1M1RA

Reduced p222 crystal structure of the tetraheme cytochrome c of shewanella oneidensis mr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
ADQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL tetraheme cytochrome c
publication title Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1m1rA00
3L1TA 4Q5BA 3UU9A 1GU6A 4Q4UA 1FS9A 1JRXA 1LJ1A 2B7RA 4L3ZA 1JNIA 1FS8A 3MMOA 3BNJA 1QO8A 2K3VA 1P2HA 1QDBA 1E39A 3LG1A 4L3YA 1M1PA 4WJYA 3OWMA 3LGQA 4Q17A 3SXQA 1QJDA 2E80A 4L38A 1JRYA 3BNHA 1KSUA 2VR0A 1KSSA 3F29A 1BVBA 1P2EA 3TTBA 2RDZA 1D4DA 3SCEA 1D4EA 1M64A 4Q0TA 1Y0PA 1OAHA 1FS7A 1M1QA 1Q9IA 2RF7A 1FT5A 3D1IA 2ZO5A 4Q1OA 1M1RA 2E81A 1D4CA 1SP3A 3BNFA 3BNGA 4Q5CA 3UBRA 3FO3A 4L3XA 1FT6A 3TORA 2J7AA 2OT4A 3RKHA 2B7SA 3S7WA 3GM6A 1JRZA
chains in the Genus database with same CATH superfamily
3L1TA 4Q5BA 3UU9A 1GU6A 4Q4UA 1FS9A 1JRXA 1LJ1A 2B7RA 4L3ZA 1JNIA 1FS8A 3MMOA 3BNJA 1QO8A 2K3VA 1P2HA 1QDBA 1E39A 3LG1A 4L3YA 1M1PA 4WJYA 3OWMA 3LGQA 4Q17A 3SXQA 1QJDA 2CZSA 2E80A 1JRYA 3BNHA 1KSUA 4L38A 2VR0A 1KSSA 3F29A 1BVBA 1P2EA 3TTBA 2RDZA 1D4DA 3SCEA 1D4EA 1M64A 4Q0TA 1Y0PA 1OAHA 1FS7A 1M1QA 1Q9IA 2RF7A 1FT5A 3D1IA 2ZO5A 4Q1OA 1M1RA 2E81A 1D4CA 1SP3A 3BNFA 3BNGA 4Q5CA 3UBRA 3FO3A 4L3XA 1FT6A 3TORA 2J7AA 2OT4A 3RKHA 2B7SA 3S7WA 3GM6A 1JRZA
chains in the Genus database with same CATH topology
3L1TA 4Q5BA 3UU9A 1GU6A 4Q4UA 1FS9A 1JRXA 1LJ1A 2B7RA 4L3ZA 1JNIA 1FS8A 3MMOA 3BNJA 1QO8A 2K3VA 1P2HA 1QDBA 1E39A 3LG1A 4L3YA 1M1PA 4WJYA 3OWMA 3LGQA 4Q17A 3SXQA 1QJDA 2E80A 4L38A 1JRYA 3BNHA 1KSUA 2VR0A 1KSSA 3F29A 1BVBA 1P2EA 3TTBA 2RDZA 1D4DA 3SCEA 1D4EA 1M64A 4Q0TA 1Y0PA 1OAHA 1FS7A 1M1QA 1Q9IA 2RF7A 1FT5A 3D1IA 2ZO5A 4Q1OA 1M1RA 2E81A 1D4CA 1SP3A 3BNFA 3BNGA 4Q5CA 3UBRA 3FO3A 4L3XA 1FT6A 3TORA 2J7AA 2OT4A 3RKHA 2B7SA 3S7WA 3GM6A 1JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1T A;  4Q5B A;  3UU9 A;  1GU6 A;  4Q4U A;  1FS9 A;  1JRX A;  1LJ1 A;  2B7R A;  4L3Z A;  1JNI A;  1FS8 A;  3MMO A;  3BNJ A;  1QO8 A;  2K3V A;  1P2H A;  1QDB A;  1E39 A;  3LG1 A;  4L3Y A;  1M1P A;  4WJY A;  3OWM A;  3LGQ A;  4Q17 A;  3SXQ A;  1QJD A;  2E80 A;  4L38 A;  1JRY A;  3BNH A;  1KSU A;  2VR0 A;  1KSS A;  3F29 A;  1BVB A;  1P2E A;  3TTB A;  2RDZ A;  1D4D A;  3SCE A;  1D4E A;  1M64 A;  4Q0T A;  1Y0P A;  1OAH A;  1FS7 A;  1M1Q A;  1Q9I A;  2RF7 A;  1FT5 A;  3D1I A;  2ZO5 A;  4Q1O A;  1M1R A;  2E81 A;  1D4C A;  1SP3 A;  3BNF A;  3BNG A;  4Q5C A;  3UBR A;  3FO3 A;  4L3X A;  1FT6 A;  3TOR A;  2J7A A;  2OT4 A;  3RKH A;  2B7S A;  3S7W A;  3GM6 A;  1JRZ A; 
#chains in the Genus database with same CATH topology
 3L1T A;  4Q5B A;  3UU9 A;  1GU6 A;  4Q4U A;  1FS9 A;  1JRX A;  1LJ1 A;  2B7R A;  4L3Z A;  1JNI A;  1FS8 A;  3MMO A;  3BNJ A;  1QO8 A;  2K3V A;  1P2H A;  1QDB A;  1E39 A;  3LG1 A;  4L3Y A;  1M1P A;  4WJY A;  3OWM A;  3LGQ A;  4Q17 A;  3SXQ A;  1QJD A;  2CZS A;  2E80 A;  1JRY A;  3BNH A;  1KSU A;  4L38 A;  2VR0 A;  1KSS A;  3F29 A;  1BVB A;  1P2E A;  3TTB A;  2RDZ A;  1D4D A;  3SCE A;  1D4E A;  1M64 A;  4Q0T A;  1Y0P A;  1OAH A;  1FS7 A;  1M1Q A;  1Q9I A;  2RF7 A;  1FT5 A;  3D1I A;  2ZO5 A;  4Q1O A;  1M1R A;  2E81 A;  1D4C A;  1SP3 A;  3BNF A;  3BNG A;  4Q5C A;  3UBR A;  3FO3 A;  4L3X A;  1FT6 A;  3TOR A;  2J7A A;  2OT4 A;  3RKH A;  2B7S A;  3S7W A;  3GM6 A;  1JRZ A; 
#chains in the Genus database with same CATH homology
 3L1T A;  4Q5B A;  3UU9 A;  1GU6 A;  4Q4U A;  1FS9 A;  1JRX A;  1LJ1 A;  2B7R A;  4L3Z A;  1JNI A;  1FS8 A;  3MMO A;  3BNJ A;  1QO8 A;  2K3V A;  1P2H A;  1QDB A;  1E39 A;  3LG1 A;  4L3Y A;  1M1P A;  4WJY A;  3OWM A;  3LGQ A;  4Q17 A;  3SXQ A;  1QJD A;  2E80 A;  4L38 A;  1JRY A;  3BNH A;  1KSU A;  2VR0 A;  1KSS A;  3F29 A;  1BVB A;  1P2E A;  3TTB A;  2RDZ A;  1D4D A;  3SCE A;  1D4E A;  1M64 A;  4Q0T A;  1Y0P A;  1OAH A;  1FS7 A;  1M1Q A;  1Q9I A;  2RF7 A;  1FT5 A;  3D1I A;  2ZO5 A;  4Q1O A;  1M1R A;  2E81 A;  1D4C A;  1SP3 A;  3BNF A;  3BNG A;  4Q5C A;  3UBR A;  3FO3 A;  4L3X A;  1FT6 A;  3TOR A;  2J7A A;  2OT4 A;  3RKH A;  2B7S A;  3S7W A;  3GM6 A;  1JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...