2K3VA

Solution structure of a tetrahaem cytochrome from shewanella frigidimarina
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
ADETLAEFHVEMGGCENCHADGEPSKDGAYEFEQCQSCHGSLAEMDDNHKPHDGLLMCADCHAPHEAKVGEKPTCDTCHDDGRTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetraheme cytochrome c-type
publication title The solution structure of a tetraheme cytochrome from Shewanella frigidimarina reveals a novel family structural motif
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Electron transport
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2k3vA00
1M64A 1D4DA 3FO3A 2RF7A 3L1TA 1JRZA 3BNHA 1D4EA 4Q5BA 4Q4UA 1GU6A 3SCEA 2E80A 1M1PA 1QO8A 1BVBA 1SP3A 3S7WA 2K3VA 1KSSA 3F29A 4Q1OA 3MMOA 4Q17A 2OT4A 3SXQA 3TTBA 1E39A 1KSUA 1JRYA 4L3ZA 4Q0TA 4Q5CA 3LG1A 4WJYA 1FS7A 1FS9A 2B7RA 1JNIA 3D1IA 4L3XA 1FT5A 3RKHA 1D4CA 3GM6A 3UBRA 2RDZA 3OWMA 4L38A 2J7AA 3LGQA 1FT6A 1M1RA 1QJDA 1Q9IA 2ZO5A 2VR0A 4L3YA 3BNJA 2B7SA 1FS8A 1LJ1A 3TORA 1P2HA 1P2EA 1OAHA 1Y0PA 3BNFA 1QDBA 3BNGA 3UU9A 1JRXA 1M1QA 2E81A
chains in the Genus database with same CATH superfamily
1M64A 1D4DA 3FO3A 2RF7A 3L1TA 1JRZA 3BNHA 1D4EA 4Q5BA 4Q4UA 1GU6A 3SCEA 2E80A 1M1PA 1QO8A 1BVBA 1SP3A 3S7WA 2K3VA 1KSSA 3F29A 4Q1OA 3MMOA 4Q17A 2OT4A 3SXQA 3TTBA 2CZSA 1E39A 1KSUA 1JRYA 4L3ZA 4Q0TA 4Q5CA 3LG1A 4WJYA 1FS7A 1FS9A 2B7RA 1JNIA 3D1IA 4L3XA 1FT5A 3RKHA 1D4CA 3GM6A 3UBRA 2RDZA 3OWMA 4L38A 2J7AA 3LGQA 1FT6A 1M1RA 1QJDA 1Q9IA 2ZO5A 2VR0A 4L3YA 3BNJA 2B7SA 1FS8A 1LJ1A 3TORA 1P2HA 1P2EA 1OAHA 1Y0PA 3BNFA 1QDBA 3BNGA 3UU9A 1JRXA 1M1QA 2E81A
chains in the Genus database with same CATH topology
1M64A 1D4DA 3FO3A 2RF7A 3L1TA 1JRZA 3BNHA 1D4EA 4Q5BA 4Q4UA 1GU6A 3SCEA 2E80A 1M1PA 1QO8A 1BVBA 1SP3A 3S7WA 2K3VA 1KSSA 3F29A 4Q1OA 3MMOA 4Q17A 2OT4A 3SXQA 3TTBA 1E39A 1KSUA 1JRYA 4L3ZA 4Q0TA 4Q5CA 3LG1A 4WJYA 1FS7A 1FS9A 2B7RA 1JNIA 3D1IA 4L3XA 1FT5A 3RKHA 1D4CA 3GM6A 3UBRA 2RDZA 3OWMA 4L38A 2J7AA 3LGQA 1FT6A 1M1RA 1QJDA 1Q9IA 2ZO5A 2VR0A 4L3YA 3BNJA 2B7SA 1FS8A 1LJ1A 3TORA 1P2HA 1P2EA 1OAHA 1Y0PA 3BNFA 1QDBA 3BNGA 3UU9A 1JRXA 1M1QA 2E81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M64 A;  1D4D A;  3FO3 A;  2RF7 A;  3L1T A;  1JRZ A;  3BNH A;  1D4E A;  4Q5B A;  4Q4U A;  1GU6 A;  3SCE A;  2E80 A;  1M1P A;  1QO8 A;  1BVB A;  1SP3 A;  3S7W A;  2K3V A;  1KSS A;  3F29 A;  4Q1O A;  3MMO A;  4Q17 A;  2OT4 A;  3SXQ A;  3TTB A;  1E39 A;  1KSU A;  1JRY A;  4L3Z A;  4Q0T A;  4Q5C A;  3LG1 A;  4WJY A;  1FS7 A;  1FS9 A;  2B7R A;  1JNI A;  3D1I A;  4L3X A;  1FT5 A;  3RKH A;  1D4C A;  3GM6 A;  3UBR A;  2RDZ A;  3OWM A;  4L38 A;  2J7A A;  3LGQ A;  1FT6 A;  1M1R A;  1QJD A;  1Q9I A;  2ZO5 A;  2VR0 A;  4L3Y A;  3BNJ A;  2B7S A;  1FS8 A;  1LJ1 A;  3TOR A;  1P2H A;  1P2E A;  1OAH A;  1Y0P A;  3BNF A;  1QDB A;  3BNG A;  3UU9 A;  1JRX A;  1M1Q A;  2E81 A; 
#chains in the Genus database with same CATH topology
 1M64 A;  1D4D A;  3FO3 A;  2RF7 A;  3L1T A;  1JRZ A;  3BNH A;  1D4E A;  4Q5B A;  4Q4U A;  1GU6 A;  3SCE A;  2E80 A;  1M1P A;  1QO8 A;  1BVB A;  1SP3 A;  3S7W A;  2K3V A;  1KSS A;  3F29 A;  4Q1O A;  3MMO A;  4Q17 A;  2OT4 A;  3SXQ A;  3TTB A;  2CZS A;  1E39 A;  1KSU A;  1JRY A;  4L3Z A;  4Q0T A;  4Q5C A;  3LG1 A;  4WJY A;  1FS7 A;  1FS9 A;  2B7R A;  1JNI A;  3D1I A;  4L3X A;  1FT5 A;  3RKH A;  1D4C A;  3GM6 A;  3UBR A;  2RDZ A;  3OWM A;  4L38 A;  2J7A A;  3LGQ A;  1FT6 A;  1M1R A;  1QJD A;  1Q9I A;  2ZO5 A;  2VR0 A;  4L3Y A;  3BNJ A;  2B7S A;  1FS8 A;  1LJ1 A;  3TOR A;  1P2H A;  1P2E A;  1OAH A;  1Y0P A;  3BNF A;  1QDB A;  3BNG A;  3UU9 A;  1JRX A;  1M1Q A;  2E81 A; 
#chains in the Genus database with same CATH homology
 1M64 A;  1D4D A;  3FO3 A;  2RF7 A;  3L1T A;  1JRZ A;  3BNH A;  1D4E A;  4Q5B A;  4Q4U A;  1GU6 A;  3SCE A;  2E80 A;  1M1P A;  1QO8 A;  1BVB A;  1SP3 A;  3S7W A;  2K3V A;  1KSS A;  3F29 A;  4Q1O A;  3MMO A;  4Q17 A;  2OT4 A;  3SXQ A;  3TTB A;  1E39 A;  1KSU A;  1JRY A;  4L3Z A;  4Q0T A;  4Q5C A;  3LG1 A;  4WJY A;  1FS7 A;  1FS9 A;  2B7R A;  1JNI A;  3D1I A;  4L3X A;  1FT5 A;  3RKH A;  1D4C A;  3GM6 A;  3UBR A;  2RDZ A;  3OWM A;  4L38 A;  2J7A A;  3LGQ A;  1FT6 A;  1M1R A;  1QJD A;  1Q9I A;  2ZO5 A;  2VR0 A;  4L3Y A;  3BNJ A;  2B7S A;  1FS8 A;  1LJ1 A;  3TOR A;  1P2H A;  1P2E A;  1OAH A;  1Y0P A;  3BNF A;  1QDB A;  3BNG A;  3UU9 A;  1JRX A;  1M1Q A;  2E81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...