1M1RA

Reduced p222 crystal structure of the tetraheme cytochrome c of shewanella oneidensis mr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
ADQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords SMALL tetraheme cytochrome c
publication title Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c
pubmed doi rcsb
total genus 23
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1m1rA00
1BVBA 2ZO5A 1JRZA 2B7SA 1D4DA 2RF7A 1LJ1A 3MMOA 3F29A 2E81A 3FO3A 4WJYA 3UBRA 1Y0PA 4L3ZA 1P2EA 4L3XA 3BNJA 4L38A 1JNIA 3SCEA 4Q5BA 1OAHA 1FT6A 2E80A 3S7WA 2RDZA 3TTBA 1KSUA 2VR0A 3OWMA 3D1IA 3BNHA 4Q0TA 4Q1OA 1FS9A 1M64A 1QJDA 2J7AA 1D4CA 4L3YA 1GU6A 3BNGA 1D4EA 1M1RA 3TORA 3BNFA 2B7RA 4Q4UA 1FS7A 3SXQA 1FS8A 1Q9IA 4Q17A 1KSSA 3GM6A 2K3VA 1E39A 1FT5A 3UU9A 1QDBA 3LGQA 1M1PA 1P2HA 1SP3A 3L1TA 1QO8A 3RKHA 2OT4A 1M1QA 3LG1A 4Q5CA 1JRYA 1JRXA
chains in the Genus database with same CATH superfamily
1BVBA 2ZO5A 1JRZA 2B7SA 1D4DA 2RF7A 1LJ1A 3MMOA 3F29A 2E81A 3FO3A 4WJYA 3UBRA 1Y0PA 4L3ZA 1P2EA 4L3XA 3BNJA 4L38A 1JNIA 3SCEA 4Q5BA 1OAHA 1FT6A 2E80A 3S7WA 2RDZA 3TTBA 1KSUA 2VR0A 3OWMA 3D1IA 3BNHA 4Q0TA 4Q1OA 1FS9A 1M64A 1QJDA 2J7AA 1D4CA 4L3YA 1GU6A 3BNGA 1D4EA 1M1RA 3TORA 3BNFA 2B7RA 4Q4UA 1FS7A 2CZSA 1FS8A 3SXQA 1Q9IA 4Q17A 1KSSA 3GM6A 2K3VA 1E39A 1FT5A 3UU9A 1QDBA 3LGQA 1M1PA 1P2HA 1SP3A 3L1TA 1QO8A 3RKHA 2OT4A 1M1QA 3LG1A 4Q5CA 1JRYA 1JRXA
chains in the Genus database with same CATH topology
1BVBA 2ZO5A 1JRZA 2B7SA 1D4DA 2RF7A 1LJ1A 3MMOA 3F29A 2E81A 3FO3A 4WJYA 3UBRA 1Y0PA 4L3ZA 1P2EA 4L3XA 3BNJA 4L38A 1JNIA 3SCEA 4Q5BA 1OAHA 1FT6A 2E80A 3S7WA 2RDZA 3TTBA 1KSUA 2VR0A 3OWMA 3D1IA 3BNHA 4Q0TA 4Q1OA 1FS9A 1M64A 1QJDA 2J7AA 1D4CA 4L3YA 1GU6A 3BNGA 1D4EA 1M1RA 3TORA 3BNFA 2B7RA 4Q4UA 1FS7A 3SXQA 1FS8A 1Q9IA 4Q17A 1KSSA 3GM6A 2K3VA 1E39A 1FT5A 3UU9A 1QDBA 3LGQA 1M1PA 1P2HA 1SP3A 3L1TA 1QO8A 3RKHA 2OT4A 1M1QA 3LG1A 4Q5CA 1JRYA 1JRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BVB A;  2ZO5 A;  1JRZ A;  2B7S A;  1D4D A;  2RF7 A;  1LJ1 A;  3MMO A;  3F29 A;  2E81 A;  3FO3 A;  4WJY A;  3UBR A;  1Y0P A;  4L3Z A;  1P2E A;  4L3X A;  3BNJ A;  4L38 A;  1JNI A;  3SCE A;  4Q5B A;  1OAH A;  1FT6 A;  2E80 A;  3S7W A;  2RDZ A;  3TTB A;  1KSU A;  2VR0 A;  3OWM A;  3D1I A;  3BNH A;  4Q0T A;  4Q1O A;  1FS9 A;  1M64 A;  1QJD A;  2J7A A;  1D4C A;  4L3Y A;  1GU6 A;  3BNG A;  1D4E A;  1M1R A;  3TOR A;  3BNF A;  2B7R A;  4Q4U A;  1FS7 A;  3SXQ A;  1FS8 A;  1Q9I A;  4Q17 A;  1KSS A;  3GM6 A;  2K3V A;  1E39 A;  1FT5 A;  3UU9 A;  1QDB A;  3LGQ A;  1M1P A;  1P2H A;  1SP3 A;  3L1T A;  1QO8 A;  3RKH A;  2OT4 A;  1M1Q A;  3LG1 A;  4Q5C A;  1JRY A;  1JRX A; 
#chains in the Genus database with same CATH topology
 1BVB A;  2ZO5 A;  1JRZ A;  2B7S A;  1D4D A;  2RF7 A;  1LJ1 A;  3MMO A;  3F29 A;  2E81 A;  3FO3 A;  4WJY A;  3UBR A;  1Y0P A;  4L3Z A;  1P2E A;  4L3X A;  3BNJ A;  4L38 A;  1JNI A;  3SCE A;  4Q5B A;  1OAH A;  1FT6 A;  2E80 A;  3S7W A;  2RDZ A;  3TTB A;  1KSU A;  2VR0 A;  3OWM A;  3D1I A;  3BNH A;  4Q0T A;  4Q1O A;  1FS9 A;  1M64 A;  1QJD A;  2J7A A;  1D4C A;  4L3Y A;  1GU6 A;  3BNG A;  1D4E A;  1M1R A;  3TOR A;  3BNF A;  2B7R A;  4Q4U A;  1FS7 A;  2CZS A;  1FS8 A;  3SXQ A;  1Q9I A;  4Q17 A;  1KSS A;  3GM6 A;  2K3V A;  1E39 A;  1FT5 A;  3UU9 A;  1QDB A;  3LGQ A;  1M1P A;  1P2H A;  1SP3 A;  3L1T A;  1QO8 A;  3RKH A;  2OT4 A;  1M1Q A;  3LG1 A;  4Q5C A;  1JRY A;  1JRX A; 
#chains in the Genus database with same CATH homology
 1BVB A;  2ZO5 A;  1JRZ A;  2B7S A;  1D4D A;  2RF7 A;  1LJ1 A;  3MMO A;  3F29 A;  2E81 A;  3FO3 A;  4WJY A;  3UBR A;  1Y0P A;  4L3Z A;  1P2E A;  4L3X A;  3BNJ A;  4L38 A;  1JNI A;  3SCE A;  4Q5B A;  1OAH A;  1FT6 A;  2E80 A;  3S7W A;  2RDZ A;  3TTB A;  1KSU A;  2VR0 A;  3OWM A;  3D1I A;  3BNH A;  4Q0T A;  4Q1O A;  1FS9 A;  1M64 A;  1QJD A;  2J7A A;  1D4C A;  4L3Y A;  1GU6 A;  3BNG A;  1D4E A;  1M1R A;  3TOR A;  3BNF A;  2B7R A;  4Q4U A;  1FS7 A;  3SXQ A;  1FS8 A;  1Q9I A;  4Q17 A;  1KSS A;  3GM6 A;  2K3V A;  1E39 A;  1FT5 A;  3UU9 A;  1QDB A;  3LGQ A;  1M1P A;  1P2H A;  1SP3 A;  3L1T A;  1QO8 A;  3RKH A;  2OT4 A;  1M1Q A;  3LG1 A;  4Q5C A;  1JRY A;  1JRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...