2K3VA

Solution structure of a tetrahaem cytochrome from shewanella frigidimarina
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
b'ADETLAEFHVEMGGCENCHADGEPSKDGAYEFEQCQSCHGSLAEMDDNHKPHDGLLMCADCHAPHEAKVGEKPTCDTCHDDGRTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetraheme cytochrome c-type
publication title The solution structure of a tetraheme cytochrome from Shewanella frigidimarina reveals a novel family structural motif
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Electron transport
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2k3vA00
1BVBA 1P2HA 1FT6A 3SCEA 2VR0A 1JRXA 1D4CA 3BNJA 1QO8A 3BNFA 3RKHA 1M1QA 1GU6A 2J7AA 1FT5A 3TORA 3BNHA 2E81A 4Q0TA 4WJYA 2RF7A 1D4EA 3D1IA 3FO3A 2ZO5A 1E39A 4Q4UA 4Q5CA 3BNGA 2B7RA 3SXQA 1Y0PA 1D4DA 3TTBA 1KSUA 3F29A 4Q1OA 1M1PA 3UU9A 3OWMA 1OAHA 2K3VA 3MMOA 4Q5BA 1P2EA 3LGQA 1M1RA 1JRZA 2RDZA 4Q17A 3UBRA 2OT4A 3S7WA 1JRYA 1SP3A 1KSSA 3L1TA 4L3ZA 1Q9IA 4L38A 4L3XA 1M64A 4L3YA 1QJDA 3GM6A 1LJ1A 1QDBA 1FS9A 3LG1A 1FS8A 2B7SA 2E80A 1FS7A 1JNIA
chains in the Genus database with same CATH superfamily
1BVBA 2CZSA 1P2HA 1FT6A 3SCEA 2VR0A 1JRXA 1D4CA 3BNJA 1QO8A 3BNFA 3RKHA 1M1QA 1GU6A 2J7AA 1FT5A 3TORA 3BNHA 2E81A 4Q0TA 4WJYA 2RF7A 1D4EA 3D1IA 3FO3A 2ZO5A 1E39A 4Q4UA 4Q5CA 3BNGA 2B7RA 3SXQA 1Y0PA 1D4DA 3TTBA 1KSUA 3F29A 4Q1OA 1M1PA 3UU9A 3OWMA 1OAHA 2K3VA 3MMOA 4Q5BA 1P2EA 3LGQA 1M1RA 1JRZA 2RDZA 4Q17A 3UBRA 2OT4A 3S7WA 1JRYA 1SP3A 1KSSA 3L1TA 4L3ZA 1Q9IA 4L38A 4L3XA 1M64A 4L3YA 1QJDA 3GM6A 1LJ1A 1QDBA 1FS9A 3LG1A 1FS8A 2B7SA 2E80A 1FS7A 1JNIA
chains in the Genus database with same CATH topology
1BVBA 1P2HA 1FT6A 3SCEA 2VR0A 1JRXA 1D4CA 3BNJA 1QO8A 3BNFA 3RKHA 1M1QA 1GU6A 2J7AA 1FT5A 3TORA 3BNHA 2E81A 4Q0TA 4WJYA 2RF7A 1D4EA 3D1IA 3FO3A 2ZO5A 1E39A 4Q4UA 4Q5CA 3BNGA 2B7RA 3SXQA 1Y0PA 1D4DA 3TTBA 1KSUA 3F29A 4Q1OA 1M1PA 3UU9A 3OWMA 1OAHA 2K3VA 3MMOA 4Q5BA 1P2EA 3LGQA 1M1RA 1JRZA 2RDZA 4Q17A 3UBRA 2OT4A 3S7WA 1JRYA 1SP3A 1KSSA 3L1TA 4L3ZA 1Q9IA 4L38A 4L3XA 1M64A 4L3YA 1QJDA 3GM6A 1LJ1A 1QDBA 1FS9A 3LG1A 1FS8A 2B7SA 2E80A 1FS7A 1JNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BVB A;  1P2H A;  1FT6 A;  3SCE A;  2VR0 A;  1JRX A;  1D4C A;  3BNJ A;  1QO8 A;  3BNF A;  3RKH A;  1M1Q A;  1GU6 A;  2J7A A;  1FT5 A;  3TOR A;  3BNH A;  2E81 A;  4Q0T A;  4WJY A;  2RF7 A;  1D4E A;  3D1I A;  3FO3 A;  2ZO5 A;  1E39 A;  4Q4U A;  4Q5C A;  3BNG A;  2B7R A;  3SXQ A;  1Y0P A;  1D4D A;  3TTB A;  1KSU A;  3F29 A;  4Q1O A;  1M1P A;  3UU9 A;  3OWM A;  1OAH A;  2K3V A;  3MMO A;  4Q5B A;  1P2E A;  3LGQ A;  1M1R A;  1JRZ A;  2RDZ A;  4Q17 A;  3UBR A;  2OT4 A;  3S7W A;  1JRY A;  1SP3 A;  1KSS A;  3L1T A;  4L3Z A;  1Q9I A;  4L38 A;  4L3X A;  1M64 A;  4L3Y A;  1QJD A;  3GM6 A;  1LJ1 A;  1QDB A;  1FS9 A;  3LG1 A;  1FS8 A;  2B7S A;  2E80 A;  1FS7 A;  1JNI A; 
#chains in the Genus database with same CATH topology
 1BVB A;  2CZS A;  1P2H A;  1FT6 A;  3SCE A;  2VR0 A;  1JRX A;  1D4C A;  3BNJ A;  1QO8 A;  3BNF A;  3RKH A;  1M1Q A;  1GU6 A;  2J7A A;  1FT5 A;  3TOR A;  3BNH A;  2E81 A;  4Q0T A;  4WJY A;  2RF7 A;  1D4E A;  3D1I A;  3FO3 A;  2ZO5 A;  1E39 A;  4Q4U A;  4Q5C A;  3BNG A;  2B7R A;  3SXQ A;  1Y0P A;  1D4D A;  3TTB A;  1KSU A;  3F29 A;  4Q1O A;  1M1P A;  3UU9 A;  3OWM A;  1OAH A;  2K3V A;  3MMO A;  4Q5B A;  1P2E A;  3LGQ A;  1M1R A;  1JRZ A;  2RDZ A;  4Q17 A;  3UBR A;  2OT4 A;  3S7W A;  1JRY A;  1SP3 A;  1KSS A;  3L1T A;  4L3Z A;  1Q9I A;  4L38 A;  4L3X A;  1M64 A;  4L3Y A;  1QJD A;  3GM6 A;  1LJ1 A;  1QDB A;  1FS9 A;  3LG1 A;  1FS8 A;  2B7S A;  2E80 A;  1FS7 A;  1JNI A; 
#chains in the Genus database with same CATH homology
 1BVB A;  1P2H A;  1FT6 A;  3SCE A;  2VR0 A;  1JRX A;  1D4C A;  3BNJ A;  1QO8 A;  3BNF A;  3RKH A;  1M1Q A;  1GU6 A;  2J7A A;  1FT5 A;  3TOR A;  3BNH A;  2E81 A;  4Q0T A;  4WJY A;  2RF7 A;  1D4E A;  3D1I A;  3FO3 A;  2ZO5 A;  1E39 A;  4Q4U A;  4Q5C A;  3BNG A;  2B7R A;  3SXQ A;  1Y0P A;  1D4D A;  3TTB A;  1KSU A;  3F29 A;  4Q1O A;  1M1P A;  3UU9 A;  3OWM A;  1OAH A;  2K3V A;  3MMO A;  4Q5B A;  1P2E A;  3LGQ A;  1M1R A;  1JRZ A;  2RDZ A;  4Q17 A;  3UBR A;  2OT4 A;  3S7W A;  1JRY A;  1SP3 A;  1KSS A;  3L1T A;  4L3Z A;  1Q9I A;  4L38 A;  4L3X A;  1M64 A;  4L3Y A;  1QJD A;  3GM6 A;  1LJ1 A;  1QDB A;  1FS9 A;  3LG1 A;  1FS8 A;  2B7S A;  2E80 A;  1FS7 A;  1JNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...