  4RG4 A;  1L0V A;  4YSH A;  1ZMC A;  3D1I A;  3GSI A;  4H4Q A;  2YQU A;  3V3O A;  1BF3 A;  1E1K A;  1MO9 A;  4II3 A;  3SYI A;  1JRY A;  2H88 A;  1ZOV A;  4EMJ A;  2OAM A;  1B8S A;  2XYO A;  4JY3 A;  4TM0 A;  3RP7 A;  5IQ4 A;  2O9Z A;  3G5Q A;  1JNI A;  5JCK A;  1NPX A;  3C96 A;  1GXF A;  4TM4 A;  3OZ2 A;  4HA6 A;  3ZYX A;  1K4Q A;  2QAE A;  1BGN A;  2EQ6 A;  4C3X A;  1D4E A;  3LJP A;  3M13 A;  3P1W A;  2XVF A;  4X9N A;  1H83 A;  4UDQ A;  2B9W A;  4Y4L A;  2I0Z A;  1GRA A;  5C3J A;  1GTE A;  5C2T A;  1PJ6 A;  5FS9 A;  4Z26 A;  2GRT A;  1YQ4 A;  4EQW A;  4JDR A;  4H4Z A;  3AE4 A;  1VG9 A;  3RP8 A;  4A65 A;  5BUL A;  5HYM A;  2YLT A;  5GSN A;  3F29 A;  4CY6 A;  3B6D A;  2GR3 A;  3GMC A;  1DOE A;  2BK5 A;  2WDV A;  3SZC A;  4CCQ A;  3KPK A;  1M1R A;  2YG3 A;  3DGZ A;  2E1M A;  1BWC A;  2VVL A;  2GR1 A;  2APG A;  4IVO B;  1PXA A;  2IID A;  1TYP A;  5U25 A;  2WPF A;  1TDF A;  1YQ3 A;  1CL0 A;  4JQ9 A;  4BK1 A;  1XHC A;  1PBE A;  3C4N A;  1GAL A;  4L3Z A;  2BA9 A;  3K7Q X;  1H6V A;  1GRE A;  3GWF A;  4U8O A;  4U8J A;  5U1O A;  3EAN A;  1TYT A;  3M0O A;  5ER0 A;  4Q4U A;  4OVI A;  5JCN A;  1LJ1 A;  4ZCC A;  3GD3 A;  2B9X A;  4AOX A;  1QO8 A;  1XPQ A;  3S5W A;  1ZY8 A;  4J2W A;  4EIP A;  2YVF A;  4B67 A;  4JNQ A;  3SCE A;  5J60 A;  2X8G A;  1S3E A;  3KU9 A;  2XVE A;  4BV6 A;  4H7U A;  5BVA A;  3GYJ A;  1DNC A;  4TLX A;  4L3X A;  4FK1 A;  1KNR A;  3DJG X;  1E1L A;  2AQJ A;  5BUK A;  1ZP0 A;  3NYE A;  4K7Z A;  4AP3 A;  3DJE A;  3P4P A;  4REK A;  2CDU A;  1VG0 A;  5DBJ A;  1NAA A;  2WPC A;  4YXD A;  2WDQ A;  4KX6 A;  1IJH A;  2X50 A;  2C7G A;  5KRQ A;  3DME A;  3KKJ A;  1DJQ A;  1N4W A;  3AXB A;  4G6G A;  1S2Y A;  3T31 A;  4Z44 A;  3DH9 A;  4A99 A;  5IPY A;  2XFP A;  1EL5 A;  1F8S A;  3IHG A;  4A9W A;  3SM8 A;  1OAH A;  1GT8 A;  3I3L A;  1ZMD A;  4K5R A;  4U2L A;  4L3Y A;  3AEF A;  4NEV A;  4C3Y A;  3ICS A;  3K30 A;  2XDO A;  1JNR A;  3CN8 A;  4GR1 A;  3EAO A;  2OAL A;  3T0K A;  1B5Q A;  1K0I A;  2OLN A;  2YR5 A;  4P9S A;  3LB8 A;  1L9D A;  3H4K A;  1PXB A;  2XVJ A;  2NPX A;  2RGH A;  4AOS A;  1GRH A;  4ECH A;  3COX A;  4B66 A;  3E1T A;  4PAB A;  3AE5 A;  3CTY A;  3CMM A;  2R45 A;  3AYJ A;  3NYC A;  1TDK A;  4DSH A;  3LXD A;  3UTH A;  2YAU A;  2XLT A;  3AE2 A;  1GV4 A;  2GR2 A;  3F8R A;  4NEW A;  4AP1 A;  1NEK A;  2VOU A;  3HZL A;  3ALJ A;  2BCP A;  4U8K A;  2VQ7 A;  1D4D A;  1YKJ A;  4U2S A;  4Q5C A;  2K3V A;  3LG1 A;  3SXQ A;  2RGJ A;  1M1Q A;  3SX6 A;  4I59 A;  4J56 A;  2YLR A;  4Q1O A;  2BS3 A;  3NT6 A;  2UZZ A;  1GTH A;  2YG7 A;  3AE8 A;  4J36 A;  3UKQ A;  2ZBW A;  2BXS A;  2EQ9 A;  1GEU A;  1O5W A;  2BS4 A;  3S61 A;  1H7X A;  1X31 B;  3AE9 A;  5JCM A;  3B3R A;  1SP3 A;  4WX1 A;  1YY5 A;  3P4Q A;  3UKA A;  1NHP A;  4CY8 A;  3AEC A;  1IUT A;  2PYX A;  4N9X A;  1M1P A;  2WOV A;  3ADA B;  3AE1 A;  3HYW A;  3AEE A;  2IVE A;  2JBV A;  2WOW A;  2ZZC A;  4GF7 A;  3URH A;  5HY5 A;  2VQB A;  3JSK A;  5JCI A;  4Q17 A;  2ARD A;  4LII A;  2R0C A;  4USR A;  3CPJ G;  1DOD A;  3NTA A;  4H4R A;  4JN9 A;  4USQ A;  4DSG A;  3ATR A;  2B7S A;  1D7Y A;  1VQW A;  4L38 A;  3UU9 A;  1DOB A;  2WP6 A;  4D04 A;  2FJD A;  4Z2U A;  4Q0T A;  3NN0 X;  4Y4M A;  3UOZ A;  1E1M A;  3KPF A;  5U63 A;  5KWF A;  3AE3 A;  2GAH B;  1IUV A;  4KPR A;  1P2H A;  4OPC A;  2BXR A;  3FO3 A;  1PN0 A;  4EIQ A;  2C4C A;  3D8X A;  1FCD A;  1E7P A;  1F3P A;  1ZKQ A;  3RED A;  1OJD A;  1XDI A;  2XLU A;  1VDC A;  2GR0 A;  2BAC A;  2VVL G;  4K2X A;  4Z2T A;  2R0G A;  2C66 A;  5HXI A;  3BNU A;  3SQP A;  2J3N A;  2XVH A;  3GDN A;  1JEH A;  4EM4 A;  3VQR A;  3L1T A;  4XWR A;  3BHF A;  2XLS A;  1TDN A;  4YTM A;  3CGC A;  3KLJ A;  4UP3 A;  1ONF A;  4FK1 C;  2RAB A;  4EMI A;  2JB3 A;  2YM2 A;  5HHF A;  3RNM A;  4OPI A;  4RG3 A;  2FJB A;  4YWO A;  4B64 A;  4YSZ A;  3BNM A;  1NHR A;  2AR8 A;  4EQX A;  4A6N B;  2V60 A;  2BAB A;  3T2Y A;  3PO7 A;  4RSL A;  2ZZ0 A;  3QFB A;  4J33 A;  2GV8 A;  2CVJ A;  1GER A;  5M0Z A;  2GF3 A;  3VRB A;  1AOG A;  2VRM A;  4OPU A;  1ELI A;  2C65 A;  1LQT A;  3HYV A;  4H4P A;  3RHA A;  2IVD A;  1BGJ A;  2JB2 A;  2WHD A;  4ZCD A;  2WOI A;  2C70 A;  2E5V A;  3AB1 A;  1D7L A;  2Z5Y A;  4IVM B;  1GRF A;  1D5T A;  3CGE A;  2XCG A;  3ICT A;  4BK2 A;  4B69 A;  2VR0 A;  1VRQ B;  4H4Y A;  3UKF A;  4A5L A;  4EQR A;  2J7A A;  2BRA A;  4GUV A;  5LV9 A;  1DJN A;  3DK8 A;  3QSS A;  2XVI A;  3CPI G;  3O0H A;  2FJE A;  3PS9 A;  3PVC A;  4H4V A;  3RKH A;  4H4S A;  1Y0P A;  1NG3 A;  3WE0 A;  1RSG A;  3L8K A;  1S2Q A;  1Z6L A;  3QSM A;  2JAE A;  1FS7 A;  2JKC A;  5BRT A;  1Y56 A;  3NLC A;  2X8C A;  5EB4 A;  1O95 A;  3NKS A;  2OA1 A;  3ICR A;  4AT0 A;  1PBF A;  1UKV G;  1YQZ A;  3UOX A;  3AE6 A;  1GSN A;  2R46 A;  1JRZ A;  1L9E A;  1Q1W A;  2QCU A;  3GRS A;  3SZF A;  1Q1R A;  4EM3 A;  4LU6 A;  2DKH A;  3NNE A;  4IA5 A;  1DOC A;  4G73 A;  4CCR A;  2TMD A;  2ZZB A;  3D1C A;  3AE7 A;  1BZL A;  3ATQ A;  2X99 A;  3II4 A;  4NNJ A;  1H82 A;  4U8M A;  1GPE A;  2BRY A;  1ZK7 A;  2FBW A;  4NWZ A;  3FBS A;  4MJW A;  4YTN A;  5KVH A;  1IUW A;  1GRB A;  4J57 A;  2CFY A;  3OC4 A;  3SXI A;  5KNL A;  3ISH A;  4O5Q A;  3M12 A;  4XXG A;  4WJY A;  2RGO A;  4ICY A;  3UOV A;  3AEB A;  3CGD A;  5KVI A;  1FOH A;  4G6H A;  5KMS A;  3G5R A;  4Z24 A;  5EBK A;  3T2K A;  2B7R A;  2LFC A;  4Y4N A;  2C3D A;  3VR9 A;  3AD8 B;  2BK4 A;  3DJJ A;  1Q9I A;  1IUX A;  2BCG G;  2YG6 A;  3SY4 A;  2YLS A;  4OPL A;  4YKF A;  2YLX A;  5EB5 A;  3F8D A;  5KXJ A;  1KSS A;  3BNJ A;  1H84 A;  2WP5 A;  1PXC A;  3NYF A;  4TLZ A;  3Q9T A;  1Y56 B;  3NRN A;  2YVJ A;  4E0V A;  1O94 A;  2DKI A;  2YR4 A;  3FIM B;  2GQW A;  3CND A;  1LVL A;  1PDH A;  3NN6 X;  4IV9 A;  3KD9 A;  1PBD A;  2C72 A;  5KMP A;  1OJA A;  1FEB A;  5GRT A;  4U2T A;  4BJZ A;  4U8I A;  3CNJ A;  4H4U A;  3DGH A;  3NH3 X;  1GES A;  1NDA A;  3NHO X;  3T37 A;  3AEA A;  4A7A A;  1TRB A;  4OPG A;  3NIX A;  1L9C A;  5FMH A;  2YR6 A;  4C5O A;  2B9Y A;  3IHM A;  3V3N A;  2WU2 A;  2YVG A;  1V59 A;  2WU5 A;  2VRL A;  4YSX A;  1E1N A;  4H4W A;  4H4T A;  4FX9 A;  5CQF A;  4B63 A;  4DNA A;  5KMR A;  4BJY A;  1KNP A;  4O5U A;  4GRT A;  1TDE A;  4NZH A;  1N4U A;  1GND A;  2R4E A;  1CHU A;  2OLO A;  2YM1 A;  4APN A;  3IC9 A;  4BK3 A;  3LGQ A;  1PS9 A;  4WCT A;  3IWA A;  2WET A;  4CRT A;  3FMW A;  3K7T A;  4JY2 A;  1M6I A;  1NHQ A;  2GMJ A;  1MXT A;  2V61 A;  4PAA A;  1LTX R;  4CNJ A;  2WBA A;  5KMQ A;  3CNS A;  3V76 A;  1FS8 A;  2XFN A;  3BHK A;  4TM3 A;  2Y6R A;  4H2P A;  4NTD A;  1CJ2 A;  3IF9 A;  1OJC A;  2C76 A;  4Q5B A;  1ZX9 A;  3CPH G;  4NTE A;  1E39 A;  2GVC A;  4ZN0 A;  2C3C A;  1H81 A;  4M52 A;  1RYI A;  1JOA A;  3GWD A;  3DJD A;  2QA2 A;  3GD4 A;  3UKP A;  4BUR A;  3K7M X;  4XWZ A;  2C75 A;  2WP9 A;  3LOV A;  5JCL A;  5M10 A;  3NGC X;  3BNH A;  1REO A;  4K8D A;  1DXL A;  3NTD A;  3C4A A;  1PBB A;  3UP5 A;  1BKW A;  5IQ1 A;  2X8H A;  3G5S A;  4B1B A;  3GM6 A;  3AWI A;  3CGB A;  5FS7 A;  2CUL A;  1PJ5 A;  1W4X A;  3BI4 A;  3UKH A;  1NHS A;  2JK6 A;  1JRX A;  2EQ7 A;  2Q6U A;  2WS3 A;  1GRG A;  2YLW A;  2Z5X A;  3EPT A;  3NK0 X;  2W0H A;  4H50 A;  4YTP A;  2XFU A;  4H2Q A;  1JNZ A;  4GDP A;  1GOS A;  3UKL A;  4YT0 A;  1N1P A;  3AED A;  3H8L A;  1F8W A;  3NG7 X;  2B76 A;  1KFY A;  1E6E A;  3SGL A;  5KOW A;  2VVM A;  4H4X A;  1NEN A;  1COY A;  2F5Z A;  2XFO A;  3ZDN A;  2OT4 A;  2FJA A;  3QFA A;  5KOX A;  5EOW A;  4HB9 A;  4OPT A;  3AYI A;  3LZX A;  2V3A A;  2RDZ A;  1EL8 A;  2BC1 A;  2Q7V A;  3HYX A;  3P4S A;  2WEU A;  4YSY A;  4GAP A;  2V5Z A;  3SFD A;  3UTE A;  4D03 A;  1ZOY A;  3QSE A;  1M64 A;  2GMH A;  3TTB A;  4C77 A;  2PHH A;  1IUS A;  1S3B A;  1CBO A;  3SZ0 A;  4EQS A;  2ZO5 A;  2BS2 A;  1H86 A;  1FS9 A;  2YG4 A;  1OJ9 A;  1LV0 A;  1H7W A;  3FG2 P;  2XFQ A;  2WDR A;  4UDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...