1SP3A

Crystal structure of octaheme cytochrome c from shewanella oneidensis
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
442
structure length
436
Chain Sequence
ANPHKDVLKGPFTTGSEVTTQCLTCHEEQATDMMKTSHWTWELEQKLPDRTVVRGKKNSINNFCVAISSNEPRCTSCHAGYGWKDNTFDFKDKTKVDCLICHDTTGTYVKDPAGAGEPMAKLDLAKIAQNVGAPVRDNCGSCHFYGKHGDLDSSMAYPDKATDVHMDSDGNNFQCQNCHTTEKHQISGNAMGVSPGGIDHIGCENCHDSAPHSNKKLNTHTATVACQTCHIPFFAKNEPTKMQWDWSTAGDDKPETVDQYGKHTYQKKKGNFVWEKMVKPQYAWYNGTANAYMAGDKMDSNVVTKLTYPMGDINDAKAKIYPFKVHTGKQIYDKKLNIFITPKTYGKGGYWSEFDWNLAAKLGMEANPTMLEKGIKYSGEYDFAATEMWWRINHMVSPKEQALNCNDCHNKGTRLDWQALGYQGDPMKNKQGPKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords cytochrome c, putative
publication title Octaheme tetrathionate reductase is a respiratory enzyme with novel heme ligation.
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 111
structure length 436
sequence length 442
ec nomenclature
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11783 Cytochrome_cB Cytochrome c bacterial
A PF13435 Cytochrome_C554 Cytochrome c554 and c-prime
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1sp3A01
1SP3A 3UU9A 3SXQA 1QJDA 4Q17A 1QDBA 1QO8A 2RF7A 1E39A 3F29A 3MMOA 4L3XA 4Q5BA 3BNGA 1LJ1A 4Q0TA 1JRYA 3GM6A 2RDZA 4L3ZA 2B7SA 4Q5CA 1JRZA 1D4CA 3TTBA 1Q9IA 2B7RA 3L1TA 3TORA 2J7AA 1FT5A 1Y0PA 2E80A 3BNHA 3LG1A 1FS9A 1FS7A 1GU6A 3RKHA 3SCEA 2VR0A 1KSSA 1D4EA 1FS8A 1M64A 3FO3A 3LGQA 1D4DA 3BNFA 4Q4UA 1P2EA 1M1PA 1M1RA 1JNIA 1M1QA 1KSUA 2K3VA 3OWMA 2OT4A 4WJYA 3D1IA 3UBRA 1P2HA 4L3YA 3S7WA 4L38A 2E81A 1FT6A 2ZO5A 1OAHA 3BNJA 4Q1OA 1JRXA 1BVBA
chains in the Genus database with same CATH superfamily
1SP3A 3UU9A 3SXQA 1QJDA 4Q17A 1QDBA 1QO8A 2CZSA 1E39A 2RF7A 3F29A 3MMOA 4L3XA 3BNGA 4Q5BA 1LJ1A 4Q0TA 1JRYA 3GM6A 2RDZA 4L3ZA 2B7SA 4Q5CA 1JRZA 1D4CA 3TTBA 1Q9IA 2B7RA 3L1TA 3TORA 2J7AA 1FT5A 1Y0PA 2E80A 3BNHA 3LG1A 1FS9A 1FS7A 1GU6A 3RKHA 3SCEA 2VR0A 1KSSA 1D4EA 1FS8A 1M64A 3FO3A 3LGQA 1D4DA 3BNFA 4Q4UA 1P2EA 1M1PA 1M1RA 1JNIA 1M1QA 1KSUA 2K3VA 3OWMA 2OT4A 4WJYA 3D1IA 3UBRA 1P2HA 4L3YA 3S7WA 4L38A 2E81A 1FT6A 2ZO5A 1OAHA 3BNJA 4Q1OA 1JRXA 1BVBA
chains in the Genus database with same CATH topology
1SP3A 3UU9A 3SXQA 1QJDA 4Q17A 1QDBA 1QO8A 2RF7A 1E39A 3F29A 3MMOA 4L3XA 4Q5BA 3BNGA 1LJ1A 4Q0TA 1JRYA 3GM6A 2RDZA 4L3ZA 2B7SA 4Q5CA 1JRZA 1D4CA 3TTBA 1Q9IA 2B7RA 3L1TA 3TORA 2J7AA 1FT5A 1Y0PA 2E80A 3BNHA 3LG1A 1FS9A 1FS7A 1GU6A 3RKHA 3SCEA 2VR0A 1KSSA 1D4EA 1FS8A 1M64A 3FO3A 3LGQA 1D4DA 3BNFA 4Q4UA 1P2EA 1M1PA 1M1RA 1JNIA 1M1QA 1KSUA 2K3VA 3OWMA 2OT4A 4WJYA 3D1IA 3UBRA 1P2HA 4L3YA 3S7WA 4L38A 2E81A 1FT6A 2ZO5A 1OAHA 3BNJA 4Q1OA 1JRXA 1BVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SP3 A;  3UU9 A;  3SXQ A;  1QJD A;  4Q17 A;  1QDB A;  1QO8 A;  2RF7 A;  1E39 A;  3F29 A;  3MMO A;  4L3X A;  4Q5B A;  3BNG A;  1LJ1 A;  4Q0T A;  1JRY A;  3GM6 A;  2RDZ A;  4L3Z A;  2B7S A;  4Q5C A;  1JRZ A;  1D4C A;  3TTB A;  1Q9I A;  2B7R A;  3L1T A;  3TOR A;  2J7A A;  1FT5 A;  1Y0P A;  2E80 A;  3BNH A;  3LG1 A;  1FS9 A;  1FS7 A;  1GU6 A;  3RKH A;  3SCE A;  2VR0 A;  1KSS A;  1D4E A;  1FS8 A;  1M64 A;  3FO3 A;  3LGQ A;  1D4D A;  3BNF A;  4Q4U A;  1P2E A;  1M1P A;  1M1R A;  1JNI A;  1M1Q A;  1KSU A;  2K3V A;  3OWM A;  2OT4 A;  4WJY A;  3D1I A;  3UBR A;  1P2H A;  4L3Y A;  3S7W A;  4L38 A;  2E81 A;  1FT6 A;  2ZO5 A;  1OAH A;  3BNJ A;  4Q1O A;  1JRX A;  1BVB A; 
#chains in the Genus database with same CATH topology
 1SP3 A;  3UU9 A;  3SXQ A;  1QJD A;  4Q17 A;  1QDB A;  1QO8 A;  2CZS A;  1E39 A;  2RF7 A;  3F29 A;  3MMO A;  4L3X A;  3BNG A;  4Q5B A;  1LJ1 A;  4Q0T A;  1JRY A;  3GM6 A;  2RDZ A;  4L3Z A;  2B7S A;  4Q5C A;  1JRZ A;  1D4C A;  3TTB A;  1Q9I A;  2B7R A;  3L1T A;  3TOR A;  2J7A A;  1FT5 A;  1Y0P A;  2E80 A;  3BNH A;  3LG1 A;  1FS9 A;  1FS7 A;  1GU6 A;  3RKH A;  3SCE A;  2VR0 A;  1KSS A;  1D4E A;  1FS8 A;  1M64 A;  3FO3 A;  3LGQ A;  1D4D A;  3BNF A;  4Q4U A;  1P2E A;  1M1P A;  1M1R A;  1JNI A;  1M1Q A;  1KSU A;  2K3V A;  3OWM A;  2OT4 A;  4WJY A;  3D1I A;  3UBR A;  1P2H A;  4L3Y A;  3S7W A;  4L38 A;  2E81 A;  1FT6 A;  2ZO5 A;  1OAH A;  3BNJ A;  4Q1O A;  1JRX A;  1BVB A; 
#chains in the Genus database with same CATH homology
 1SP3 A;  3UU9 A;  3SXQ A;  1QJD A;  4Q17 A;  1QDB A;  1QO8 A;  2RF7 A;  1E39 A;  3F29 A;  3MMO A;  4L3X A;  4Q5B A;  3BNG A;  1LJ1 A;  4Q0T A;  1JRY A;  3GM6 A;  2RDZ A;  4L3Z A;  2B7S A;  4Q5C A;  1JRZ A;  1D4C A;  3TTB A;  1Q9I A;  2B7R A;  3L1T A;  3TOR A;  2J7A A;  1FT5 A;  1Y0P A;  2E80 A;  3BNH A;  3LG1 A;  1FS9 A;  1FS7 A;  1GU6 A;  3RKH A;  3SCE A;  2VR0 A;  1KSS A;  1D4E A;  1FS8 A;  1M64 A;  3FO3 A;  3LGQ A;  1D4D A;  3BNF A;  4Q4U A;  1P2E A;  1M1P A;  1M1R A;  1JNI A;  1M1Q A;  1KSU A;  2K3V A;  3OWM A;  2OT4 A;  4WJY A;  3D1I A;  3UBR A;  1P2H A;  4L3Y A;  3S7W A;  4L38 A;  2E81 A;  1FT6 A;  2ZO5 A;  1OAH A;  3BNJ A;  4Q1O A;  1JRX A;  1BVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...