1SP3A

Crystal structure of octaheme cytochrome c from shewanella oneidensis
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
442
structure length
436
Chain Sequence
ANPHKDVLKGPFTTGSEVTTQCLTCHEEQATDMMKTSHWTWELEQKLPDRTVVRGKKNSINNFCVAISSNEPRCTSCHAGYGWKDNTFDFKDKTKVDCLICHDTTGTYVKDPAGAGEPMAKLDLAKIAQNVGAPVRDNCGSCHFYGKHGDLDSSMAYPDKATDVHMDSDGNNFQCQNCHTTEKHQISGNAMGVSPGGIDHIGCENCHDSAPHSNKKLNTHTATVACQTCHIPFFAKNEPTKMQWDWSTAGDDKPETVDQYGKHTYQKKKGNFVWEKMVKPQYAWYNGTANAYMAGDKMDSNVVTKLTYPMGDINDAKAKIYPFKVHTGKQIYDKKLNIFITPKTYGKGGYWSEFDWNLAAKLGMEANPTMLEKGIKYSGEYDFAATEMWWRINHMVSPKEQALNCNDCHNKGTRLDWQALGYQGDPMKNKQGPKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cytochrome c, putative
publication title Octaheme tetrathionate reductase is a respiratory enzyme with novel heme ligation.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Oxidoreductase
total genus 111
structure length 436
sequence length 442
ec nomenclature
pdb deposition date 2004-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11783 Cytochrome_cB Cytochrome c bacterial
A PF13435 Cytochrome_C554 Cytochrome c554 and c-prime
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1sp3A01
1M1RA 3LG1A 2E81A 4Q1OA 3RKHA 1KSSA 1SP3A 3UU9A 1E39A 4L3YA 1QO8A 1JRXA 4Q5BA 3L1TA 1OAHA 3LGQA 3SXQA 3TTBA 1LJ1A 1D4EA 3OWMA 3BNGA 1JRYA 3D1IA 4Q0TA 1GU6A 1M1PA 2J7AA 3BNJA 4WJYA 2OT4A 1QDBA 1FS7A 1M1QA 1FT5A 3BNFA 3BNHA 1M64A 3GM6A 3SCEA 1P2HA 3FO3A 4Q5CA 2K3VA 4Q4UA 3F29A 1Y0PA 2E80A 1JNIA 2VR0A 2RF7A 4L3XA 1QJDA 1JRZA 1D4DA 1FS9A 2RDZA 4L3ZA 1FT6A 1FS8A 2B7RA 3MMOA 1D4CA 2ZO5A 4Q17A 1BVBA 4L38A 3TORA 1P2EA 1Q9IA 1KSUA 3S7WA 2B7SA 3UBRA
chains in the Genus database with same CATH superfamily
1M1RA 3LG1A 2E81A 4Q1OA 3RKHA 1KSSA 1SP3A 3UU9A 1E39A 4L3YA 1QO8A 1JRXA 4Q5BA 3L1TA 1OAHA 3LGQA 3SXQA 3TTBA 1LJ1A 1D4EA 3OWMA 3BNGA 1JRYA 3D1IA 4Q0TA 1GU6A 1M1PA 2J7AA 3BNJA 4WJYA 2OT4A 1QDBA 2CZSA 1FS7A 1M1QA 1FT5A 3BNFA 3BNHA 1M64A 3GM6A 3SCEA 1P2HA 3FO3A 4Q5CA 2K3VA 4Q4UA 3F29A 1Y0PA 2E80A 1JNIA 2VR0A 2RF7A 4L3XA 1QJDA 1JRZA 1D4DA 1FS9A 2RDZA 4L3ZA 1FT6A 1FS8A 2B7RA 3MMOA 1D4CA 2ZO5A 4Q17A 1BVBA 4L38A 3TORA 1P2EA 1Q9IA 1KSUA 3S7WA 2B7SA 3UBRA
chains in the Genus database with same CATH topology
1M1RA 3LG1A 2E81A 4Q1OA 3RKHA 1KSSA 1SP3A 3UU9A 1E39A 4L3YA 1QO8A 1JRXA 4Q5BA 3L1TA 1OAHA 3LGQA 3SXQA 3TTBA 1LJ1A 1D4EA 3OWMA 3BNGA 1JRYA 3D1IA 4Q0TA 1GU6A 1M1PA 2J7AA 3BNJA 4WJYA 2OT4A 1QDBA 1FS7A 1M1QA 1FT5A 3BNFA 3BNHA 1M64A 3GM6A 3SCEA 1P2HA 3FO3A 4Q5CA 2K3VA 4Q4UA 3F29A 1Y0PA 2E80A 1JNIA 2VR0A 2RF7A 4L3XA 1QJDA 1JRZA 1D4DA 1FS9A 2RDZA 4L3ZA 1FT6A 1FS8A 2B7RA 3MMOA 1D4CA 2ZO5A 4Q17A 1BVBA 4L38A 3TORA 1P2EA 1Q9IA 1KSUA 3S7WA 2B7SA 3UBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1R A;  3LG1 A;  2E81 A;  4Q1O A;  3RKH A;  1KSS A;  1SP3 A;  3UU9 A;  1E39 A;  4L3Y A;  1QO8 A;  1JRX A;  4Q5B A;  3L1T A;  1OAH A;  3LGQ A;  3SXQ A;  3TTB A;  1LJ1 A;  1D4E A;  3OWM A;  3BNG A;  1JRY A;  3D1I A;  4Q0T A;  1GU6 A;  1M1P A;  2J7A A;  3BNJ A;  4WJY A;  2OT4 A;  1QDB A;  1FS7 A;  1M1Q A;  1FT5 A;  3BNF A;  3BNH A;  1M64 A;  3GM6 A;  3SCE A;  1P2H A;  3FO3 A;  4Q5C A;  2K3V A;  4Q4U A;  3F29 A;  1Y0P A;  2E80 A;  1JNI A;  2VR0 A;  2RF7 A;  4L3X A;  1QJD A;  1JRZ A;  1D4D A;  1FS9 A;  2RDZ A;  4L3Z A;  1FT6 A;  1FS8 A;  2B7R A;  3MMO A;  1D4C A;  2ZO5 A;  4Q17 A;  1BVB A;  4L38 A;  3TOR A;  1P2E A;  1Q9I A;  1KSU A;  3S7W A;  2B7S A;  3UBR A; 
#chains in the Genus database with same CATH topology
 1M1R A;  3LG1 A;  2E81 A;  4Q1O A;  3RKH A;  1KSS A;  1SP3 A;  3UU9 A;  1E39 A;  4L3Y A;  1QO8 A;  1JRX A;  4Q5B A;  3L1T A;  1OAH A;  3LGQ A;  3SXQ A;  3TTB A;  1LJ1 A;  1D4E A;  3OWM A;  3BNG A;  1JRY A;  3D1I A;  4Q0T A;  1GU6 A;  1M1P A;  2J7A A;  3BNJ A;  4WJY A;  2OT4 A;  1QDB A;  2CZS A;  1FS7 A;  1M1Q A;  1FT5 A;  3BNF A;  3BNH A;  1M64 A;  3GM6 A;  3SCE A;  1P2H A;  3FO3 A;  4Q5C A;  2K3V A;  4Q4U A;  3F29 A;  1Y0P A;  2E80 A;  1JNI A;  2VR0 A;  2RF7 A;  4L3X A;  1QJD A;  1JRZ A;  1D4D A;  1FS9 A;  2RDZ A;  4L3Z A;  1FT6 A;  1FS8 A;  2B7R A;  3MMO A;  1D4C A;  2ZO5 A;  4Q17 A;  1BVB A;  4L38 A;  3TOR A;  1P2E A;  1Q9I A;  1KSU A;  3S7W A;  2B7S A;  3UBR A; 
#chains in the Genus database with same CATH homology
 1M1R A;  3LG1 A;  2E81 A;  4Q1O A;  3RKH A;  1KSS A;  1SP3 A;  3UU9 A;  1E39 A;  4L3Y A;  1QO8 A;  1JRX A;  4Q5B A;  3L1T A;  1OAH A;  3LGQ A;  3SXQ A;  3TTB A;  1LJ1 A;  1D4E A;  3OWM A;  3BNG A;  1JRY A;  3D1I A;  4Q0T A;  1GU6 A;  1M1P A;  2J7A A;  3BNJ A;  4WJY A;  2OT4 A;  1QDB A;  1FS7 A;  1M1Q A;  1FT5 A;  3BNF A;  3BNH A;  1M64 A;  3GM6 A;  3SCE A;  1P2H A;  3FO3 A;  4Q5C A;  2K3V A;  4Q4U A;  3F29 A;  1Y0P A;  2E80 A;  1JNI A;  2VR0 A;  2RF7 A;  4L3X A;  1QJD A;  1JRZ A;  1D4D A;  1FS9 A;  2RDZ A;  4L3Z A;  1FT6 A;  1FS8 A;  2B7R A;  3MMO A;  1D4C A;  2ZO5 A;  4Q17 A;  1BVB A;  4L38 A;  3TOR A;  1P2E A;  1Q9I A;  1KSU A;  3S7W A;  2B7S A;  3UBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...