2K3VA

Solution structure of a tetrahaem cytochrome from shewanella frigidimarina
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
ADETLAEFHVEMGGCENCHADGEPSKDGAYEFEQCQSCHGSLAEMDDNHKPHDGLLMCADCHAPHEAKVGEKPTCDTCHDDGRTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Tetraheme cytochrome c-type
publication title The solution structure of a tetraheme cytochrome from Shewanella frigidimarina reveals a novel family structural motif
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2k3vA00
4Q1OA 1JNIA 3F29A 2OT4A 1E39A 2E80A 4L3XA 2J7AA 1FT5A 1FS7A 3SCEA 3BNHA 2E81A 1GU6A 1M1PA 2ZO5A 1OAHA 2VR0A 4L3YA 1Y0PA 3D1IA 3GM6A 1FS9A 2B7SA 3FO3A 4Q5CA 1JRZA 1M1RA 3L1TA 4Q5BA 3SXQA 3TTBA 1SP3A 3RKHA 4L38A 1D4EA 3UBRA 1P2HA 1M1QA 1FT6A 1M64A 1BVBA 1Q9IA 2RDZA 3LG1A 3TORA 3UU9A 3BNGA 4WJYA 1FS8A 1P2EA 1JRYA 1KSSA 2B7RA 3OWMA 4Q0TA 1LJ1A 1D4CA 1QO8A 2K3VA 3BNFA 4L3ZA 2RF7A 4Q17A 3S7WA 1QJDA 1QDBA 3MMOA 1D4DA 1KSUA 3BNJA 3LGQA 1JRXA 4Q4UA
chains in the Genus database with same CATH superfamily
4Q1OA 1JNIA 3F29A 2OT4A 1E39A 2E80A 4L3XA 2J7AA 1FT5A 1FS7A 3SCEA 3BNHA 2E81A 1GU6A 1M1PA 2ZO5A 1OAHA 2VR0A 4L3YA 1Y0PA 3D1IA 3GM6A 1FS9A 2B7SA 3FO3A 4Q5CA 1JRZA 1M1RA 3L1TA 4Q5BA 3SXQA 3TTBA 1SP3A 3RKHA 4L38A 1D4EA 3UBRA 1P2HA 1M1QA 1FT6A 1M64A 1BVBA 1Q9IA 2CZSA 2RDZA 3LG1A 3TORA 3BNGA 3UU9A 4WJYA 1FS8A 1P2EA 1JRYA 1KSSA 2B7RA 3OWMA 4Q0TA 1LJ1A 1D4CA 1QO8A 2K3VA 3BNFA 4L3ZA 2RF7A 4Q17A 3S7WA 1QJDA 1QDBA 3MMOA 1D4DA 1KSUA 3BNJA 3LGQA 1JRXA 4Q4UA
chains in the Genus database with same CATH topology
4Q1OA 1JNIA 3F29A 2OT4A 1E39A 2E80A 4L3XA 2J7AA 1FT5A 1FS7A 3SCEA 3BNHA 2E81A 1GU6A 1M1PA 2ZO5A 1OAHA 2VR0A 4L3YA 1Y0PA 3D1IA 3GM6A 1FS9A 2B7SA 3FO3A 4Q5CA 1JRZA 1M1RA 3L1TA 4Q5BA 3SXQA 3TTBA 1SP3A 3RKHA 4L38A 1D4EA 3UBRA 1P2HA 1M1QA 1FT6A 1M64A 1BVBA 1Q9IA 2RDZA 3LG1A 3TORA 3UU9A 3BNGA 4WJYA 1FS8A 1P2EA 1JRYA 1KSSA 2B7RA 3OWMA 4Q0TA 1LJ1A 1D4CA 1QO8A 2K3VA 3BNFA 4L3ZA 2RF7A 4Q17A 3S7WA 1QJDA 1QDBA 3MMOA 1D4DA 1KSUA 3BNJA 3LGQA 1JRXA 4Q4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q1O A;  1JNI A;  3F29 A;  2OT4 A;  1E39 A;  2E80 A;  4L3X A;  2J7A A;  1FT5 A;  1FS7 A;  3SCE A;  3BNH A;  2E81 A;  1GU6 A;  1M1P A;  2ZO5 A;  1OAH A;  2VR0 A;  4L3Y A;  1Y0P A;  3D1I A;  3GM6 A;  1FS9 A;  2B7S A;  3FO3 A;  4Q5C A;  1JRZ A;  1M1R A;  3L1T A;  4Q5B A;  3SXQ A;  3TTB A;  1SP3 A;  3RKH A;  4L38 A;  1D4E A;  3UBR A;  1P2H A;  1M1Q A;  1FT6 A;  1M64 A;  1BVB A;  1Q9I A;  2RDZ A;  3LG1 A;  3TOR A;  3UU9 A;  3BNG A;  4WJY A;  1FS8 A;  1P2E A;  1JRY A;  1KSS A;  2B7R A;  3OWM A;  4Q0T A;  1LJ1 A;  1D4C A;  1QO8 A;  2K3V A;  3BNF A;  4L3Z A;  2RF7 A;  4Q17 A;  3S7W A;  1QJD A;  1QDB A;  3MMO A;  1D4D A;  1KSU A;  3BNJ A;  3LGQ A;  1JRX A;  4Q4U A; 
#chains in the Genus database with same CATH topology
 4Q1O A;  1JNI A;  3F29 A;  2OT4 A;  1E39 A;  2E80 A;  4L3X A;  2J7A A;  1FT5 A;  1FS7 A;  3SCE A;  3BNH A;  2E81 A;  1GU6 A;  1M1P A;  2ZO5 A;  1OAH A;  2VR0 A;  4L3Y A;  1Y0P A;  3D1I A;  3GM6 A;  1FS9 A;  2B7S A;  3FO3 A;  4Q5C A;  1JRZ A;  1M1R A;  3L1T A;  4Q5B A;  3SXQ A;  3TTB A;  1SP3 A;  3RKH A;  4L38 A;  1D4E A;  3UBR A;  1P2H A;  1M1Q A;  1FT6 A;  1M64 A;  1BVB A;  1Q9I A;  2CZS A;  2RDZ A;  3LG1 A;  3TOR A;  3BNG A;  3UU9 A;  4WJY A;  1FS8 A;  1P2E A;  1JRY A;  1KSS A;  2B7R A;  3OWM A;  4Q0T A;  1LJ1 A;  1D4C A;  1QO8 A;  2K3V A;  3BNF A;  4L3Z A;  2RF7 A;  4Q17 A;  3S7W A;  1QJD A;  1QDB A;  3MMO A;  1D4D A;  1KSU A;  3BNJ A;  3LGQ A;  1JRX A;  4Q4U A; 
#chains in the Genus database with same CATH homology
 4Q1O A;  1JNI A;  3F29 A;  2OT4 A;  1E39 A;  2E80 A;  4L3X A;  2J7A A;  1FT5 A;  1FS7 A;  3SCE A;  3BNH A;  2E81 A;  1GU6 A;  1M1P A;  2ZO5 A;  1OAH A;  2VR0 A;  4L3Y A;  1Y0P A;  3D1I A;  3GM6 A;  1FS9 A;  2B7S A;  3FO3 A;  4Q5C A;  1JRZ A;  1M1R A;  3L1T A;  4Q5B A;  3SXQ A;  3TTB A;  1SP3 A;  3RKH A;  4L38 A;  1D4E A;  3UBR A;  1P2H A;  1M1Q A;  1FT6 A;  1M64 A;  1BVB A;  1Q9I A;  2RDZ A;  3LG1 A;  3TOR A;  3UU9 A;  3BNG A;  4WJY A;  1FS8 A;  1P2E A;  1JRY A;  1KSS A;  2B7R A;  3OWM A;  4Q0T A;  1LJ1 A;  1D4C A;  1QO8 A;  2K3V A;  3BNF A;  4L3Z A;  2RF7 A;  4Q17 A;  3S7W A;  1QJD A;  1QDB A;  3MMO A;  1D4D A;  1KSU A;  3BNJ A;  3LGQ A;  1JRX A;  4Q4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...