2B7SA

R381k mutant of flavocytochrome c3
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVKGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 192
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7sA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7sA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7sA03
1FEAA 2VVMA 1CC4A 2V60A 2Z5XA 1NG4A 2X99A 3AE3A 2RABA 3P1WA 5GSNA 1FEBA 1PBDA 5BUKA 3KKJA 3CTYA 3VR9A 3FPZA 1NHPA 1K4QA 1LTXR 1NENA 4TM4A 1ZP0A 3F29A 1CJ2A 2FBWA 1E1NA 3C96A 3NH3X 2VQ7A 4Q1OA 3NG7X 3QJ4A 4HA6A 2CFYA 5J7XA 4H4ZA 4EMJA 2XVHA 1CC2A 3ATQA 1KNPA 4JQ9A 4BV6A 1GREA 3K30A 4Z44A 3NN6X 3G5RA 3CPHG 5U63A 1H83A 1GV4A 1OJ9A 2WS3A 1NEKA 3AWIA 5LV9A 3G5SA 3AE7A 4OPGA 1PBCA 4GF7A 3RKHA 1GPEA 2WP6A 3IC9A 4K7ZA 4JN9A 1MOKA 3HZLA 3ITJA 3GWDA 3OWMA 4RSLA 1S3EA 3ADAB 1PJ6A 1BGNA 1DODA 5DBJA 1ZX9A 4YTNA 2RF7A 4IA6A 4EM3A 2AR8A 4B1BA 5KWFA 4Q0TA 1KSUA 1GALA 1GRGA 2BCGG 4H50A 3SCEA 2WP9A 4HB9A 4AP1A 4OPCA 1F8RA 2ARDA 4AOXA 1ONFA 1TDNA 3EPTA 3QFAA 2PHHA 5EOWA 1P2EA 1KDGA 3TTBA 3AE5A 3KVEA 1QJDA 3II4A 2V3AA 3AE9A 4IV9A 1FCDA 3LGQA 2XFQA 2WPCA 1FT5A 2C72A 2RDZA 4H4PA 4AOSA 1EL9A 4LA1A 4H4SA 3ATRA 2E80A 2BK5A 4DSHA 4CBQA 3BNGA 2EQ8A 1GXFA 2CULA 3PVCA 2A87A 4IVMB 4U8JA 3S5WA 1PBEA 3AYJA 4EIQA 1E1MA 3E1TA 4C77A 2YG3A 4RG4A 3SXQA 1FL2A 2Z5YA 2GMHA 1F3PA 3VRBA 2VQBA 4GDEA 4J36A 3Q9TA 2WDRA 3CNTA 1CC6A 4D03A 2XLTA 3QSMA 4NTCA 4N9XA 4TM0A 1E7PA 2R0CA 3ALLA 3UKHA 2GR1A 1S2QA 2YVFA 2C70A 1OJTA 5M0ZA 4IVOB 3URHA 3NTAA 2LFCA 3D1IA 3BNFA 3KPFA 3DK9A 4U2LA 3UKKA 3BNJA 1QLBA 4U8PA 2A89A 4L3XA 1LV0A 3F8RA 1M1QA 1EL5A 3LADA 3AEFA 1PXAA 1H86A 2C73A 3NT6A 3AE4A 4H4WA 1MXTA 3BHKA 3O0HA 2C3DA 4H4VA 1GRAA 1NAAA 4NTDA 4J2WA 1DOCA 1Y56A 2YM1A 2XCGA 3DGHA 2XLUA 1LQUA 2V6OA 2E81A 2BXSA 1Q1RA 2JKCA 2ZZ0A 3RHAA 2NVKX 5KOWA 2ACZA 2EQ6A 3KA7A 2C76A 2YLTA 2BS3A 4UDRA 2IIDA 3VQRA 1YKJA 4APNA 3QFBA 1N4VA 3DJJA 3FBSA 1O95A 3FIMB 3UKQA 1LJ1A 4GUVA 5JCIA 4I59A 1GRHA 3CGCA 1GOSA 1GNDA 2JK6A 3CGEA 1CF3A 3LZXA 4OPIA 4Z2TA 3B3RA 2EQ7A 4H2QA 4B63A 2JB2A 1IUVA 3AEGA 1GTEA 3CPJG 3FO3A 2X3NA 3AD9B 1IUTA 2YLZA 3GMCA 3GRTA 3LB8A 4H4XA 4EM4A 5EB5A 3V3NA 3ICRA 1CJCA 2WP5A 4AT0A 5U25A 4UDQA 3NLCA 2C67A 2R0PA 2WBAA 2OT4A 4H4TA 2R0GA 3AYLA 5FMHA 1M1RA 5U1OA 4EIPA 5KVIA 2FJEA 3AD8B 2GQWA 3DA1A 3KD9A 3NK0X 3H8LA 1QDBA 2X8CA 2ZZBA 1JNRA 3AE6A 3UP4A 5KRQA 1UKVG 4ZCDA 2GRTA 1K0JA 4PABA 4BURA 4Q5CA 4JNQA 4OPLA 4K8DA 4AT2A 1YQ3A 1KSSA 4H2PA 4A65A 3M13A 3BI4A 2C3CA 4WX1A 3P4QA 3NK1X 2WEUA 3Q6JA 4TLXA 4XXGA 2OALA 1E39A 3GM6A 3UTHA 2NPXA 4Y4MA 1ZKQA 3ZYXA 4CY8A 2CDUA 1DOBA 4C5OA 1BF3A 1JRZA 3UTGA 1GRTA 2F5ZA 1IUXA 2OA1A 5GRTA 4YTPA 4Q4UA 2W0HA 1M1PA 3AEEA 2J7AA 4A6NA 2DKHA 2RGJA 4OCGA 4H2NA 3P4SA 2QA1A 5C3JA 1SEZA 1TRBA 3LG1A 2GAHB 1K0LA 2XFOA 3LZWA 2GH5A 5FS7A 5FS6A 3SFDA 4U8KA 3R9UA 4EMWA 1XHCA 2WPFA 1M6IA 3JSKA 3DMEA 2BCPA 4TM1A 5FS9A 4M52A 1KNRA 3ICTA 2QA2A 1JU2A 1Z6LA 4PAAA 1LVLA 2XLSA 3M0OA 2XLPA 3L1RA 2X50A 1GSNA 4Z24A 4H4RA 2BK3A 4J33A 4TLZA 3C4NA 1K0IA 1HYUA 4J34A 1Y56B 1S2YA 3GDPA 3VRDB 3H8IA 2RGHA 4RG3A 5CKUA 4L3YA 3AEBA 1D7YA 1TDEA 5EB4A 4ADWA 4YKGA 4U8LA 2J3NA 4U8IA 1F8WA 3NTDA 1Y0PA 4BJYA 4EMIA 2X8HA 2RGOA 2BXRA 1ZOYA 4A79A 5C2TA 2YLXA 1TDFA 3NRNA 1H6VA 3G5QA 3BNMA 1E6EA 2VOUA 3AD7B 3K7QX 1FS9A 4WCTA 5KVHA 4WJYA 1XANA 2GQFA 2WESA 1B5QA 1GU6A 1N1PA 4FDCB 1TDKA 1P2HA 1ZMDA 1NDAA 3RP7A 3K7MX 1JNIA 1RP0A 1ZK7A 1EL7A 4Z25A 1H7XA 4OPUA 3H4KA 5KXJA 1SP3A 2WU2A 4BK1A 4J31A 1QO8A 1EBDA 1MO9A 3EF6A 3GDNA 4Q17A 2CVJA 1VDCA 1TDOA 2GR2A 3BNUA 3IHGA 3D1CA 3V76A 2K3VA 4DSGA 3COXA 3CPIG 2A8XA 4YTMA 2R46A 3UOYA 2B76A 2Q0LA 3AE1A 2AAQA 4GRTA 2B9WA 4O5UA 3L1TA 2VZ2A 2JB1A 3NIXA 1GT8A 3S7WA 1CHUA 1XPQA 3CNJA 1ZMCA 4CNKA 4ZN0A 3B6DA 1CJ3A 2YLSA 2GEWA 3NN0X 1GEUA 1S3BA 3CNPA 2E5VA 1N4UA 1VG0A 2XVJA 4H4UA 2O9ZA 2Q0KA 1H84A 1GTHA 2YG6A 4FK1A 1LQTA 2GAGB 1VQWA 2H89A 4J56A 4GCMA 4X9NA 4K2XA 3QSSA 3NYEA 3RP8A 2Y6RA 2WETA 3ALMA 1TYPA 3ISHA 1OJCA 4D04A 3LXDA 3QSEA 3DJDA 1JRXA 2V3BA 2JAEA 3GRSA 3IHMA 3RP6A 1BZLA 1JOAA 3CNDA 4DGKA 4YSZA 2XLRA 4Q5BA 4KX6A 4C3YA 4E0VA 1H81A 2C65A 2DKIA 2WHDA 3BI2A 3CN8A 3GMBA 5JCLA 4CY6A 3KLJA 1H7WA 3REDA 4OVIA 4ZCCA 3BNHA 3QVRA 1PDHA 4K22A 1BGJA 3SQPA 2B9XA 4NZHA 4KPRA 5HXIA 5JCMA 2XFPA 2YAUA 3UCLA 4U8MA 4B68A 3AE2A 2GMJA 4UP3A 2WOWA 4U2TA 3DK4A 2R9ZA 2UZZA 1TYTA 3MMOA 2E1MA 3GD3A 1B4VA 1E1KA 2BS4A 1DJQA 1F8SA 2ZO5A 5BULA 2JB3A 5JCKA 3K7TA 3P9UA 2BK4A 3BI5A 2GR0A 3GWFA 4REKA 2BS2A 3CIRA 5ER0A 1PS9A 3UP5A 1YQ4A 3PS9A 2YM2A 3AB1A 4U8OA 1ZY8A 3LJPA 2Y6QA 3GYIA 1PXCA 3UTFA 3UKFA 4CCRA 2YLWA 2Q6UA 3P4RA 3CGBA 4GR1A 2WPEA 2WU5A 5L46A 3UOVA 1LPFA 3DJGX 2BABA 5EBKA 4XWZA 2R4JA 2YVJA 4A7AA 2IVEA 4YXDA 3NHOX 3UKPA 3VR8A 4K5RA 3PO7A 2ZZCA 5HHFA 2WQYA 3ABVA 3NKSA 2YLRA 5IQ1A 1OAHA 1IJHA 4EQWA 1L9CA 1YQZA 3UU9A 1X31B 2BACA 4GDPA 2YG7A 3V3OA 4A5LA 3CGDA 3OZ2A 3UKAA 4Z2RA 2H88A 1ELIA 4FK1C 1W4XA 2BC1A 4U2SA 3DGZA 4MJWA 1BVBA 2TMDA 4NEVA 3DK8A 2R4EA 3EAOA 3BHFA 4I58A 4L3ZA 4UDPA 2IVDA 2B7RA 1GESA 1O94A 1Q9IA 1COYA 2BYBA 2XVEA 2YR6A 2B7SA 1GRFA 3UOXA 4X9MA 3WE0A 4JNAA 1RYIA 2FJDA 2GR3A 5BRTA 5IQ4A 1AOGA 2VR0A 1PBBA 1NHSA 2XYOA 3NK2X 1DNCA 3LOVA 4YKFA 3I6DA 5HY5A 3AECA 4ICYA 2C64A 2YVGA 1L0VA 1BKWA 1H82A 3IF9A 3AXBA 2WOVA 3GYJA 4EQXA 5TR3A 3CNSA 3NNEA 5KOXA 2XDOA 1NG3A 2GV8A 1DXLA 1E1LA 1DJNA 2VVLA 4H2RA 4FX9A 4JDRA 4LIIA 2PYXA 1ZOVA 2E4GA 2WDQA 4Z43A 2R45A 1D7LA 2B9YA 4B65A 1KF6A 3TORA 1GETA 4YSXA 3NYFA 2GVCA 1FECA 4TM3A 4CCQA 5J60A 4EQSA 3SGLA 1GERA 3P4PA 3DH9A 1YY5A 4H4QA 1ZDLA 3NYCA 2FJBA 3AE8A 4BJZA 4EQRA 4B67A 1D4EA 3EANA 4L38A 5M10A 5HYMA 3FG2P 1O5WA 1IUSA 1FOHA 1NPXA 2EQ9A 1KFYA 3L8KA 1D5TA 4A99A 2QCUA 2TPRA 4OPTA 1N4WA 4ECHA 1L9EA 2OLNA 1RSGA 2YG5A 4O5QA 5FS8A 2BA9A 1B37A 4J57A 3RNMA 4YT0A 1FS7A 4H7UA 4A9WA 3I3LA 4YWOA 1JNZA 1Q1WA 1XDIA 4C3XA 1VRQB 4USQA 1GRBA 4NTEA 1PXBA 2YR4A 2ZBWA 2C66A 4Y4LA 3T37A 3UKLA 1B8SA 3UOZA 2I0ZA 5JCNA 3GYXA 2V5ZA 2GF3A 1OJAA 1PJ5A 3ALJA 1D4DA 2JBVA 2YR5A 3NGCX 2VRMA 2WOIA 4K5SA 1PBFA 4Y4NA 1PHHA 4P9SA 2C75A 1OJDA 2XVIA 2OAMA 4JY2A 2YG4A 2OLOA 2YWLA 1M64A 4A6NB 4B66A 5BVAA 1PJ7A 1PN0A 3IWAA 1D4CA 3QVPA 1FS8A 3F8PA 4LU6A 1FT6A 3D8XA 3SFEA 4BK3A 3AEDA 5IPYA 4YSYA 3GSIA 4C74A 2AQJA 3GD4A 4X4JA 4Z2UA 2Q7VA 2X8GA 2XVFA 1DOEA 1NHRA 4XWRA 3ICSA 4AP3A 2YQUA 2HQMA 2QAEA 4USRA 1BWCA 3F8DA 3VRAA 2VRLA 3DJEA 4NEWA 1NHQA 4H4YA 2BC0A 2GB0A 3C4AA 5CQFA 4BK2A 3AYIA 4OPDA 2APGA 4IA5A 1REOA 3UTEA 4CNJA 2FJAA 4CRTA 1V59A 2V61A 3M12A 1CL0A 2XFNA 1IUUA 3SM8A 1CJ4A 1JRYA 1IUWA 2C7GA 2VVLG 4JY3A 1VG9A 4U8NA 4DNAA 1JEHA 3UBRA 1F6MA 3KU9A 3FMWA 2XFUA 4YSHA 3OC4A 4B64A 1L9DA 4Z26A 1EL8A 3AEAA 1CBOA 3ZDNA 4B69A 2WDVA 3S61A
chains in the Genus database with same CATH superfamily
1FEAA 2VVMA 1CC4A 2V60A 2Z5XA 1NG4A 2X99A 3AE3A 2RABA 3P1WA 5GSNA 1FEBA 1PBDA 5BUKA 3KKJA 3CTYA 3VR9A 3FPZA 1NHPA 1K4QA 1LTXR 1NENA 4TM4A 1ZP0A 3F29A 1CJ2A 2FBWA 1E1NA 3C96A 3NH3X 2VQ7A 4Q1OA 3NG7X 3QJ4A 4HA6A 2CFYA 5J7XA 4GAVA 4H4ZA 4EMJA 2XVHA 1CC2A 3ATQA 1KNPA 4JQ9A 4BV6A 1GREA 3K30A 4Z44A 3NN6X 3G5RA 3CPHG 5U63A 1H83A 1GV4A 1OJ9A 2WS3A 1NEKA 3AWIA 5LV9A 3G5SA 3AE7A 4OPGA 1PBCA 4GF7A 3RKHA 1GPEA 2WP6A 3IC9A 4K7ZA 4JN9A 1MOKA 3HZLA 3ITJA 3GWDA 3OWMA 4RSLA 1S3EA 3ADAB 1PJ6A 1BGNA 1DODA 5DBJA 1ZX9A 4YTNA 2RF7A 4IA6A 4EM3A 2AR8A 4B1BA 5KWFA 4Q0TA 1KSUA 1GALA 1GRGA 2BCGG 4H50A 3SCEA 2WP9A 4HB9A 4AP1A 4OPCA 1F8RA 2ARDA 3HYVA 4AOXA 1ONFA 1TDNA 3EPTA 3QFAA 2PHHA 5EOWA 1P2EA 1KDGA 3TTBA 3AE5A 3KVEA 1QJDA 3II4A 2V3AA 3AE9A 4IV9A 1FCDA 3LGQA 2XFQA 2WPCA 1FT5A 2C72A 2RDZA 4H4PA 4AOSA 1EL9A 4LA1A 4H4SA 3ATRA 2E80A 2BK5A 4DSHA 4GAPA 3BNGA 4CBQA 2EQ8A 1GXFA 2CULA 3PVCA 2A87A 4IVMB 4U8JA 3S5WA 1PBEA 3AYJA 4EIQA 1E1MA 3E1TA 4C77A 2YG3A 4RG4A 3SXQA 1FL2A 2Z5YA 2GMHA 1F3PA 3VRBA 2VQBA 4GDEA 4J36A 3Q9TA 2WDRA 3CNTA 1CC6A 4D03A 2XLTA 3QSMA 4G74A 4N9XA 4NTCA 1E7PA 2R0CA 3ALLA 4TM0A 2GR1A 3SZWA 1S2QA 3UKHA 2YVFA 4NNJA 2C70A 1OJTA 5M0ZA 4IVOB 4II2A 3URHA 3NTAA 2LFCA 3D1IA 3BNFA 3KPFA 3DK9A 4NWZA 4U2LA 3UKKA 3BNJA 1QLBA 4U8PA 3SYIA 2A89A 4L3XA 1LV0A 3F8RA 1M1QA 1EL5A 3LADA 3AEFA 1PXAA 1H86A 2C73A 3NT6A 3AE4A 4H4WA 1MXTA 3BHKA 3O0HA 2C3DA 3KPKA 4H4VA 1GRAA 1NAAA 4NTDA 3T2KA 4J2WA 1DOCA 1Y56A 2YM1A 2XCGA 3DGHA 2XLUA 1LQUA 2V6OA 2E81A 2BXSA 1Q1RA 2JKCA 2ZZ0A 3RHAA 2NVKX 5KOWA 2ACZA 2EQ6A 3KA7A 2C76A 2YLTA 2BS3A 4UDRA 2IIDA 3VQRA 1YKJA 4APNA 3QFBA 1N4VA 3DJJA 3FBSA 1O95A 3FIMB 3UKQA 1LJ1A 4GUVA 5JCIA 2BRAA 4I59A 1GRHA 3CGCA 1GOSA 1GNDA 2JK6A 3CGEA 1CF3A 3LZXA 4OPIA 4Z2TA 3B3RA 2EQ7A 4H2QA 4B63A 2JB2A 1IUVA 3AEGA 1GTEA 3CPJG 3FO3A 2X3NA 3AD9B 1IUTA 2YLZA 3GMCA 3GRTA 3LB8A 4H4XA 4EM4A 5EB5A 3V3NA 3ICRA 1CJCA 2WP5A 4AT0A 5U25A 4UDQA 3NLCA 2C67A 2R0PA 2WBAA 2OT4A 4H4TA 2R0GA 3AYLA 5FMHA 1M1RA 5U1OA 4EIPA 5KVIA 2FJEA 2CZSA 3AD8B 2GQWA 3DA1A 3KD9A 3NK0X 3H8LA 1QDBA 2X8CA 2ZZBA 1JNRA 3AE6A 3UP4A 5KRQA 1UKVG 4ZCDA 2GRTA 1K0JA 4PABA 4BURA 4Q5CA 4JNQA 4G6HA 4OPLA 4K8DA 4AT2A 1YQ3A 1KSSA 4H2PA 4A65A 3M13A 3BI4A 2C3CA 4WX1A 5KMSA 3HYXA 3P4QA 3NK1X 2WEUA 3Q6JA 4TLXA 4XXGA 2OALA 1E39A 3GM6A 3UTHA 2NPXA 4Y4MA 1ZKQA 3ZYXA 4CY8A 2CDUA 1DOBA 4C5OA 1BF3A 1JRZA 3UTGA 1GRTA 2F5ZA 1IUXA 2OA1A 4G9KA 5GRTA 4YTPA 4Q4UA 2W0HA 1M1PA 3AEEA 2J7AA 4A6NA 2DKHA 2RGJA 4OCGA 4H2NA 3P4SA 2QA1A 5C3JA 1SEZA 1TRBA 3LG1A 2GAHB 1K0LA 2XFOA 3LZWA 2GH5A 5FS7A 5FS6A 3SFDA 4U8KA 3SZ0A 3R9UA 4EMWA 1XHCA 2WPFA 1M6IA 3JSKA 3DMEA 2BCPA 4TM1A 5FS9A 4M52A 1KNRA 3ICTA 2QA2A 1JU2A 3SY4A 1Z6LA 4PAAA 1LVLA 2XLSA 3M0OA 2XLPA 3L1RA 2X50A 1GSNA 4Z24A 4H4RA 2BK3A 4J33A 4TLZA 3C4NA 1K0IA 1HYUA 4J34A 1Y56B 1S2YA 3GDPA 3VRDB 3H8IA 2RGHA 4RG3A 5CKUA 4L3YA 3AEBA 1D7YA 1TDEA 5EB4A 4ADWA 4YKGA 4U8LA 2J3NA 4U8IA 1F8WA 3NTDA 1Y0PA 4BJYA 4EMIA 2X8HA 2RGOA 2BXRA 1ZOYA 3HYWA 4A79A 5C2TA 2YLXA 1TDFA 3NRNA 1H6VA 3G5QA 3BNMA 1E6EA 2VOUA 3AD7B 3K7QX 1FS9A 4WCTA 5KVHA 4WJYA 1XANA 2GQFA 2WESA 1B5QA 1GU6A 1N1PA 4FDCB 1TDKA 1P2HA 1ZMDA 1NDAA 3RP7A 3K7MX 1JNIA 1RP0A 1ZK7A 1EL7A 4Z25A 1H7XA 4OPUA 3H4KA 5KXJA 1SP3A 2WU2A 4BK1A 4J31A 1QO8A 1EBDA 1MO9A 3EF6A 3GDNA 4Q17A 2CVJA 1VDCA 1TDOA 2GR2A 3BNUA 3IHGA 3D1CA 3T31A 2K3VA 3V76A 4DSGA 3T14A 3COXA 3CPIG 2A8XA 4YTMA 2R46A 3UOYA 2B76A 2Q0LA 3AE1A 2AAQA 4GRTA 2B9WA 4O5UA 3L1TA 2VZ2A 2JB1A 3NIXA 3SZCA 1GT8A 3S7WA 1CHUA 1XPQA 3CNJA 5KMQA 1ZMCA 4CNKA 4ZN0A 3B6DA 1CJ3A 2YLSA 2GEWA 3NN0X 1GEUA 1S3BA 3CNPA 2E5VA 1N4UA 1VG0A 2XVJA 4H4UA 2O9ZA 2Q0KA 1H84A 1GTHA 2YG6A 4FK1A 1LQTA 2GAGB 1VQWA 2H89A 4J56A 4GCMA 4X9NA 3SX6A 4K2XA 3QSSA 3NYEA 3RP8A 2Y6RA 2WETA 3ALMA 1TYPA 3ISHA 1OJCA 4D04A 3LXDA 3QSEA 3DJDA 1JRXA 2V3BA 2JAEA 3GRSA 3IHMA 3RP6A 1BZLA 1JOAA 3CNDA 4DGKA 4YSZA 2XLRA 4Q5BA 4KX6A 4C3YA 4E0VA 1H81A 2C65A 2DKIA 2WHDA 3BI2A 3CN8A 3GMBA 5JCLA 4CY6A 3KLJA 1H7WA 3REDA 4OVIA 4ZCCA 3BNHA 3QVRA 1PDHA 4K22A 1BGJA 3SQPA 2B9XA 4NZHA 4KPRA 5HXIA 5JCMA 2XFPA 2YAUA 3UCLA 4U8MA 4B68A 3AE2A 2GMJA 4UP3A 2WOWA 4U2TA 3DK4A 2R9ZA 2UZZA 1TYTA 3MMOA 2E1MA 3CMMA 3GD3A 1B4VA 1E1KA 2BS4A 1DJQA 1F8SA 2ZO5A 5BULA 2JB3A 5JCKA 3K7TA 3P9UA 2BK4A 2C4CA 3BI5A 2GR0A 3GWFA 4REKA 2BS2A 3CIRA 5ER0A 1PS9A 3UP5A 1YQ4A 3PS9A 2YM2A 3AB1A 4U8OA 1ZY8A 3LJPA 2Y6QA 3GYIA 1PXCA 3UTFA 3UKFA 4CCRA 2YLWA 2Q6UA 3P4RA 3CGBA 4GR1A 2WPEA 2WU5A 5L46A 3UOVA 1LPFA 3DJGX 2BABA 5EBKA 4XWZA 2R4JA 3T0KA 2YVJA 4A7AA 2IVEA 4YXDA 3NHOX 3UKPA 3VR8A 4K5RA 3PO7A 2ZZCA 5HHFA 2WQYA 3ABVA 3NKSA 2YLRA 5IQ1A 1OAHA 1IJHA 4EQWA 1L9CA 1YQZA 3UU9A 1X31B 2BACA 4GDPA 2YG7A 3V3OA 4A5LA 3CGDA 3OZ2A 3UKAA 4Z2RA 2H88A 1ELIA 4FK1C 1W4XA 2BC1A 4U2SA 3DGZA 4MJWA 1BVBA 2TMDA 4NEVA 3DK8A 2R4EA 3EAOA 3BHFA 4I58A 4L3ZA 4UDPA 2IVDA 2B7RA 1GESA 1O94A 1Q9IA 1COYA 2BYBA 2XVEA 2YR6A 2B7SA 1GRFA 3UOXA 4X9MA 3T2YA 3WE0A 4JNAA 1RYIA 2FJDA 2GR3A 5BRTA 5IQ4A 1AOGA 2VR0A 1PBBA 1NHSA 2XYOA 3NK2X 1DNCA 3LOVA 4YKFA 3I6DA 5HY5A 3AECA 4ICYA 2C64A 2YVGA 4II3A 1L0VA 1BKWA 1H82A 3IF9A 3AXBA 3T2ZA 2WOVA 3GYJA 4EQXA 5TR3A 3CNSA 3NNEA 5KOXA 2XDOA 1NG3A 2GV8A 1DXLA 1E1LA 1DJNA 2VVLA 4H2RA 4FX9A 4JDRA 4LIIA 2PYXA 1ZOVA 2E4GA 2WDQA 3SXIA 4Z43A 5KMRA 2R45A 1D7LA 2B9YA 4B65A 1KF6A 3TORA 1GETA 4YSXA 3NYFA 2GVCA 1FECA 4TM3A 4CCQA 5J60A 4EQSA 3SGLA 1GERA 3P4PA 3DH9A 1YY5A 4H4QA 1ZDLA 3NYCA 2FJBA 3AE8A 4BJZA 4EQRA 4B67A 5KMPA 1D4EA 3EANA 4L38A 5M10A 5HYMA 3FG2P 1O5WA 1IUSA 1FOHA 1NPXA 2EQ9A 1KFYA 3L8KA 1D5TA 4A99A 2QCUA 2TPRA 4OPTA 1N4WA 4ECHA 1L9EA 2OLNA 1RSGA 2YG5A 4O5QA 5FS8A 2BA9A 1B37A 4J57A 3RNMA 4YT0A 1FS7A 4H7UA 4A9WA 3I3LA 4YWOA 1JNZA 1Q1WA 1XDIA 4C3XA 1VRQB 4USQA 1GRBA 4NTEA 3SZFA 1PXBA 2YR4A 2ZBWA 2C66A 4Y4LA 3T37A 3UKLA 1B8SA 3GYXA 2I0ZA 3UOZA 5JCNA 2V5ZA 2GF3A 1OJAA 1PJ5A 3ALJA 1D4DA 2JBVA 2YR5A 3NGCX 2VRMA 2WOIA 4K5SA 1PBFA 4Y4NA 1PHHA 4P9SA 2C75A 1OJDA 2XVIA 2OAMA 4JY2A 2YG4A 2OLOA 2YWLA 1M64A 4A6NB 4B66A 5BVAA 5KNLA 1PJ7A 1PN0A 3IWAA 1D4CA 3QVPA 1FS8A 3F8PA 4LU6A 1FT6A 3D8XA 3SFEA 4BK3A 3AEDA 4G73A 4YSYA 3GSIA 4C74A 5IPYA 2AQJA 3GD4A 4X4JA 4Z2UA 2Q7VA 2X8GA 2XVFA 1DOEA 1NHRA 4XWRA 3ICSA 4AP3A 2YQUA 2HQMA 2QAEA 4USRA 1BWCA 3F8DA 3VRAA 2VRLA 3DJEA 4NEWA 1NHQA 4H4YA 2BC0A 2GB0A 3C4AA 5CQFA 4BK2A 2BRYA 3AYIA 2APGA 4IA5A 1REOA 4OPDA 3UTEA 4CNJA 2FJAA 4CRTA 1V59A 2V61A 3M12A 1CL0A 2XFNA 1IUUA 4G6GA 1CJ4A 1JRYA 1IUWA 2C7GA 2VVLG 3SM8A 4JY3A 1VG9A 4U8NA 4DNAA 1JEHA 3UBRA 1F6MA 3KU9A 3FMWA 2XFUA 4YSHA 3OC4A 4B64A 1L9DA 4Z26A 1EL8A 3AEAA 1CBOA 3ZDNA 4B69A 2WDVA 3S61A
chains in the Genus database with same CATH topology
1FEAA 2VVMA 1CC4A 2V60A 2Z5XA 1NG4A 2X99A 3AE3A 2RABA 3P1WA 5GSNA 1FEBA 1PBDA 5BUKA 3KKJA 3CTYA 3VR9A 3FPZA 1NHPA 1K4QA 1LTXR 1NENA 4TM4A 1ZP0A 3F29A 1CJ2A 2FBWA 1E1NA 3C96A 3NH3X 2VQ7A 4Q1OA 3NG7X 3QJ4A 4HA6A 2CFYA 5J7XA 4GAVA 4H4ZA 4EMJA 2XVHA 1CC2A 3ATQA 1KNPA 4JQ9A 4BV6A 1GREA 3K30A 4Z44A 3NN6X 3G5RA 3CPHG 5U63A 1H83A 1GV4A 1OJ9A 2WS3A 1NEKA 3AWIA 5LV9A 3G5SA 3AE7A 4OPGA 1PBCA 4GF7A 3RKHA 1GPEA 2WP6A 3IC9A 4K7ZA 4JN9A 1MOKA 3HZLA 3ITJA 3GWDA 3OWMA 4RSLA 1S3EA 3ADAB 1PJ6A 1BGNA 1DODA 5DBJA 1ZX9A 4YTNA 2RF7A 4IA6A 4EM3A 2AR8A 4B1BA 5KWFA 4Q0TA 1KSUA 1GALA 1GRGA 2BCGG 4H50A 3SCEA 2WP9A 4HB9A 4AP1A 4OPCA 1F8RA 2ARDA 3HYVA 4AOXA 1ONFA 1TDNA 3EPTA 3QFAA 2PHHA 5EOWA 1P2EA 1KDGA 3TTBA 3AE5A 3KVEA 1QJDA 3II4A 2V3AA 3AE9A 4IV9A 1FCDA 3LGQA 2XFQA 2WPCA 1FT5A 2C72A 2RDZA 4H4PA 4AOSA 1EL9A 4LA1A 4H4SA 3ATRA 2E80A 2BK5A 4DSHA 4GAPA 3BNGA 4CBQA 2EQ8A 1GXFA 2CULA 3PVCA 2A87A 4IVMB 4U8JA 3S5WA 1PBEA 3AYJA 4EIQA 1E1MA 3E1TA 4C77A 2YG3A 4RG4A 3SXQA 1FL2A 2Z5YA 2GMHA 1F3PA 3VRBA 2VQBA 4GDEA 4J36A 3Q9TA 2WDRA 3CNTA 1CC6A 4D03A 2XLTA 3QSMA 4G74A 4N9XA 4NTCA 1E7PA 2R0CA 3ALLA 4TM0A 2GR1A 3SZWA 1S2QA 3UKHA 2YVFA 4NNJA 2C70A 1OJTA 5M0ZA 4IVOB 4II2A 3URHA 3NTAA 2LFCA 3D1IA 3BNFA 3KPFA 3DK9A 4NWZA 4U2LA 3UKKA 3BNJA 1QLBA 4U8PA 3SYIA 2A89A 4L3XA 1LV0A 3F8RA 1M1QA 1EL5A 3LADA 3AEFA 1PXAA 1H86A 2C73A 3NT6A 3AE4A 4H4WA 1MXTA 3BHKA 3O0HA 2C3DA 3KPKA 4H4VA 1GRAA 1NAAA 4NTDA 3T2KA 4J2WA 1DOCA 1Y56A 2YM1A 2XCGA 3DGHA 2XLUA 1LQUA 2V6OA 2E81A 2BXSA 1Q1RA 2JKCA 2ZZ0A 3RHAA 2NVKX 5KOWA 2ACZA 2EQ6A 3KA7A 2C76A 2YLTA 2BS3A 4UDRA 2IIDA 3VQRA 1YKJA 4APNA 3QFBA 1N4VA 3DJJA 3FBSA 1O95A 3FIMB 3UKQA 1LJ1A 4GUVA 5JCIA 2BRAA 4I59A 1GRHA 3CGCA 1GOSA 1GNDA 2JK6A 3CGEA 1CF3A 3LZXA 4OPIA 4Z2TA 3B3RA 2EQ7A 4H2QA 4B63A 2JB2A 1IUVA 3AEGA 1GTEA 3CPJG 3FO3A 2X3NA 3AD9B 1IUTA 2YLZA 3GMCA 3GRTA 3LB8A 4H4XA 4EM4A 5EB5A 3V3NA 3ICRA 1CJCA 2WP5A 4AT0A 5U25A 4UDQA 3NLCA 2C67A 2R0PA 2WBAA 2OT4A 4H4TA 2R0GA 3AYLA 5FMHA 1M1RA 5U1OA 4EIPA 5KVIA 2FJEA 3AD8B 2GQWA 3DA1A 3KD9A 3NK0X 3H8LA 1QDBA 2X8CA 2ZZBA 1JNRA 3AE6A 3UP4A 5KRQA 1UKVG 4ZCDA 2GRTA 1K0JA 4PABA 4BURA 4Q5CA 4JNQA 4G6HA 4OPLA 4K8DA 4AT2A 1YQ3A 1KSSA 4H2PA 4A65A 3M13A 3BI4A 2C3CA 4WX1A 5KMSA 3HYXA 3P4QA 3NK1X 2WEUA 3Q6JA 4TLXA 4XXGA 2OALA 1E39A 3GM6A 3UTHA 2NPXA 4Y4MA 1ZKQA 3ZYXA 4CY8A 2CDUA 1DOBA 4C5OA 1BF3A 1JRZA 3UTGA 1GRTA 2F5ZA 1IUXA 2OA1A 4G9KA 5GRTA 4YTPA 4Q4UA 2W0HA 1M1PA 3AEEA 2J7AA 4A6NA 2DKHA 2RGJA 4OCGA 4H2NA 3P4SA 2QA1A 5C3JA 1SEZA 1TRBA 3LG1A 2GAHB 1K0LA 2XFOA 3LZWA 2GH5A 5FS7A 5FS6A 3SFDA 4U8KA 3SZ0A 3R9UA 4EMWA 1XHCA 2WPFA 1M6IA 3JSKA 3DMEA 2BCPA 4TM1A 5FS9A 4M52A 1KNRA 3ICTA 2QA2A 1JU2A 3SY4A 1Z6LA 4PAAA 1LVLA 2XLSA 3M0OA 2XLPA 3L1RA 2X50A 1GSNA 4Z24A 4H4RA 2BK3A 4J33A 4TLZA 3C4NA 1K0IA 1HYUA 4J34A 1Y56B 1S2YA 3GDPA 3VRDB 3H8IA 2RGHA 4RG3A 5CKUA 4L3YA 3AEBA 1D7YA 1TDEA 5EB4A 4ADWA 4YKGA 4U8LA 2J3NA 4U8IA 1F8WA 3NTDA 1Y0PA 4BJYA 4EMIA 2X8HA 2RGOA 2BXRA 1ZOYA 3HYWA 4A79A 5C2TA 2YLXA 1TDFA 3NRNA 1H6VA 3G5QA 3BNMA 1E6EA 2VOUA 3AD7B 3K7QX 1FS9A 4WCTA 5KVHA 4WJYA 1XANA 2GQFA 2WESA 1B5QA 1GU6A 1N1PA 4FDCB 1TDKA 1P2HA 1ZMDA 1NDAA 3RP7A 3K7MX 1JNIA 1RP0A 1ZK7A 1EL7A 4Z25A 1H7XA 4OPUA 3H4KA 5KXJA 1SP3A 2WU2A 4BK1A 4J31A 1QO8A 1EBDA 1MO9A 3EF6A 3GDNA 4Q17A 2CVJA 1VDCA 1TDOA 2GR2A 3BNUA 3IHGA 3D1CA 3T31A 2K3VA 3V76A 4DSGA 3T14A 3COXA 3CPIG 2A8XA 4YTMA 2R46A 3UOYA 2B76A 2Q0LA 3AE1A 2AAQA 4GRTA 2B9WA 4O5UA 3L1TA 2VZ2A 2JB1A 3NIXA 3SZCA 1GT8A 3S7WA 1CHUA 1XPQA 3CNJA 5KMQA 1ZMCA 4CNKA 4ZN0A 3B6DA 1CJ3A 2YLSA 2GEWA 3NN0X 1GEUA 1S3BA 3CNPA 2E5VA 1N4UA 1VG0A 2XVJA 4H4UA 2O9ZA 2Q0KA 1H84A 1GTHA 2YG6A 4FK1A 1LQTA 2GAGB 1VQWA 2H89A 4J56A 4GCMA 4X9NA 3SX6A 4K2XA 3QSSA 3NYEA 3RP8A 2Y6RA 2WETA 3ALMA 1TYPA 3ISHA 1OJCA 4D04A 3LXDA 3QSEA 3DJDA 1JRXA 2V3BA 2JAEA 3GRSA 3IHMA 3RP6A 1BZLA 1JOAA 3CNDA 4DGKA 4YSZA 2XLRA 4Q5BA 4KX6A 4C3YA 4E0VA 1H81A 2C65A 2DKIA 2WHDA 3BI2A 3CN8A 3GMBA 5JCLA 4CY6A 3KLJA 1H7WA 3REDA 4OVIA 4ZCCA 3BNHA 3QVRA 1PDHA 4K22A 1BGJA 3SQPA 2B9XA 4NZHA 4KPRA 5HXIA 5JCMA 2XFPA 2YAUA 3UCLA 4U8MA 4B68A 3AE2A 2GMJA 4UP3A 2WOWA 4U2TA 3DK4A 2R9ZA 2UZZA 1TYTA 3MMOA 2E1MA 3CMMA 3GD3A 1B4VA 1E1KA 2BS4A 1DJQA 1F8SA 2ZO5A 5BULA 2JB3A 5JCKA 3K7TA 3P9UA 2BK4A 2C4CA 3BI5A 2GR0A 3GWFA 4REKA 2BS2A 3CIRA 5ER0A 1PS9A 3UP5A 1YQ4A 3PS9A 2YM2A 3AB1A 4U8OA 1ZY8A 3LJPA 2Y6QA 3GYIA 1PXCA 3UTFA 3UKFA 4CCRA 2YLWA 2Q6UA 3P4RA 3CGBA 4GR1A 2WPEA 2WU5A 5L46A 3UOVA 1LPFA 3DJGX 2BABA 5EBKA 4XWZA 2R4JA 3T0KA 2YVJA 4A7AA 2IVEA 4YXDA 3NHOX 3UKPA 3VR8A 4K5RA 3PO7A 2ZZCA 5HHFA 2WQYA 3ABVA 3NKSA 2YLRA 5IQ1A 1OAHA 1IJHA 4EQWA 1L9CA 1YQZA 3UU9A 1X31B 2BACA 4GDPA 2YG7A 3V3OA 4A5LA 3CGDA 3OZ2A 3UKAA 4Z2RA 2H88A 1ELIA 4FK1C 1W4XA 2BC1A 4U2SA 3DGZA 4MJWA 1BVBA 2TMDA 4NEVA 3DK8A 2R4EA 3EAOA 3BHFA 4I58A 4L3ZA 4UDPA 2IVDA 2B7RA 1GESA 1O94A 1Q9IA 1COYA 2BYBA 2XVEA 2YR6A 2B7SA 1GRFA 3UOXA 4X9MA 3T2YA 3WE0A 4JNAA 1RYIA 2FJDA 2GR3A 5BRTA 5IQ4A 1AOGA 2VR0A 1PBBA 1NHSA 2XYOA 3NK2X 1DNCA 3LOVA 4YKFA 3I6DA 5HY5A 3AECA 4ICYA 2C64A 2YVGA 4II3A 1L0VA 1BKWA 1H82A 3IF9A 3AXBA 3T2ZA 2WOVA 3GYJA 4EQXA 5TR3A 3CNSA 3NNEA 5KOXA 2XDOA 1NG3A 2GV8A 1DXLA 1E1LA 1DJNA 2VVLA 4H2RA 4FX9A 4JDRA 4LIIA 2PYXA 1ZOVA 2E4GA 2WDQA 3SXIA 4Z43A 5KMRA 2R45A 1D7LA 2B9YA 4B65A 1KF6A 3TORA 1GETA 4YSXA 3NYFA 2GVCA 1FECA 4TM3A 4CCQA 5J60A 4EQSA 3SGLA 1GERA 3P4PA 3DH9A 1YY5A 4H4QA 1ZDLA 3NYCA 2FJBA 3AE8A 4BJZA 4EQRA 4B67A 5KMPA 1D4EA 3EANA 4L38A 5M10A 5HYMA 3FG2P 1O5WA 1IUSA 1FOHA 1NPXA 2EQ9A 1KFYA 3L8KA 1D5TA 4A99A 2QCUA 2TPRA 4OPTA 1N4WA 4ECHA 1L9EA 2OLNA 1RSGA 2YG5A 4O5QA 5FS8A 2BA9A 1B37A 4J57A 3RNMA 4YT0A 1FS7A 4H7UA 4A9WA 3I3LA 4YWOA 1JNZA 1Q1WA 1XDIA 4C3XA 1VRQB 4USQA 1GRBA 4NTEA 3SZFA 1PXBA 2YR4A 2ZBWA 2C66A 4Y4LA 3T37A 3UKLA 1B8SA 3GYXA 2I0ZA 3UOZA 5JCNA 2V5ZA 2GF3A 1OJAA 1PJ5A 3ALJA 1D4DA 2JBVA 2YR5A 3NGCX 2VRMA 2WOIA 4K5SA 1PBFA 4Y4NA 1PHHA 4P9SA 2C75A 1OJDA 2XVIA 2OAMA 4JY2A 2YG4A 2OLOA 2YWLA 1M64A 4A6NB 4B66A 5BVAA 5KNLA 1PJ7A 1PN0A 3IWAA 1D4CA 3QVPA 1FS8A 3F8PA 4LU6A 1FT6A 3D8XA 3SFEA 4BK3A 3AEDA 4G73A 4YSYA 3GSIA 4C74A 5IPYA 2AQJA 3GD4A 4X4JA 4Z2UA 2Q7VA 2X8GA 2XVFA 1DOEA 1NHRA 4XWRA 3ICSA 4AP3A 2YQUA 2HQMA 2QAEA 4USRA 1BWCA 3F8DA 3VRAA 2VRLA 3DJEA 4NEWA 1NHQA 4H4YA 2BC0A 2GB0A 3C4AA 5CQFA 4BK2A 2BRYA 3AYIA 2APGA 4IA5A 1REOA 4OPDA 3UTEA 4CNJA 2FJAA 4CRTA 1V59A 2V61A 3M12A 1CL0A 2XFNA 1IUUA 4G6GA 1CJ4A 1JRYA 1IUWA 2C7GA 2VVLG 3SM8A 4JY3A 1VG9A 4U8NA 4DNAA 1JEHA 3UBRA 1F6MA 3KU9A 3FMWA 2XFUA 4YSHA 3OC4A 4B64A 1L9DA 4Z26A 1EL8A 3AEAA 1CBOA 3ZDNA 4B69A 2WDVA 3S61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEA A;  2VVM A;  1CC4 A;  2V60 A;  2Z5X A;  1NG4 A;  2X99 A;  3AE3 A;  2RAB A;  3P1W A;  5GSN A;  1FEB A;  1PBD A;  5BUK A;  3KKJ A;  3CTY A;  3VR9 A;  3FPZ A;  1NHP A;  1K4Q A;  1LTX R;  1NEN A;  4TM4 A;  1ZP0 A;  3F29 A;  1CJ2 A;  2FBW A;  1E1N A;  3C96 A;  3NH3 X;  2VQ7 A;  4Q1O A;  3NG7 X;  3QJ4 A;  4HA6 A;  2CFY A;  5J7X A;  4H4Z A;  4EMJ A;  2XVH A;  1CC2 A;  3ATQ A;  1KNP A;  4JQ9 A;  4BV6 A;  1GRE A;  3K30 A;  4Z44 A;  3NN6 X;  3G5R A;  3CPH G;  5U63 A;  1H83 A;  1GV4 A;  1OJ9 A;  2WS3 A;  1NEK A;  3AWI A;  5LV9 A;  3G5S A;  3AE7 A;  4OPG A;  1PBC A;  4GF7 A;  3RKH A;  1GPE A;  2WP6 A;  3IC9 A;  4K7Z A;  4JN9 A;  1MOK A;  3HZL A;  3ITJ A;  3GWD A;  3OWM A;  4RSL A;  1S3E A;  3ADA B;  1PJ6 A;  1BGN A;  1DOD A;  5DBJ A;  1ZX9 A;  4YTN A;  2RF7 A;  4IA6 A;  4EM3 A;  2AR8 A;  4B1B A;  5KWF A;  4Q0T A;  1KSU A;  1GAL A;  1GRG A;  2BCG G;  4H50 A;  3SCE A;  2WP9 A;  4HB9 A;  4AP1 A;  4OPC A;  1F8R A;  2ARD A;  4AOX A;  1ONF A;  1TDN A;  3EPT A;  3QFA A;  2PHH A;  5EOW A;  1P2E A;  1KDG A;  3TTB A;  3AE5 A;  3KVE A;  1QJD A;  3II4 A;  2V3A A;  3AE9 A;  4IV9 A;  1FCD A;  3LGQ A;  2XFQ A;  2WPC A;  1FT5 A;  2C72 A;  2RDZ A;  4H4P A;  4AOS A;  1EL9 A;  4LA1 A;  4H4S A;  3ATR A;  2E80 A;  2BK5 A;  4DSH A;  4CBQ A;  3BNG A;  2EQ8 A;  1GXF A;  2CUL A;  3PVC A;  2A87 A;  4IVM B;  4U8J A;  3S5W A;  1PBE A;  3AYJ A;  4EIQ A;  1E1M A;  3E1T A;  4C77 A;  2YG3 A;  4RG4 A;  3SXQ A;  1FL2 A;  2Z5Y A;  2GMH A;  1F3P A;  3VRB A;  2VQB A;  4GDE A;  4J36 A;  3Q9T A;  2WDR A;  3CNT A;  1CC6 A;  4D03 A;  2XLT A;  3QSM A;  4NTC A;  4N9X A;  4TM0 A;  1E7P A;  2R0C A;  3ALL A;  3UKH A;  2GR1 A;  1S2Q A;  2YVF A;  2C70 A;  1OJT A;  5M0Z A;  4IVO B;  3URH A;  3NTA A;  2LFC A;  3D1I A;  3BNF A;  3KPF A;  3DK9 A;  4U2L A;  3UKK A;  3BNJ A;  1QLB A;  4U8P A;  2A89 A;  4L3X A;  1LV0 A;  3F8R A;  1M1Q A;  1EL5 A;  3LAD A;  3AEF A;  1PXA A;  1H86 A;  2C73 A;  3NT6 A;  3AE4 A;  4H4W A;  1MXT A;  3BHK A;  3O0H A;  2C3D A;  4H4V A;  1GRA A;  1NAA A;  4NTD A;  4J2W A;  1DOC A;  1Y56 A;  2YM1 A;  2XCG A;  3DGH A;  2XLU A;  1LQU A;  2V6O A;  2E81 A;  2BXS A;  1Q1R A;  2JKC A;  2ZZ0 A;  3RHA A;  2NVK X;  5KOW A;  2ACZ A;  2EQ6 A;  3KA7 A;  2C76 A;  2YLT A;  2BS3 A;  4UDR A;  2IID A;  3VQR A;  1YKJ A;  4APN A;  3QFB A;  1N4V A;  3DJJ A;  3FBS A;  1O95 A;  3FIM B;  3UKQ A;  1LJ1 A;  4GUV A;  5JCI A;  4I59 A;  1GRH A;  3CGC A;  1GOS A;  1GND A;  2JK6 A;  3CGE A;  1CF3 A;  3LZX A;  4OPI A;  4Z2T A;  3B3R A;  2EQ7 A;  4H2Q A;  4B63 A;  2JB2 A;  1IUV A;  3AEG A;  1GTE A;  3CPJ G;  3FO3 A;  2X3N A;  3AD9 B;  1IUT A;  2YLZ A;  3GMC A;  3GRT A;  3LB8 A;  4H4X A;  4EM4 A;  5EB5 A;  3V3N A;  3ICR A;  1CJC A;  2WP5 A;  4AT0 A;  5U25 A;  4UDQ A;  3NLC A;  2C67 A;  2R0P A;  2WBA A;  2OT4 A;  4H4T A;  2R0G A;  3AYL A;  5FMH A;  1M1R A;  5U1O A;  4EIP A;  5KVI A;  2FJE A;  3AD8 B;  2GQW A;  3DA1 A;  3KD9 A;  3NK0 X;  3H8L A;  1QDB A;  2X8C A;  2ZZB A;  1JNR A;  3AE6 A;  3UP4 A;  5KRQ A;  1UKV G;  4ZCD A;  2GRT A;  1K0J A;  4PAB A;  4BUR A;  4Q5C A;  4JNQ A;  4OPL A;  4K8D A;  4AT2 A;  1YQ3 A;  1KSS A;  4H2P A;  4A65 A;  3M13 A;  3BI4 A;  2C3C A;  4WX1 A;  3P4Q A;  3NK1 X;  2WEU A;  3Q6J A;  4TLX A;  4XXG A;  2OAL A;  1E39 A;  3GM6 A;  3UTH A;  2NPX A;  4Y4M A;  1ZKQ A;  3ZYX A;  4CY8 A;  2CDU A;  1DOB A;  4C5O A;  1BF3 A;  1JRZ A;  3UTG A;  1GRT A;  2F5Z A;  1IUX A;  2OA1 A;  5GRT A;  4YTP A;  4Q4U A;  2W0H A;  1M1P A;  3AEE A;  2J7A A;  4A6N A;  2DKH A;  2RGJ A;  4OCG A;  4H2N A;  3P4S A;  2QA1 A;  5C3J A;  1SEZ A;  1TRB A;  3LG1 A;  2GAH B;  1K0L A;  2XFO A;  3LZW A;  2GH5 A;  5FS7 A;  5FS6 A;  3SFD A;  4U8K A;  3R9U A;  4EMW A;  1XHC A;  2WPF A;  1M6I A;  3JSK A;  3DME A;  2BCP A;  4TM1 A;  5FS9 A;  4M52 A;  1KNR A;  3ICT A;  2QA2 A;  1JU2 A;  1Z6L A;  4PAA A;  1LVL A;  2XLS A;  3M0O A;  2XLP A;  3L1R A;  2X50 A;  1GSN A;  4Z24 A;  4H4R A;  2BK3 A;  4J33 A;  4TLZ A;  3C4N A;  1K0I A;  1HYU A;  4J34 A;  1Y56 B;  1S2Y A;  3GDP A;  3VRD B;  3H8I A;  2RGH A;  4RG3 A;  5CKU A;  4L3Y A;  3AEB A;  1D7Y A;  1TDE A;  5EB4 A;  4ADW A;  4YKG A;  4U8L A;  2J3N A;  4U8I A;  1F8W A;  3NTD A;  1Y0P A;  4BJY A;  4EMI A;  2X8H A;  2RGO A;  2BXR A;  1ZOY A;  4A79 A;  5C2T A;  2YLX A;  1TDF A;  3NRN A;  1H6V A;  3G5Q A;  3BNM A;  1E6E A;  2VOU A;  3AD7 B;  3K7Q X;  1FS9 A;  4WCT A;  5KVH A;  4WJY A;  1XAN A;  2GQF A;  2WES A;  1B5Q A;  1GU6 A;  1N1P A;  4FDC B;  1TDK A;  1P2H A;  1ZMD A;  1NDA A;  3RP7 A;  3K7M X;  1JNI A;  1RP0 A;  1ZK7 A;  1EL7 A;  4Z25 A;  1H7X A;  4OPU A;  3H4K A;  5KXJ A;  1SP3 A;  2WU2 A;  4BK1 A;  4J31 A;  1QO8 A;  1EBD A;  1MO9 A;  3EF6 A;  3GDN A;  4Q17 A;  2CVJ A;  1VDC A;  1TDO A;  2GR2 A;  3BNU A;  3IHG A;  3D1C A;  3V76 A;  2K3V A;  4DSG A;  3COX A;  3CPI G;  2A8X A;  4YTM A;  2R46 A;  3UOY A;  2B76 A;  2Q0L A;  3AE1 A;  2AAQ A;  4GRT A;  2B9W A;  4O5U A;  3L1T A;  2VZ2 A;  2JB1 A;  3NIX A;  1GT8 A;  3S7W A;  1CHU A;  1XPQ A;  3CNJ A;  1ZMC A;  4CNK A;  4ZN0 A;  3B6D A;  1CJ3 A;  2YLS A;  2GEW A;  3NN0 X;  1GEU A;  1S3B A;  3CNP A;  2E5V A;  1N4U A;  1VG0 A;  2XVJ A;  4H4U A;  2O9Z A;  2Q0K A;  1H84 A;  1GTH A;  2YG6 A;  4FK1 A;  1LQT A;  2GAG B;  1VQW A;  2H89 A;  4J56 A;  4GCM A;  4X9N A;  4K2X A;  3QSS A;  3NYE A;  3RP8 A;  2Y6R A;  2WET A;  3ALM A;  1TYP A;  3ISH A;  1OJC A;  4D04 A;  3LXD A;  3QSE A;  3DJD A;  1JRX A;  2V3B A;  2JAE A;  3GRS A;  3IHM A;  3RP6 A;  1BZL A;  1JOA A;  3CND A;  4DGK A;  4YSZ A;  2XLR A;  4Q5B A;  4KX6 A;  4C3Y A;  4E0V A;  1H81 A;  2C65 A;  2DKI A;  2WHD A;  3BI2 A;  3CN8 A;  3GMB A;  5JCL A;  4CY6 A;  3KLJ A;  1H7W A;  3RED A;  4OVI A;  4ZCC A;  3BNH A;  3QVR A;  1PDH A;  4K22 A;  1BGJ A;  3SQP A;  2B9X A;  4NZH A;  4KPR A;  5HXI A;  5JCM A;  2XFP A;  2YAU A;  3UCL A;  4U8M A;  4B68 A;  3AE2 A;  2GMJ A;  4UP3 A;  2WOW A;  4U2T A;  3DK4 A;  2R9Z A;  2UZZ A;  1TYT A;  3MMO A;  2E1M A;  3GD3 A;  1B4V A;  1E1K A;  2BS4 A;  1DJQ A;  1F8S A;  2ZO5 A;  5BUL A;  2JB3 A;  5JCK A;  3K7T A;  3P9U A;  2BK4 A;  3BI5 A;  2GR0 A;  3GWF A;  4REK A;  2BS2 A;  3CIR A;  5ER0 A;  1PS9 A;  3UP5 A;  1YQ4 A;  3PS9 A;  2YM2 A;  3AB1 A;  4U8O A;  1ZY8 A;  3LJP A;  2Y6Q A;  3GYI A;  1PXC A;  3UTF A;  3UKF A;  4CCR A;  2YLW A;  2Q6U A;  3P4R A;  3CGB A;  4GR1 A;  2WPE A;  2WU5 A;  5L46 A;  3UOV A;  1LPF A;  3DJG X;  2BAB A;  5EBK A;  4XWZ A;  2R4J A;  2YVJ A;  4A7A A;  2IVE A;  4YXD A;  3NHO X;  3UKP A;  3VR8 A;  4K5R A;  3PO7 A;  2ZZC A;  5HHF A;  2WQY A;  3ABV A;  3NKS A;  2YLR A;  5IQ1 A;  1OAH A;  1IJH A;  4EQW A;  1L9C A;  1YQZ A;  3UU9 A;  1X31 B;  2BAC A;  4GDP A;  2YG7 A;  3V3O A;  4A5L A;  3CGD A;  3OZ2 A;  3UKA A;  4Z2R A;  2H88 A;  1ELI A;  4FK1 C;  1W4X A;  2BC1 A;  4U2S A;  3DGZ A;  4MJW A;  1BVB A;  2TMD A;  4NEV A;  3DK8 A;  2R4E A;  3EAO A;  3BHF A;  4I58 A;  4L3Z A;  4UDP A;  2IVD A;  2B7R A;  1GES A;  1O94 A;  1Q9I A;  1COY A;  2BYB A;  2XVE A;  2YR6 A;  2B7S A;  1GRF A;  3UOX A;  4X9M A;  3WE0 A;  4JNA A;  1RYI A;  2FJD A;  2GR3 A;  5BRT A;  5IQ4 A;  1AOG A;  2VR0 A;  1PBB A;  1NHS A;  2XYO A;  3NK2 X;  1DNC A;  3LOV A;  4YKF A;  3I6D A;  5HY5 A;  3AEC A;  4ICY A;  2C64 A;  2YVG A;  1L0V A;  1BKW A;  1H82 A;  3IF9 A;  3AXB A;  2WOV A;  3GYJ A;  4EQX A;  5TR3 A;  3CNS A;  3NNE A;  5KOX A;  2XDO A;  1NG3 A;  2GV8 A;  1DXL A;  1E1L A;  1DJN A;  2VVL A;  4H2R A;  4FX9 A;  4JDR A;  4LII A;  2PYX A;  1ZOV A;  2E4G A;  2WDQ A;  4Z43 A;  2R45 A;  1D7L A;  2B9Y A;  4B65 A;  1KF6 A;  3TOR A;  1GET A;  4YSX A;  3NYF A;  2GVC A;  1FEC A;  4TM3 A;  4CCQ A;  5J60 A;  4EQS A;  3SGL A;  1GER A;  3P4P A;  3DH9 A;  1YY5 A;  4H4Q A;  1ZDL A;  3NYC A;  2FJB A;  3AE8 A;  4BJZ A;  4EQR A;  4B67 A;  1D4E A;  3EAN A;  4L38 A;  5M10 A;  5HYM A;  3FG2 P;  1O5W A;  1IUS A;  1FOH A;  1NPX A;  2EQ9 A;  1KFY A;  3L8K A;  1D5T A;  4A99 A;  2QCU A;  2TPR A;  4OPT A;  1N4W A;  4ECH A;  1L9E A;  2OLN A;  1RSG A;  2YG5 A;  4O5Q A;  5FS8 A;  2BA9 A;  1B37 A;  4J57 A;  3RNM A;  4YT0 A;  1FS7 A;  4H7U A;  4A9W A;  3I3L A;  4YWO A;  1JNZ A;  1Q1W A;  1XDI A;  4C3X A;  1VRQ B;  4USQ A;  1GRB A;  4NTE A;  1PXB A;  2YR4 A;  2ZBW A;  2C66 A;  4Y4L A;  3T37 A;  3UKL A;  1B8S A;  3UOZ A;  2I0Z A;  5JCN A;  3GYX A;  2V5Z A;  2GF3 A;  1OJA A;  1PJ5 A;  3ALJ A;  1D4D A;  2JBV A;  2YR5 A;  3NGC X;  2VRM A;  2WOI A;  4K5S A;  1PBF A;  4Y4N A;  1PHH A;  4P9S A;  2C75 A;  1OJD A;  2XVI A;  2OAM A;  4JY2 A;  2YG4 A;  2OLO A;  2YWL A;  1M64 A;  4A6N B;  4B66 A;  5BVA A;  1PJ7 A;  1PN0 A;  3IWA A;  1D4C A;  3QVP A;  1FS8 A;  3F8P A;  4LU6 A;  1FT6 A;  3D8X A;  3SFE A;  4BK3 A;  3AED A;  5IPY A;  4YSY A;  3GSI A;  4C74 A;  2AQJ A;  3GD4 A;  4X4J A;  4Z2U A;  2Q7V A;  2X8G A;  2XVF A;  1DOE A;  1NHR A;  4XWR A;  3ICS A;  4AP3 A;  2YQU A;  2HQM A;  2QAE A;  4USR A;  1BWC A;  3F8D A;  3VRA A;  2VRL A;  3DJE A;  4NEW A;  1NHQ A;  4H4Y A;  2BC0 A;  2GB0 A;  3C4A A;  5CQF A;  4BK2 A;  3AYI A;  4OPD A;  2APG A;  4IA5 A;  1REO A;  3UTE A;  4CNJ A;  2FJA A;  4CRT A;  1V59 A;  2V61 A;  3M12 A;  1CL0 A;  2XFN A;  1IUU A;  3SM8 A;  1CJ4 A;  1JRY A;  1IUW A;  2C7G A;  2VVL G;  4JY3 A;  1VG9 A;  4U8N A;  4DNA A;  1JEH A;  3UBR A;  1F6M A;  3KU9 A;  3FMW A;  2XFU A;  4YSH A;  3OC4 A;  4B64 A;  1L9D A;  4Z26 A;  1EL8 A;  3AEA A;  1CBO A;  3ZDN A;  4B69 A;  2WDV A;  3S61 A; 
#chains in the Genus database with same CATH topology
 1FEA A;  2VVM A;  1CC4 A;  2V60 A;  2Z5X A;  1NG4 A;  2X99 A;  3AE3 A;  2RAB A;  3P1W A;  5GSN A;  1FEB A;  1PBD A;  5BUK A;  3KKJ A;  3CTY A;  3VR9 A;  3FPZ A;  1NHP A;  1K4Q A;  1LTX R;  1NEN A;  4TM4 A;  1ZP0 A;  3F29 A;  1CJ2 A;  2FBW A;  1E1N A;  3C96 A;  3NH3 X;  2VQ7 A;  4Q1O A;  3NG7 X;  3QJ4 A;  4HA6 A;  2CFY A;  5J7X A;  4GAV A;  4H4Z A;  4EMJ A;  2XVH A;  1CC2 A;  3ATQ A;  1KNP A;  4JQ9 A;  4BV6 A;  1GRE A;  3K30 A;  4Z44 A;  3NN6 X;  3G5R A;  3CPH G;  5U63 A;  1H83 A;  1GV4 A;  1OJ9 A;  2WS3 A;  1NEK A;  3AWI A;  5LV9 A;  3G5S A;  3AE7 A;  4OPG A;  1PBC A;  4GF7 A;  3RKH A;  1GPE A;  2WP6 A;  3IC9 A;  4K7Z A;  4JN9 A;  1MOK A;  3HZL A;  3ITJ A;  3GWD A;  3OWM A;  4RSL A;  1S3E A;  3ADA B;  1PJ6 A;  1BGN A;  1DOD A;  5DBJ A;  1ZX9 A;  4YTN A;  2RF7 A;  4IA6 A;  4EM3 A;  2AR8 A;  4B1B A;  5KWF A;  4Q0T A;  1KSU A;  1GAL A;  1GRG A;  2BCG G;  4H50 A;  3SCE A;  2WP9 A;  4HB9 A;  4AP1 A;  4OPC A;  1F8R A;  2ARD A;  3HYV A;  4AOX A;  1ONF A;  1TDN A;  3EPT A;  3QFA A;  2PHH A;  5EOW A;  1P2E A;  1KDG A;  3TTB A;  3AE5 A;  3KVE A;  1QJD A;  3II4 A;  2V3A A;  3AE9 A;  4IV9 A;  1FCD A;  3LGQ A;  2XFQ A;  2WPC A;  1FT5 A;  2C72 A;  2RDZ A;  4H4P A;  4AOS A;  1EL9 A;  4LA1 A;  4H4S A;  3ATR A;  2E80 A;  2BK5 A;  4DSH A;  4GAP A;  3BNG A;  4CBQ A;  2EQ8 A;  1GXF A;  2CUL A;  3PVC A;  2A87 A;  4IVM B;  4U8J A;  3S5W A;  1PBE A;  3AYJ A;  4EIQ A;  1E1M A;  3E1T A;  4C77 A;  2YG3 A;  4RG4 A;  3SXQ A;  1FL2 A;  2Z5Y A;  2GMH A;  1F3P A;  3VRB A;  2VQB A;  4GDE A;  4J36 A;  3Q9T A;  2WDR A;  3CNT A;  1CC6 A;  4D03 A;  2XLT A;  3QSM A;  4G74 A;  4N9X A;  4NTC A;  1E7P A;  2R0C A;  3ALL A;  4TM0 A;  2GR1 A;  3SZW A;  1S2Q A;  3UKH A;  2YVF A;  4NNJ A;  2C70 A;  1OJT A;  5M0Z A;  4IVO B;  4II2 A;  3URH A;  3NTA A;  2LFC A;  3D1I A;  3BNF A;  3KPF A;  3DK9 A;  4NWZ A;  4U2L A;  3UKK A;  3BNJ A;  1QLB A;  4U8P A;  3SYI A;  2A89 A;  4L3X A;  1LV0 A;  3F8R A;  1M1Q A;  1EL5 A;  3LAD A;  3AEF A;  1PXA A;  1H86 A;  2C73 A;  3NT6 A;  3AE4 A;  4H4W A;  1MXT A;  3BHK A;  3O0H A;  2C3D A;  3KPK A;  4H4V A;  1GRA A;  1NAA A;  4NTD A;  3T2K A;  4J2W A;  1DOC A;  1Y56 A;  2YM1 A;  2XCG A;  3DGH A;  2XLU A;  1LQU A;  2V6O A;  2E81 A;  2BXS A;  1Q1R A;  2JKC A;  2ZZ0 A;  3RHA A;  2NVK X;  5KOW A;  2ACZ A;  2EQ6 A;  3KA7 A;  2C76 A;  2YLT A;  2BS3 A;  4UDR A;  2IID A;  3VQR A;  1YKJ A;  4APN A;  3QFB A;  1N4V A;  3DJJ A;  3FBS A;  1O95 A;  3FIM B;  3UKQ A;  1LJ1 A;  4GUV A;  5JCI A;  2BRA A;  4I59 A;  1GRH A;  3CGC A;  1GOS A;  1GND A;  2JK6 A;  3CGE A;  1CF3 A;  3LZX A;  4OPI A;  4Z2T A;  3B3R A;  2EQ7 A;  4H2Q A;  4B63 A;  2JB2 A;  1IUV A;  3AEG A;  1GTE A;  3CPJ G;  3FO3 A;  2X3N A;  3AD9 B;  1IUT A;  2YLZ A;  3GMC A;  3GRT A;  3LB8 A;  4H4X A;  4EM4 A;  5EB5 A;  3V3N A;  3ICR A;  1CJC A;  2WP5 A;  4AT0 A;  5U25 A;  4UDQ A;  3NLC A;  2C67 A;  2R0P A;  2WBA A;  2OT4 A;  4H4T A;  2R0G A;  3AYL A;  5FMH A;  1M1R A;  5U1O A;  4EIP A;  5KVI A;  2FJE A;  2CZS A;  3AD8 B;  2GQW A;  3DA1 A;  3KD9 A;  3NK0 X;  3H8L A;  1QDB A;  2X8C A;  2ZZB A;  1JNR A;  3AE6 A;  3UP4 A;  5KRQ A;  1UKV G;  4ZCD A;  2GRT A;  1K0J A;  4PAB A;  4BUR A;  4Q5C A;  4JNQ A;  4G6H A;  4OPL A;  4K8D A;  4AT2 A;  1YQ3 A;  1KSS A;  4H2P A;  4A65 A;  3M13 A;  3BI4 A;  2C3C A;  4WX1 A;  5KMS A;  3HYX A;  3P4Q A;  3NK1 X;  2WEU A;  3Q6J A;  4TLX A;  4XXG A;  2OAL A;  1E39 A;  3GM6 A;  3UTH A;  2NPX A;  4Y4M A;  1ZKQ A;  3ZYX A;  4CY8 A;  2CDU A;  1DOB A;  4C5O A;  1BF3 A;  1JRZ A;  3UTG A;  1GRT A;  2F5Z A;  1IUX A;  2OA1 A;  4G9K A;  5GRT A;  4YTP A;  4Q4U A;  2W0H A;  1M1P A;  3AEE A;  2J7A A;  4A6N A;  2DKH A;  2RGJ A;  4OCG A;  4H2N A;  3P4S A;  2QA1 A;  5C3J A;  1SEZ A;  1TRB A;  3LG1 A;  2GAH B;  1K0L A;  2XFO A;  3LZW A;  2GH5 A;  5FS7 A;  5FS6 A;  3SFD A;  4U8K A;  3SZ0 A;  3R9U A;  4EMW A;  1XHC A;  2WPF A;  1M6I A;  3JSK A;  3DME A;  2BCP A;  4TM1 A;  5FS9 A;  4M52 A;  1KNR A;  3ICT A;  2QA2 A;  1JU2 A;  3SY4 A;  1Z6L A;  4PAA A;  1LVL A;  2XLS A;  3M0O A;  2XLP A;  3L1R A;  2X50 A;  1GSN A;  4Z24 A;  4H4R A;  2BK3 A;  4J33 A;  4TLZ A;  3C4N A;  1K0I A;  1HYU A;  4J34 A;  1Y56 B;  1S2Y A;  3GDP A;  3VRD B;  3H8I A;  2RGH A;  4RG3 A;  5CKU A;  4L3Y A;  3AEB A;  1D7Y A;  1TDE A;  5EB4 A;  4ADW A;  4YKG A;  4U8L A;  2J3N A;  4U8I A;  1F8W A;  3NTD A;  1Y0P A;  4BJY A;  4EMI A;  2X8H A;  2RGO A;  2BXR A;  1ZOY A;  3HYW A;  4A79 A;  5C2T A;  2YLX A;  1TDF A;  3NRN A;  1H6V A;  3G5Q A;  3BNM A;  1E6E A;  2VOU A;  3AD7 B;  3K7Q X;  1FS9 A;  4WCT A;  5KVH A;  4WJY A;  1XAN A;  2GQF A;  2WES A;  1B5Q A;  1GU6 A;  1N1P A;  4FDC B;  1TDK A;  1P2H A;  1ZMD A;  1NDA A;  3RP7 A;  3K7M X;  1JNI A;  1RP0 A;  1ZK7 A;  1EL7 A;  4Z25 A;  1H7X A;  4OPU A;  3H4K A;  5KXJ A;  1SP3 A;  2WU2 A;  4BK1 A;  4J31 A;  1QO8 A;  1EBD A;  1MO9 A;  3EF6 A;  3GDN A;  4Q17 A;  2CVJ A;  1VDC A;  1TDO A;  2GR2 A;  3BNU A;  3IHG A;  3D1C A;  3T31 A;  2K3V A;  3V76 A;  4DSG A;  3T14 A;  3COX A;  3CPI G;  2A8X A;  4YTM A;  2R46 A;  3UOY A;  2B76 A;  2Q0L A;  3AE1 A;  2AAQ A;  4GRT A;  2B9W A;  4O5U A;  3L1T A;  2VZ2 A;  2JB1 A;  3NIX A;  3SZC A;  1GT8 A;  3S7W A;  1CHU A;  1XPQ A;  3CNJ A;  5KMQ A;  1ZMC A;  4CNK A;  4ZN0 A;  3B6D A;  1CJ3 A;  2YLS A;  2GEW A;  3NN0 X;  1GEU A;  1S3B A;  3CNP A;  2E5V A;  1N4U A;  1VG0 A;  2XVJ A;  4H4U A;  2O9Z A;  2Q0K A;  1H84 A;  1GTH A;  2YG6 A;  4FK1 A;  1LQT A;  2GAG B;  1VQW A;  2H89 A;  4J56 A;  4GCM A;  4X9N A;  3SX6 A;  4K2X A;  3QSS A;  3NYE A;  3RP8 A;  2Y6R A;  2WET A;  3ALM A;  1TYP A;  3ISH A;  1OJC A;  4D04 A;  3LXD A;  3QSE A;  3DJD A;  1JRX A;  2V3B A;  2JAE A;  3GRS A;  3IHM A;  3RP6 A;  1BZL A;  1JOA A;  3CND A;  4DGK A;  4YSZ A;  2XLR A;  4Q5B A;  4KX6 A;  4C3Y A;  4E0V A;  1H81 A;  2C65 A;  2DKI A;  2WHD A;  3BI2 A;  3CN8 A;  3GMB A;  5JCL A;  4CY6 A;  3KLJ A;  1H7W A;  3RED A;  4OVI A;  4ZCC A;  3BNH A;  3QVR A;  1PDH A;  4K22 A;  1BGJ A;  3SQP A;  2B9X A;  4NZH A;  4KPR A;  5HXI A;  5JCM A;  2XFP A;  2YAU A;  3UCL A;  4U8M A;  4B68 A;  3AE2 A;  2GMJ A;  4UP3 A;  2WOW A;  4U2T A;  3DK4 A;  2R9Z A;  2UZZ A;  1TYT A;  3MMO A;  2E1M A;  3CMM A;  3GD3 A;  1B4V A;  1E1K A;  2BS4 A;  1DJQ A;  1F8S A;  2ZO5 A;  5BUL A;  2JB3 A;  5JCK A;  3K7T A;  3P9U A;  2BK4 A;  2C4C A;  3BI5 A;  2GR0 A;  3GWF A;  4REK A;  2BS2 A;  3CIR A;  5ER0 A;  1PS9 A;  3UP5 A;  1YQ4 A;  3PS9 A;  2YM2 A;  3AB1 A;  4U8O A;  1ZY8 A;  3LJP A;  2Y6Q A;  3GYI A;  1PXC A;  3UTF A;  3UKF A;  4CCR A;  2YLW A;  2Q6U A;  3P4R A;  3CGB A;  4GR1 A;  2WPE A;  2WU5 A;  5L46 A;  3UOV A;  1LPF A;  3DJG X;  2BAB A;  5EBK A;  4XWZ A;  2R4J A;  3T0K A;  2YVJ A;  4A7A A;  2IVE A;  4YXD A;  3NHO X;  3UKP A;  3VR8 A;  4K5R A;  3PO7 A;  2ZZC A;  5HHF A;  2WQY A;  3ABV A;  3NKS A;  2YLR A;  5IQ1 A;  1OAH A;  1IJH A;  4EQW A;  1L9C A;  1YQZ A;  3UU9 A;  1X31 B;  2BAC A;  4GDP A;  2YG7 A;  3V3O A;  4A5L A;  3CGD A;  3OZ2 A;  3UKA A;  4Z2R A;  2H88 A;  1ELI A;  4FK1 C;  1W4X A;  2BC1 A;  4U2S A;  3DGZ A;  4MJW A;  1BVB A;  2TMD A;  4NEV A;  3DK8 A;  2R4E A;  3EAO A;  3BHF A;  4I58 A;  4L3Z A;  4UDP A;  2IVD A;  2B7R A;  1GES A;  1O94 A;  1Q9I A;  1COY A;  2BYB A;  2XVE A;  2YR6 A;  2B7S A;  1GRF A;  3UOX A;  4X9M A;  3T2Y A;  3WE0 A;  4JNA A;  1RYI A;  2FJD A;  2GR3 A;  5BRT A;  5IQ4 A;  1AOG A;  2VR0 A;  1PBB A;  1NHS A;  2XYO A;  3NK2 X;  1DNC A;  3LOV A;  4YKF A;  3I6D A;  5HY5 A;  3AEC A;  4ICY A;  2C64 A;  2YVG A;  4II3 A;  1L0V A;  1BKW A;  1H82 A;  3IF9 A;  3AXB A;  3T2Z A;  2WOV A;  3GYJ A;  4EQX A;  5TR3 A;  3CNS A;  3NNE A;  5KOX A;  2XDO A;  1NG3 A;  2GV8 A;  1DXL A;  1E1L A;  1DJN A;  2VVL A;  4H2R A;  4FX9 A;  4JDR A;  4LII A;  2PYX A;  1ZOV A;  2E4G A;  2WDQ A;  3SXI A;  4Z43 A;  5KMR A;  2R45 A;  1D7L A;  2B9Y A;  4B65 A;  1KF6 A;  3TOR A;  1GET A;  4YSX A;  3NYF A;  2GVC A;  1FEC A;  4TM3 A;  4CCQ A;  5J60 A;  4EQS A;  3SGL A;  1GER A;  3P4P A;  3DH9 A;  1YY5 A;  4H4Q A;  1ZDL A;  3NYC A;  2FJB A;  3AE8 A;  4BJZ A;  4EQR A;  4B67 A;  5KMP A;  1D4E A;  3EAN A;  4L38 A;  5M10 A;  5HYM A;  3FG2 P;  1O5W A;  1IUS A;  1FOH A;  1NPX A;  2EQ9 A;  1KFY A;  3L8K A;  1D5T A;  4A99 A;  2QCU A;  2TPR A;  4OPT A;  1N4W A;  4ECH A;  1L9E A;  2OLN A;  1RSG A;  2YG5 A;  4O5Q A;  5FS8 A;  2BA9 A;  1B37 A;  4J57 A;  3RNM A;  4YT0 A;  1FS7 A;  4H7U A;  4A9W A;  3I3L A;  4YWO A;  1JNZ A;  1Q1W A;  1XDI A;  4C3X A;  1VRQ B;  4USQ A;  1GRB A;  4NTE A;  3SZF A;  1PXB A;  2YR4 A;  2ZBW A;  2C66 A;  4Y4L A;  3T37 A;  3UKL A;  1B8S A;  3GYX A;  2I0Z A;  3UOZ A;  5JCN A;  2V5Z A;  2GF3 A;  1OJA A;  1PJ5 A;  3ALJ A;  1D4D A;  2JBV A;  2YR5 A;  3NGC X;  2VRM A;  2WOI A;  4K5S A;  1PBF A;  4Y4N A;  1PHH A;  4P9S A;  2C75 A;  1OJD A;  2XVI A;  2OAM A;  4JY2 A;  2YG4 A;  2OLO A;  2YWL A;  1M64 A;  4A6N B;  4B66 A;  5BVA A;  5KNL A;  1PJ7 A;  1PN0 A;  3IWA A;  1D4C A;  3QVP A;  1FS8 A;  3F8P A;  4LU6 A;  1FT6 A;  3D8X A;  3SFE A;  4BK3 A;  3AED A;  4G73 A;  4YSY A;  3GSI A;  4C74 A;  5IPY A;  2AQJ A;  3GD4 A;  4X4J A;  4Z2U A;  2Q7V A;  2X8G A;  2XVF A;  1DOE A;  1NHR A;  4XWR A;  3ICS A;  4AP3 A;  2YQU A;  2HQM A;  2QAE A;  4USR A;  1BWC A;  3F8D A;  3VRA A;  2VRL A;  3DJE A;  4NEW A;  1NHQ A;  4H4Y A;  2BC0 A;  2GB0 A;  3C4A A;  5CQF A;  4BK2 A;  2BRY A;  3AYI A;  2APG A;  4IA5 A;  1REO A;  4OPD A;  3UTE A;  4CNJ A;  2FJA A;  4CRT A;  1V59 A;  2V61 A;  3M12 A;  1CL0 A;  2XFN A;  1IUU A;  4G6G A;  1CJ4 A;  1JRY A;  1IUW A;  2C7G A;  2VVL G;  3SM8 A;  4JY3 A;  1VG9 A;  4U8N A;  4DNA A;  1JEH A;  3UBR A;  1F6M A;  3KU9 A;  3FMW A;  2XFU A;  4YSH A;  3OC4 A;  4B64 A;  1L9D A;  4Z26 A;  1EL8 A;  3AEA A;  1CBO A;  3ZDN A;  4B69 A;  2WDV A;  3S61 A; 
#chains in the Genus database with same CATH homology
 1FEA A;  2VVM A;  1CC4 A;  2V60 A;  2Z5X A;  1NG4 A;  2X99 A;  3AE3 A;  2RAB A;  3P1W A;  5GSN A;  1FEB A;  1PBD A;  5BUK A;  3KKJ A;  3CTY A;  3VR9 A;  3FPZ A;  1NHP A;  1K4Q A;  1LTX R;  1NEN A;  4TM4 A;  1ZP0 A;  3F29 A;  1CJ2 A;  2FBW A;  1E1N A;  3C96 A;  3NH3 X;  2VQ7 A;  4Q1O A;  3NG7 X;  3QJ4 A;  4HA6 A;  2CFY A;  5J7X A;  4GAV A;  4H4Z A;  4EMJ A;  2XVH A;  1CC2 A;  3ATQ A;  1KNP A;  4JQ9 A;  4BV6 A;  1GRE A;  3K30 A;  4Z44 A;  3NN6 X;  3G5R A;  3CPH G;  5U63 A;  1H83 A;  1GV4 A;  1OJ9 A;  2WS3 A;  1NEK A;  3AWI A;  5LV9 A;  3G5S A;  3AE7 A;  4OPG A;  1PBC A;  4GF7 A;  3RKH A;  1GPE A;  2WP6 A;  3IC9 A;  4K7Z A;  4JN9 A;  1MOK A;  3HZL A;  3ITJ A;  3GWD A;  3OWM A;  4RSL A;  1S3E A;  3ADA B;  1PJ6 A;  1BGN A;  1DOD A;  5DBJ A;  1ZX9 A;  4YTN A;  2RF7 A;  4IA6 A;  4EM3 A;  2AR8 A;  4B1B A;  5KWF A;  4Q0T A;  1KSU A;  1GAL A;  1GRG A;  2BCG G;  4H50 A;  3SCE A;  2WP9 A;  4HB9 A;  4AP1 A;  4OPC A;  1F8R A;  2ARD A;  3HYV A;  4AOX A;  1ONF A;  1TDN A;  3EPT A;  3QFA A;  2PHH A;  5EOW A;  1P2E A;  1KDG A;  3TTB A;  3AE5 A;  3KVE A;  1QJD A;  3II4 A;  2V3A A;  3AE9 A;  4IV9 A;  1FCD A;  3LGQ A;  2XFQ A;  2WPC A;  1FT5 A;  2C72 A;  2RDZ A;  4H4P A;  4AOS A;  1EL9 A;  4LA1 A;  4H4S A;  3ATR A;  2E80 A;  2BK5 A;  4DSH A;  4GAP A;  3BNG A;  4CBQ A;  2EQ8 A;  1GXF A;  2CUL A;  3PVC A;  2A87 A;  4IVM B;  4U8J A;  3S5W A;  1PBE A;  3AYJ A;  4EIQ A;  1E1M A;  3E1T A;  4C77 A;  2YG3 A;  4RG4 A;  3SXQ A;  1FL2 A;  2Z5Y A;  2GMH A;  1F3P A;  3VRB A;  2VQB A;  4GDE A;  4J36 A;  3Q9T A;  2WDR A;  3CNT A;  1CC6 A;  4D03 A;  2XLT A;  3QSM A;  4G74 A;  4N9X A;  4NTC A;  1E7P A;  2R0C A;  3ALL A;  4TM0 A;  2GR1 A;  3SZW A;  1S2Q A;  3UKH A;  2YVF A;  4NNJ A;  2C70 A;  1OJT A;  5M0Z A;  4IVO B;  4II2 A;  3URH A;  3NTA A;  2LFC A;  3D1I A;  3BNF A;  3KPF A;  3DK9 A;  4NWZ A;  4U2L A;  3UKK A;  3BNJ A;  1QLB A;  4U8P A;  3SYI A;  2A89 A;  4L3X A;  1LV0 A;  3F8R A;  1M1Q A;  1EL5 A;  3LAD A;  3AEF A;  1PXA A;  1H86 A;  2C73 A;  3NT6 A;  3AE4 A;  4H4W A;  1MXT A;  3BHK A;  3O0H A;  2C3D A;  3KPK A;  4H4V A;  1GRA A;  1NAA A;  4NTD A;  3T2K A;  4J2W A;  1DOC A;  1Y56 A;  2YM1 A;  2XCG A;  3DGH A;  2XLU A;  1LQU A;  2V6O A;  2E81 A;  2BXS A;  1Q1R A;  2JKC A;  2ZZ0 A;  3RHA A;  2NVK X;  5KOW A;  2ACZ A;  2EQ6 A;  3KA7 A;  2C76 A;  2YLT A;  2BS3 A;  4UDR A;  2IID A;  3VQR A;  1YKJ A;  4APN A;  3QFB A;  1N4V A;  3DJJ A;  3FBS A;  1O95 A;  3FIM B;  3UKQ A;  1LJ1 A;  4GUV A;  5JCI A;  2BRA A;  4I59 A;  1GRH A;  3CGC A;  1GOS A;  1GND A;  2JK6 A;  3CGE A;  1CF3 A;  3LZX A;  4OPI A;  4Z2T A;  3B3R A;  2EQ7 A;  4H2Q A;  4B63 A;  2JB2 A;  1IUV A;  3AEG A;  1GTE A;  3CPJ G;  3FO3 A;  2X3N A;  3AD9 B;  1IUT A;  2YLZ A;  3GMC A;  3GRT A;  3LB8 A;  4H4X A;  4EM4 A;  5EB5 A;  3V3N A;  3ICR A;  1CJC A;  2WP5 A;  4AT0 A;  5U25 A;  4UDQ A;  3NLC A;  2C67 A;  2R0P A;  2WBA A;  2OT4 A;  4H4T A;  2R0G A;  3AYL A;  5FMH A;  1M1R A;  5U1O A;  4EIP A;  5KVI A;  2FJE A;  3AD8 B;  2GQW A;  3DA1 A;  3KD9 A;  3NK0 X;  3H8L A;  1QDB A;  2X8C A;  2ZZB A;  1JNR A;  3AE6 A;  3UP4 A;  5KRQ A;  1UKV G;  4ZCD A;  2GRT A;  1K0J A;  4PAB A;  4BUR A;  4Q5C A;  4JNQ A;  4G6H A;  4OPL A;  4K8D A;  4AT2 A;  1YQ3 A;  1KSS A;  4H2P A;  4A65 A;  3M13 A;  3BI4 A;  2C3C A;  4WX1 A;  5KMS A;  3HYX A;  3P4Q A;  3NK1 X;  2WEU A;  3Q6J A;  4TLX A;  4XXG A;  2OAL A;  1E39 A;  3GM6 A;  3UTH A;  2NPX A;  4Y4M A;  1ZKQ A;  3ZYX A;  4CY8 A;  2CDU A;  1DOB A;  4C5O A;  1BF3 A;  1JRZ A;  3UTG A;  1GRT A;  2F5Z A;  1IUX A;  2OA1 A;  4G9K A;  5GRT A;  4YTP A;  4Q4U A;  2W0H A;  1M1P A;  3AEE A;  2J7A A;  4A6N A;  2DKH A;  2RGJ A;  4OCG A;  4H2N A;  3P4S A;  2QA1 A;  5C3J A;  1SEZ A;  1TRB A;  3LG1 A;  2GAH B;  1K0L A;  2XFO A;  3LZW A;  2GH5 A;  5FS7 A;  5FS6 A;  3SFD A;  4U8K A;  3SZ0 A;  3R9U A;  4EMW A;  1XHC A;  2WPF A;  1M6I A;  3JSK A;  3DME A;  2BCP A;  4TM1 A;  5FS9 A;  4M52 A;  1KNR A;  3ICT A;  2QA2 A;  1JU2 A;  3SY4 A;  1Z6L A;  4PAA A;  1LVL A;  2XLS A;  3M0O A;  2XLP A;  3L1R A;  2X50 A;  1GSN A;  4Z24 A;  4H4R A;  2BK3 A;  4J33 A;  4TLZ A;  3C4N A;  1K0I A;  1HYU A;  4J34 A;  1Y56 B;  1S2Y A;  3GDP A;  3VRD B;  3H8I A;  2RGH A;  4RG3 A;  5CKU A;  4L3Y A;  3AEB A;  1D7Y A;  1TDE A;  5EB4 A;  4ADW A;  4YKG A;  4U8L A;  2J3N A;  4U8I A;  1F8W A;  3NTD A;  1Y0P A;  4BJY A;  4EMI A;  2X8H A;  2RGO A;  2BXR A;  1ZOY A;  3HYW A;  4A79 A;  5C2T A;  2YLX A;  1TDF A;  3NRN A;  1H6V A;  3G5Q A;  3BNM A;  1E6E A;  2VOU A;  3AD7 B;  3K7Q X;  1FS9 A;  4WCT A;  5KVH A;  4WJY A;  1XAN A;  2GQF A;  2WES A;  1B5Q A;  1GU6 A;  1N1P A;  4FDC B;  1TDK A;  1P2H A;  1ZMD A;  1NDA A;  3RP7 A;  3K7M X;  1JNI A;  1RP0 A;  1ZK7 A;  1EL7 A;  4Z25 A;  1H7X A;  4OPU A;  3H4K A;  5KXJ A;  1SP3 A;  2WU2 A;  4BK1 A;  4J31 A;  1QO8 A;  1EBD A;  1MO9 A;  3EF6 A;  3GDN A;  4Q17 A;  2CVJ A;  1VDC A;  1TDO A;  2GR2 A;  3BNU A;  3IHG A;  3D1C A;  3T31 A;  2K3V A;  3V76 A;  4DSG A;  3T14 A;  3COX A;  3CPI G;  2A8X A;  4YTM A;  2R46 A;  3UOY A;  2B76 A;  2Q0L A;  3AE1 A;  2AAQ A;  4GRT A;  2B9W A;  4O5U A;  3L1T A;  2VZ2 A;  2JB1 A;  3NIX A;  3SZC A;  1GT8 A;  3S7W A;  1CHU A;  1XPQ A;  3CNJ A;  5KMQ A;  1ZMC A;  4CNK A;  4ZN0 A;  3B6D A;  1CJ3 A;  2YLS A;  2GEW A;  3NN0 X;  1GEU A;  1S3B A;  3CNP A;  2E5V A;  1N4U A;  1VG0 A;  2XVJ A;  4H4U A;  2O9Z A;  2Q0K A;  1H84 A;  1GTH A;  2YG6 A;  4FK1 A;  1LQT A;  2GAG B;  1VQW A;  2H89 A;  4J56 A;  4GCM A;  4X9N A;  3SX6 A;  4K2X A;  3QSS A;  3NYE A;  3RP8 A;  2Y6R A;  2WET A;  3ALM A;  1TYP A;  3ISH A;  1OJC A;  4D04 A;  3LXD A;  3QSE A;  3DJD A;  1JRX A;  2V3B A;  2JAE A;  3GRS A;  3IHM A;  3RP6 A;  1BZL A;  1JOA A;  3CND A;  4DGK A;  4YSZ A;  2XLR A;  4Q5B A;  4KX6 A;  4C3Y A;  4E0V A;  1H81 A;  2C65 A;  2DKI A;  2WHD A;  3BI2 A;  3CN8 A;  3GMB A;  5JCL A;  4CY6 A;  3KLJ A;  1H7W A;  3RED A;  4OVI A;  4ZCC A;  3BNH A;  3QVR A;  1PDH A;  4K22 A;  1BGJ A;  3SQP A;  2B9X A;  4NZH A;  4KPR A;  5HXI A;  5JCM A;  2XFP A;  2YAU A;  3UCL A;  4U8M A;  4B68 A;  3AE2 A;  2GMJ A;  4UP3 A;  2WOW A;  4U2T A;  3DK4 A;  2R9Z A;  2UZZ A;  1TYT A;  3MMO A;  2E1M A;  3CMM A;  3GD3 A;  1B4V A;  1E1K A;  2BS4 A;  1DJQ A;  1F8S A;  2ZO5 A;  5BUL A;  2JB3 A;  5JCK A;  3K7T A;  3P9U A;  2BK4 A;  2C4C A;  3BI5 A;  2GR0 A;  3GWF A;  4REK A;  2BS2 A;  3CIR A;  5ER0 A;  1PS9 A;  3UP5 A;  1YQ4 A;  3PS9 A;  2YM2 A;  3AB1 A;  4U8O A;  1ZY8 A;  3LJP A;  2Y6Q A;  3GYI A;  1PXC A;  3UTF A;  3UKF A;  4CCR A;  2YLW A;  2Q6U A;  3P4R A;  3CGB A;  4GR1 A;  2WPE A;  2WU5 A;  5L46 A;  3UOV A;  1LPF A;  3DJG X;  2BAB A;  5EBK A;  4XWZ A;  2R4J A;  3T0K A;  2YVJ A;  4A7A A;  2IVE A;  4YXD A;  3NHO X;  3UKP A;  3VR8 A;  4K5R A;  3PO7 A;  2ZZC A;  5HHF A;  2WQY A;  3ABV A;  3NKS A;  2YLR A;  5IQ1 A;  1OAH A;  1IJH A;  4EQW A;  1L9C A;  1YQZ A;  3UU9 A;  1X31 B;  2BAC A;  4GDP A;  2YG7 A;  3V3O A;  4A5L A;  3CGD A;  3OZ2 A;  3UKA A;  4Z2R A;  2H88 A;  1ELI A;  4FK1 C;  1W4X A;  2BC1 A;  4U2S A;  3DGZ A;  4MJW A;  1BVB A;  2TMD A;  4NEV A;  3DK8 A;  2R4E A;  3EAO A;  3BHF A;  4I58 A;  4L3Z A;  4UDP A;  2IVD A;  2B7R A;  1GES A;  1O94 A;  1Q9I A;  1COY A;  2BYB A;  2XVE A;  2YR6 A;  2B7S A;  1GRF A;  3UOX A;  4X9M A;  3T2Y A;  3WE0 A;  4JNA A;  1RYI A;  2FJD A;  2GR3 A;  5BRT A;  5IQ4 A;  1AOG A;  2VR0 A;  1PBB A;  1NHS A;  2XYO A;  3NK2 X;  1DNC A;  3LOV A;  4YKF A;  3I6D A;  5HY5 A;  3AEC A;  4ICY A;  2C64 A;  2YVG A;  4II3 A;  1L0V A;  1BKW A;  1H82 A;  3IF9 A;  3AXB A;  3T2Z A;  2WOV A;  3GYJ A;  4EQX A;  5TR3 A;  3CNS A;  3NNE A;  5KOX A;  2XDO A;  1NG3 A;  2GV8 A;  1DXL A;  1E1L A;  1DJN A;  2VVL A;  4H2R A;  4FX9 A;  4JDR A;  4LII A;  2PYX A;  1ZOV A;  2E4G A;  2WDQ A;  3SXI A;  4Z43 A;  5KMR A;  2R45 A;  1D7L A;  2B9Y A;  4B65 A;  1KF6 A;  3TOR A;  1GET A;  4YSX A;  3NYF A;  2GVC A;  1FEC A;  4TM3 A;  4CCQ A;  5J60 A;  4EQS A;  3SGL A;  1GER A;  3P4P A;  3DH9 A;  1YY5 A;  4H4Q A;  1ZDL A;  3NYC A;  2FJB A;  3AE8 A;  4BJZ A;  4EQR A;  4B67 A;  5KMP A;  1D4E A;  3EAN A;  4L38 A;  5M10 A;  5HYM A;  3FG2 P;  1O5W A;  1IUS A;  1FOH A;  1NPX A;  2EQ9 A;  1KFY A;  3L8K A;  1D5T A;  4A99 A;  2QCU A;  2TPR A;  4OPT A;  1N4W A;  4ECH A;  1L9E A;  2OLN A;  1RSG A;  2YG5 A;  4O5Q A;  5FS8 A;  2BA9 A;  1B37 A;  4J57 A;  3RNM A;  4YT0 A;  1FS7 A;  4H7U A;  4A9W A;  3I3L A;  4YWO A;  1JNZ A;  1Q1W A;  1XDI A;  4C3X A;  1VRQ B;  4USQ A;  1GRB A;  4NTE A;  3SZF A;  1PXB A;  2YR4 A;  2ZBW A;  2C66 A;  4Y4L A;  3T37 A;  3UKL A;  1B8S A;  3GYX A;  2I0Z A;  3UOZ A;  5JCN A;  2V5Z A;  2GF3 A;  1OJA A;  1PJ5 A;  3ALJ A;  1D4D A;  2JBV A;  2YR5 A;  3NGC X;  2VRM A;  2WOI A;  4K5S A;  1PBF A;  4Y4N A;  1PHH A;  4P9S A;  2C75 A;  1OJD A;  2XVI A;  2OAM A;  4JY2 A;  2YG4 A;  2OLO A;  2YWL A;  1M64 A;  4A6N B;  4B66 A;  5BVA A;  5KNL A;  1PJ7 A;  1PN0 A;  3IWA A;  1D4C A;  3QVP A;  1FS8 A;  3F8P A;  4LU6 A;  1FT6 A;  3D8X A;  3SFE A;  4BK3 A;  3AED A;  4G73 A;  4YSY A;  3GSI A;  4C74 A;  5IPY A;  2AQJ A;  3GD4 A;  4X4J A;  4Z2U A;  2Q7V A;  2X8G A;  2XVF A;  1DOE A;  1NHR A;  4XWR A;  3ICS A;  4AP3 A;  2YQU A;  2HQM A;  2QAE A;  4USR A;  1BWC A;  3F8D A;  3VRA A;  2VRL A;  3DJE A;  4NEW A;  1NHQ A;  4H4Y A;  2BC0 A;  2GB0 A;  3C4A A;  5CQF A;  4BK2 A;  2BRY A;  3AYI A;  2APG A;  4IA5 A;  1REO A;  4OPD A;  3UTE A;  4CNJ A;  2FJA A;  4CRT A;  1V59 A;  2V61 A;  3M12 A;  1CL0 A;  2XFN A;  1IUU A;  4G6G A;  1CJ4 A;  1JRY A;  1IUW A;  2C7G A;  2VVL G;  3SM8 A;  4JY3 A;  1VG9 A;  4U8N A;  4DNA A;  1JEH A;  3UBR A;  1F6M A;  3KU9 A;  3FMW A;  2XFU A;  4YSH A;  3OC4 A;  4B64 A;  1L9D A;  4Z26 A;  1EL8 A;  3AEA A;  1CBO A;  3ZDN A;  4B69 A;  2WDV A;  3S61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...