2B7SA

R381k mutant of flavocytochrome c3
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVKGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 192
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7sA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7sA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7sA03
3RNMA 3DH9A 1SP3A 1Q1RA 1BWCA 1YY5A 4J31A 2YQUA 2V60A 2V5ZA 4AP3A 3GRTA 4NEWA 1JNRA 2YR6A 3AWIA 4I59A 4RSLA 5J7XA 4B64A 1GERA 2R0PA 4EIPA 5IPYA 4H4ZA 3NGCX 2BA9A 4U8JA 2YWLA 2Z5XA 3GM6A 2JAEA 2BS4A 2F5ZA 2GAHB 2C66A 4P9SA 4NZHA 4TM1A 4Y4NA 5EB5A 1LTXR 1L9EA 3UP5A 3DJGX 1YQZA 4U2SA 3ITJA 1TYTA 3NTDA 3AECA 3KPFA 4JNAA 5J60A 5FS7A 1QDBA 3LZXA 4H4YA 4YKGA 1ZP0A 1XHCA 2GMJA 2BC1A 2ZZ0A 5LV9A 2WP6A 5DBJA 3RP6A 2UZZA 3DGHA 1E1NA 5U63A 4ADWA 4A5LA 3CPHG 3NLCA 1JNIA 4GDEA 2BS2A 2CFYA 3SFEA 4FDCB 4JQ9A 3NN0X 4Z25A 4H7UA 1M64A 1M1PA 4U8PA 5KWFA 4C3YA 4OPGA 1LQUA 3F29A 5KVHA 1PBBA 3M0OA 3Q6JA 3PO7A 1DOEA 4J56A 4DGKA 3IHMA 4EQRA 1IUUA 4EMJA 4CCRA 3GWFA 1PXAA 1ZOYA 2BS3A 1F8SA 3KU9A 4M52A 1W4XA 5KVIA 1CC2A 1CJ3A 1E1MA 1Q1WA 1PJ5A 1ZMCA 1VG0A 2AAQA 1ZMDA 2H88A 1FS7A 2I0ZA 1Y0PA 2R4EA 3O0HA 2XVEA 3RP8A 2B7SA 3G5RA 1PS9A 4B65A 1TDOA 2WEUA 4EQXA 3P4PA 1DJNA 1GRTA 2RF7A 1DOBA 2BK3A 3NHOX 4LA1A 4XWRA 5BULA 3UKKA 4OPLA 4O5QA 1ZY8A 2YG4A 4CBQA 2YLWA 3CGDA 3AD7B 4TM3A 1OJ9A 1GETA 3NT6A 1IUXA 1CJCA 3P4RA 4H2RA 3UOVA 1GRFA 3AB1A 4IA6A 3UOXA 2YVJA 3LJPA 2RGJA 2K3VA 1E39A 1RYIA 3KA7A 2VRLA 1JRYA 4H4QA 2A8XA 1XDIA 4EMIA 2WDVA 4L3XA 1E1KA 2YG7A 1N1PA 4GF7A 1OJDA 4EMWA 2YLXA 1BKWA 3ABVA 3ALLA 1LQTA 4ZCCA 1NHPA 1LV0A 1OJCA 1B4VA 1FEBA 1BF3A 1PN0A 1JU2A 2C3CA 3URHA 2C75A 5HY5A 1F6MA 3II4A 1Y56B 2E1MA 3I3LA 5IQ1A 4AOSA 2C70A 3DMEA 3NTAA 3UU9A 3AE9A 3CNDA 3COXA 2BACA 2CDUA 2FJBA 3AEEA 1GXFA 2YLTA 4IA5A 2GQWA 4USQA 2FJDA 2C67A 2R4JA 4OPIA 2QCUA 2GRTA 3SGLA 2VVMA 3GD4A 3KLJA 4UP3A 3UTGA 4Z43A 3AYIA 2RABA 3BI2A 3B3RA 3ATQA 2DKIA 3CIRA 2WOVA 1IUWA 2TMDA 4B63A 4J36A 2YAUA 2B9YA 3AD9B 3AEAA 4U2TA 4Y4LA 1KSUA 3LG1A 3NYCA 4YSYA 1FS9A 4FK1C 3QSSA 5EB4A 2Y6RA 3Q9TA 2XLRA 3UCLA 3BHFA 3ALJA 3NKSA 1LPFA 5GRTA 1ZDLA 4X9MA 3UP4A 3NK0X 1ONFA 4PABA 3AE5A 3UTFA 4BK1A 3L8KA 1ZKQA 3GYJA 1VRQB 1EL8A 3BNGA 4BJZA 1GSNA 2VQ7A 4YSXA 2ZBWA 3VRAA 5JCMA 3QFAA 1AOGA 1XANA 3QVRA 4H2QA 3UKPA 1LJ1A 2BXRA 2DKHA 3NYEA 3SCEA 3NK1X 4JNQA 4YWOA 3RP7A 2OAMA 3KD9A 2BABA 1FS8A 3IWAA 4X9NA 2LFCA 5BVAA 2YG5A 2WP5A 1PBEA 1NEKA 2R46A 3DK9A 1H83A 1H86A 2WOWA 3BNMA 2X8CA 4CY6A 4EQWA 2WU2A 4U8OA 2WS3A 1X31B 3PVCA 1O5WA 3SM8A 3VQRA 2AQJA 4YSHA 1FL2A 3ATRA 3VRBA 4BK3A 3LXDA 1JOAA 3AE3A 2X8HA 3M12A 1D5TA 1NDAA 2Z5YA 2XYOA 3EF6A 3QFBA 3CPIG 3K7QX 3ZYXA 2XLSA 1NAAA 3AEDA 2GF3A 3AD8B 3AYLA 3EANA 4H2PA 3UOZA 3H4KA 2XFUA 1PBCA 2WU5A 4B1BA 4JDRA 4CY8A 1NENA 2WHDA 2BK5A 3UKAA 4OPDA 2C73A 3UOYA 2APGA 4Q0TA 4U2LA 2OLOA 1NHSA 1IJHA 1KDGA 5FS6A 4EM4A 3AE6A 1TDEA 2YR5A 2IVDA 4JN9A 1K4QA 2WP9A 4U8MA 3PS9A 5KXJA 2JB2A 3FIMB 3BI5A 2WDRA 1N4VA 1PBDA 3K7TA 4K5RA 4L3ZA 1GALA 3VR9A 3SXQA 2GR0A 4C77A 3LB8A 2XVFA 1B5QA 4Z2RA 1GRAA 1VG9A 2YLZA 2QA2A 4ICYA 4C5OA 3AYJA 3M13A 1OJAA 3AE7A 4CNJA 1GEUA 1IUSA 1ZOVA 4TM0A 3S61A 2WESA 1PDHA 1NG4A 4J57A 3QSEA 4DNAA 3DJJA 1YQ3A 5M10A 2OALA 3EAOA 2EQ7A 3CGBA 5BRTA 4K7ZA 4Z44A 2OT4A 1KNPA 2XVJA 3LADA 4Q5BA 2RGHA 3DK4A 4UDQA 1HYUA 2PYXA 3BI4A 4TLZA 2X8GA 2ZO5A 5HYMA 2NPXA 1UKVG 1N4UA 2VZ2A 5C3JA 1BVBA 2PHHA 2Q7VA 4NTEA 4Z2UA 1GOSA 2XFOA 3L1TA 3UKLA 3B6DA 4IVOB 4LIIA 4WX1A 2YR4A 4XWZA 3VR8A 1GREA 1NHRA 1S2YA 4AT2A 5U1OA 2Q0KA 2XFQA 4B66A 5BUKA 3FO3A 1FCDA 2BYBA 2C3DA 3NK2X 1BGNA 1E6EA 1F3PA 1K0JA 4H50A 2XVHA 1QLBA 3S7WA 4U8IA 2E80A 3BNJA 3AE4A 1Z6LA 1ZK7A 2GMHA 4J2WA 4UDRA 2V3AA 5EOWA 3UBRA 2BCGG 3F8PA 3GDNA 4D04A 3OZ2A 1DOCA 5GSNA 1PBFA 2ZZBA 3CPJG 1VQWA 3L1RA 4AT0A 2XDOA 1BGJA 4N9XA 5TR3A 1RP0A 2R9ZA 5L46A 3NNEA 3UKQA 2JB1A 3P9UA 5U25A 4AOXA 4IVMB 2GEWA 2H89A 2VOUA 3NIXA 4KPRA 5JCLA 2R45A 3AE1A 4GR1A 4OPCA 1V59A 4IV9A 4TLXA 4EQSA 4A9WA 1KF6A 1H7WA 2GB0A 2A89A 1CL0A 1JRZA 1CHUA 1FT6A 1KNRA 2JBVA 2V6OA 3ICSA 4B67A 4H4XA 1M1QA 2WETA 2Y6QA 4I58A 4BURA 4GRTA 3NH3X 4ZN0A 4H4PA 5JCKA 4APNA 2C7GA 1Y56A 4CCQA 3CGCA 2C76A 1GPEA 4O5UA 1RSGA 1CC4A 5JCIA 1E7PA 2R0CA 2XCGA 2VQBA 3BNUA 3C4AA 2OLNA 4U8LA 1L0VA 3P1WA 3SFDA 2YVFA 4BK2A 3UKHA 3RKHA 1K0LA 3BNFA 4H4TA 2GV8A 2FBWA 2GR2A 1GRGA 2CULA 3C4NA 3MMOA 3QSMA 3FBSA 1TDKA 4NTCA 2XLTA 3RHAA 4H2NA 3GWDA 2BC0A 4RG4A 3V76A 4OPUA 4YXDA 1MO9A 1TDFA 1H6VA 3F8DA 4H4SA 5CQFA 1O94A 3AEBA 4B69A 4EM3A 3AXBA 2A87A 1PJ7A 3AEFA 4GCMA 1NG3A 1LVLA 3CNTA 1QJDA 1PJ6A 3DGZA 3G5QA 1YQ4A 1B8SA 1S3EA 1EBDA 2Q0LA 3C96A 3NRNA 5FMHA 2YVGA 5EBKA 1NHQA 2WOIA 3D8XA 2XLUA 4OPTA 4YTNA 2QAEA 4NEVA 3OWMA 2FJAA 4L38A 1FOHA 1GTHA 3ADAB 1GTEA 1MOKA 2NVKX 3CNJA 2XFNA 2E5VA 4FX9A 1L9DA 3V3NA 2BXSA 2E4GA 3AEGA 1SEZA 1ELIA 3GYIA 2FJEA 3CGEA 2RGOA 4K8DA 1H7XA 4A65A 5KOXA 3OC4A 1F8WA 1KSSA 1GRHA 1PHHA 1CF3A 2EQ8A 1FT5A 4XXGA 2RDZA 3ICRA 3IHGA 3P4QA 3AE2A 4Q1OA 3JSKA 2E81A 1COYA 4WJYA 1H81A 1CJ4A 5M0ZA 1DXLA 2C72A 4C74A 2JKCA 1ZX9A 1F8RA 3GMCA 4KX6A 4YT0A 4A99A 4X4JA 2Q6UA 1K0IA 4BV6A 1D4CA 1QO8A 3SQPA 1DJQA 1EL9A 3DA1A 3GDPA 1GESA 4HB9A 4K22A 2BK4A 4OCGA 1EL5A 3V3OA 4FK1A 3K30A 1H84A 1REOA 1TYPA 3KVEA 4E0VA 4OVIA 1Q9IA 4U8KA 1N4WA 2BCPA 5C2TA 1CJ2A 3HZLA 2B76A 3ICTA 1FEAA 4J34A 3CTYA 1CBOA 4Q4UA 4ECHA 2IIDA 3GYXA 1DNCA 1P2EA 2GR1A 2XFPA 1M1RA 3CNPA 3LZWA 1EL7A 3DJDA 2EQ6A 4GUVA 4UDPA 1JNZA 3E1TA 4ZCDA 5HHFA 3VRDB 1FECA 1GRBA 1D4DA 1KFYA 2YM2A 4B68A 5KOWA 2JB3A 2X3NA 5FS9A 2IVEA 4Z26A 1IUVA 2YM1A 4K5SA 3CNSA 4PAAA 3DJEA 3GD3A 3FMWA 2XLPA 4YTMA 3I6DA 4L3YA 4YSZA 4NTDA 1S3BA 4TM4A 2VVLG 1VDCA 4Z24A 3TTBA 3P4SA 4H4VA 2JK6A 4Q5CA 2YLSA 2C64A 1D7LA 4GDPA 1D7YA 2ZZCA 3K7MX 3UKFA 1TRBA 3GRSA 4A6NB 1GU6A 3GSIA 1NPXA 3ISHA 3F8RA 2WPEA 4K2XA 5HXIA 2VRMA 2V61A 2YG6A 3FG2P 4CRTA 1JEHA 4D03A 3S5WA 1GV4A 1M6IA 2WBAA 2WPCA 2J3NA 3UTEA 3R9UA 2B9WA 1O95A 1D4EA 2C65A 3BHKA 4H4RA 2GAGB 2VVLA 2QA1A 3IC9A 3EPTA 1P2HA 2EQ9A 3KKJA 4HA6A 1CC6A 1OJTA 2X99A 1IUTA 5CKUA 2W0HA 4A6NA 4YTPA 3T37A 1TDNA 4EIQA 3REDA 3ZDNA 2R0GA 4LU6A 5FS8A 5JCNA 2VR0A 3ALMA 3LOVA 4DSHA 4U8NA 2O9ZA 3H8LA 2GVCA 2V3BA 5ER0A 4J33A 3LGQA 2GR3A 2TPRA 4USRA 3D1IA 1JRXA 2CVJA 1H82A 2WPFA 4WCTA 1GT8A 1MXTA 4H4WA 2HQMA 2WDQA 1DODA 1XPQA 4C3XA 2WQYA 2B7RA 3D1CA 3IF9A 4JY2A 3AE8A 3TORA 4AP1A 2OA1A 4YKFA 4CNKA 1OAHA 2J7AA 2GH5A 1PXCA 4H4UA 4MJWA 2ARDA 2X50A 1GNDA 4RG3A 4Y4MA 3DK8A 2XVIA 2GQFA 3UTHA 4A7AA 4Z2TA 5KRQA 1PXBA 1BZLA 3BNHA 3NG7X 3NYFA 5IQ4A 3H8IA 3QVPA 3FPZA 3CN8A 4BJYA 1L9CA 4Q17A 3NN6X 1YKJA 2YG3A 2B9XA 4A79A 2YLRA 1S2QA 1E1LA 4REKA 3G5SA 2ACZA 4JY3A 3QJ4A 3GMBA 1B37A 4DSGA 2AR8A 3WE0A
chains in the Genus database with same CATH superfamily
3RNMA 3DH9A 1SP3A 1Q1RA 1BWCA 1YY5A 4J31A 2YQUA 2V60A 2V5ZA 4AP3A 3GRTA 4NEWA 1JNRA 2YR6A 3AWIA 4I59A 4RSLA 5J7XA 4B64A 1GERA 2R0PA 4EIPA 5IPYA 4H4ZA 3NGCX 2BA9A 4U8JA 2YWLA 2Z5XA 3GM6A 2JAEA 2BS4A 2F5ZA 2GAHB 2C66A 4P9SA 4NZHA 4TM1A 4Y4NA 5EB5A 1LTXR 1L9EA 3UP5A 3DJGX 1YQZA 4U2SA 3ITJA 1TYTA 3NTDA 3AECA 3KPFA 4JNAA 5J60A 5FS7A 1QDBA 3LZXA 4H4YA 4YKGA 1ZP0A 1XHCA 2GMJA 2BC1A 2ZZ0A 5LV9A 2WP6A 5DBJA 3RP6A 2UZZA 3DGHA 1E1NA 5U63A 4ADWA 4A5LA 3CPHG 3NLCA 1JNIA 4GDEA 2BS2A 2CFYA 3SFEA 4FDCB 4JQ9A 3NN0X 4Z25A 4H7UA 4NWZA 1M64A 1M1PA 4U8PA 5KWFA 4C3YA 4OPGA 1LQUA 3F29A 5KVHA 1PBBA 3M0OA 3Q6JA 3PO7A 1DOEA 4J56A 4DGKA 3IHMA 4EQRA 1IUUA 4EMJA 4CCRA 3GWFA 1PXAA 1ZOYA 2BS3A 1F8SA 3KU9A 4M52A 1W4XA 5KVIA 1CC2A 1CJ3A 1E1MA 1Q1WA 1PJ5A 1ZMCA 1VG0A 2AAQA 1ZMDA 2H88A 1FS7A 2I0ZA 1Y0PA 2R4EA 3O0HA 2XVEA 3RP8A 2B7SA 3G5RA 1PS9A 4B65A 1TDOA 2WEUA 4EQXA 3P4PA 1DJNA 1GRTA 2RF7A 1DOBA 2BK3A 3NHOX 4LA1A 4XWRA 3SZ0A 3UKKA 4OPLA 4O5QA 1ZY8A 2YG4A 5BULA 4CBQA 2YLWA 3CGDA 3AD7B 4TM3A 1OJ9A 1GETA 3NT6A 1IUXA 4G73A 1CJCA 3P4RA 4H2RA 5FMHA 3UOVA 1GRFA 3AB1A 4IA6A 3UOXA 2YVJA 3LJPA 2RGJA 2K3VA 1E39A 1RYIA 3KA7A 2VRLA 1JRYA 4H4QA 2A8XA 1XDIA 4EMIA 2WDVA 4L3XA 1E1KA 2YG7A 1N1PA 4GF7A 1OJDA 4EMWA 5KNLA 2YLXA 1BKWA 3ABVA 3ALLA 1LQTA 4ZCCA 1NHPA 1LV0A 1OJCA 1B4VA 1FEBA 1BF3A 4GAVA 1PN0A 1JU2A 2C3CA 3URHA 2C75A 5HY5A 1F6MA 3II4A 1Y56B 2E1MA 3I3LA 5IQ1A 4AOSA 2C70A 3DMEA 3NTAA 3UU9A 4II3A 3AE9A 3CNDA 3COXA 2BACA 2CDUA 2FJBA 3AEEA 1GXFA 2YLTA 4IA5A 2GQWA 4USQA 2FJDA 2C67A 2R4JA 4OPIA 2QCUA 2GRTA 3SGLA 2VVMA 3GD4A 3KLJA 2CZSA 4UP3A 3UTGA 4Z43A 3AYIA 2RABA 3BI2A 3B3RA 3ATQA 2DKIA 3CIRA 2WOVA 1IUWA 2TMDA 4B63A 4J36A 2YAUA 2B9YA 3AD9B 3AEAA 4U2TA 4Y4LA 1KSUA 3LG1A 3NYCA 4YSYA 1FS9A 4FK1C 3QSSA 5EB4A 2Y6RA 3Q9TA 2XLRA 3UCLA 3BHFA 3ALJA 3NKSA 2C4CA 1LPFA 5GRTA 1ZDLA 4X9MA 3UP4A 3NK0X 1ONFA 4PABA 3AE5A 3UTFA 4BK1A 3L8KA 1ZKQA 3GYJA 1VRQB 1EL8A 3BNGA 4BJZA 1GSNA 2VQ7A 4YSXA 2ZBWA 3VRAA 5JCMA 3QFAA 1AOGA 1XANA 3QVRA 4H2QA 3UKPA 3SZWA 1LJ1A 2BXRA 2DKHA 3NYEA 3SCEA 3NK1X 4JNQA 4YWOA 3RP7A 2OAMA 3KD9A 2BABA 1FS8A 3IWAA 4X9NA 2LFCA 5BVAA 3KPKA 2YG5A 2WP5A 1PBEA 4G74A 1NEKA 2R46A 3DK9A 1H83A 1H86A 2WOWA 3BNMA 2X8CA 4CY6A 4EQWA 2WU2A 4U8OA 2WS3A 1X31B 2BRYA 3PVCA 1O5WA 3SM8A 3VQRA 2AQJA 4YSHA 1FL2A 3ATRA 3VRBA 4BK3A 3LXDA 1JOAA 3AE3A 2X8HA 3M12A 1D5TA 1NDAA 2Z5YA 2XYOA 3EF6A 3QFBA 3CPIG 3K7QX 3ZYXA 3T2YA 2XLSA 1NAAA 3AEDA 2GF3A 3AD8B 3AYLA 3EANA 4H2PA 3UOZA 3H4KA 2XFUA 1PBCA 2WU5A 4B1BA 4JDRA 4CY8A 1NENA 2WHDA 2BK5A 3UKAA 4OPDA 2C73A 3UOYA 2APGA 4Q0TA 4U2LA 2OLOA 1NHSA 1IJHA 1KDGA 5FS6A 4EM4A 3AE6A 1TDEA 2YR5A 2IVDA 4JN9A 1K4QA 2WP9A 4U8MA 3PS9A 5KXJA 2JB2A 3FIMB 3BI5A 2WDRA 1N4VA 1PBDA 3K7TA 4K5RA 4L3ZA 1GALA 3T2ZA 3VR9A 3SXQA 2GR0A 4C77A 3LB8A 2XVFA 1B5QA 4Z2RA 1GRAA 1VG9A 2YLZA 2QA2A 4ICYA 4C5OA 3AYJA 3GYXA 1OJAA 3AE7A 3M13A 1GEUA 1IUSA 1ZOVA 4TM0A 3S61A 2WESA 1PDHA 1NG4A 4J57A 3QSEA 4DNAA 3DJJA 1YQ3A 5M10A 2OALA 3EAOA 2EQ7A 3CGBA 5BRTA 4K7ZA 4Z44A 2OT4A 1KNPA 2XVJA 3LADA 4Q5BA 2RGHA 3DK4A 4UDQA 1HYUA 2PYXA 3BI4A 4TLZA 2X8GA 2ZO5A 5HYMA 2NPXA 1UKVG 1N4UA 2VZ2A 5C3JA 1BVBA 2PHHA 2Q7VA 4NTEA 4Z2UA 1GOSA 2XFOA 3L1TA 3UKLA 3B6DA 4IVOB 4LIIA 4WX1A 2YR4A 4XWZA 3VR8A 1GREA 1NHRA 1S2YA 4AT2A 5U1OA 2Q0KA 2XFQA 4B66A 5BUKA 3FO3A 1FCDA 2BYBA 2C3DA 3NK2X 1BGNA 1E6EA 1F3PA 1K0JA 4H50A 2XVHA 1QLBA 3S7WA 4U8IA 2E80A 3BNJA 3AE4A 1Z6LA 1ZK7A 2GMHA 4J2WA 4UDRA 2V3AA 5EOWA 3UBRA 2BCGG 3F8PA 3GDNA 4D04A 3OZ2A 1DOCA 5GSNA 1PBFA 2ZZBA 3CPJG 1VQWA 3L1RA 4AT0A 3SZFA 2XDOA 1BGJA 4N9XA 5TR3A 1RP0A 2R9ZA 5L46A 3NNEA 3UKQA 2JB1A 3P9UA 5U25A 3HYXA 4AOXA 4IVMB 2GEWA 2H89A 2VOUA 3NIXA 4KPRA 5JCLA 2R45A 3AE1A 4GR1A 4OPCA 1V59A 4IV9A 4TLXA 4EQSA 4A9WA 1KF6A 1H7WA 2GB0A 2A89A 1CL0A 1JRZA 1CHUA 1FT6A 1KNRA 4II2A 2JBVA 2V6OA 3ICSA 4B67A 4H4XA 1M1QA 2WETA 2Y6QA 4I58A 4BURA 4GRTA 3NH3X 4ZN0A 4H4PA 5JCKA 4APNA 2C7GA 1Y56A 4CCQA 3CGCA 2C76A 1GPEA 4O5UA 1RSGA 1CC4A 5JCIA 1E7PA 2R0CA 2XCGA 2VQBA 3BNUA 3C4AA 2OLNA 4U8LA 1L0VA 3P1WA 3SFDA 2YVFA 4BK2A 3UKHA 3RKHA 1K0LA 3BNFA 4H4TA 2GV8A 2FBWA 2GR2A 1GRGA 2CULA 5KMSA 3C4NA 3MMOA 3QSMA 3FBSA 1TDKA 4NTCA 2XLTA 3RHAA 4H2NA 3GWDA 2BC0A 4RG4A 3V76A 4OPUA 4YXDA 1MO9A 3T31A 1TDFA 5KMQA 1H6VA 3F8DA 4H4SA 5CQFA 1O94A 3AEBA 4B69A 4EM3A 3AXBA 2A87A 1PJ7A 3AEFA 4GCMA 3SX6A 1NG3A 1LVLA 3CNTA 1QJDA 1PJ6A 3DGZA 3G5QA 1YQ4A 1B8SA 1S3EA 1EBDA 2Q0LA 3C96A 3CMMA 3NRNA 2YVGA 5EBKA 1NHQA 2WOIA 3D8XA 2XLUA 4OPTA 4YTNA 2QAEA 4NEVA 3OWMA 2FJAA 4L38A 1FOHA 1GTHA 3ADAB 1GTEA 1MOKA 2NVKX 3CNJA 2XFNA 2E5VA 4FX9A 1L9DA 3V3NA 2BXSA 2E4GA 3AEGA 1SEZA 1ELIA 3GYIA 2FJEA 3CGEA 2RGOA 4K8DA 1H7XA 3SYIA 4A65A 5KOXA 3OC4A 1F8WA 1KSSA 1GRHA 1PHHA 1CF3A 2EQ8A 1FT5A 4XXGA 2RDZA 3ICRA 3IHGA 3P4QA 3AE2A 4Q1OA 3JSKA 2E81A 1COYA 4WJYA 1H81A 1CJ4A 5M0ZA 1DXLA 2C72A 3SZCA 4C74A 2JKCA 1ZX9A 1F8RA 3GMCA 4KX6A 4YT0A 4A99A 4X4JA 4NNJA 2Q6UA 1K0IA 4G6HA 4GAPA 4BV6A 1D4CA 1QO8A 3SQPA 1DJQA 1EL9A 3DA1A 3GDPA 1GESA 4HB9A 4K22A 2BK4A 4OCGA 1EL5A 3V3OA 4FK1A 3K30A 3T2KA 1H84A 1REOA 1TYPA 3KVEA 3SY4A 4OVIA 4E0VA 1Q9IA 4U8KA 1N4WA 2BCPA 5C2TA 1CJ2A 3HZLA 2B76A 3ICTA 1FEAA 4J34A 3CTYA 1CBOA 4Q4UA 4ECHA 2IIDA 1DNCA 1P2EA 2GR1A 2XFPA 1M1RA 3CNPA 3LZWA 1EL7A 3DJDA 2EQ6A 4GUVA 4UDPA 1JNZA 3E1TA 4ZCDA 5HHFA 3VRDB 1FECA 1GRBA 1D4DA 1KFYA 2YM2A 4B68A 5KOWA 3T14A 2JB3A 2X3NA 5FS9A 2IVEA 4Z26A 1IUVA 2YM1A 4K5SA 3T0KA 3CNSA 4PAAA 3DJEA 3GD3A 3FMWA 2XLPA 4YTMA 3I6DA 4L3YA 4YSZA 4NTDA 1S3BA 4TM4A 2VVLG 1VDCA 4Z24A 3TTBA 3P4SA 4H4VA 2JK6A 4Q5CA 2YLSA 2C64A 1D7LA 4GDPA 1D7YA 2ZZCA 3K7MX 3UKFA 1TRBA 3GRSA 4A6NB 1GU6A 3GSIA 1NPXA 3ISHA 3F8RA 2WPEA 4K2XA 4CNJA 5HXIA 2VRMA 2V61A 2YG6A 3FG2P 4CRTA 1JEHA 4D03A 3S5WA 1GV4A 1M6IA 2WBAA 2WPCA 2J3NA 3UTEA 3R9UA 2B9WA 1O95A 3HYVA 1D4EA 2C65A 3BHKA 4H4RA 2GAGB 2VVLA 2QA1A 3IC9A 3EPTA 1P2HA 5KMPA 2EQ9A 3KKJA 4HA6A 1CC6A 1OJTA 2X99A 1IUTA 5CKUA 2W0HA 4A6NA 4YTPA 3T37A 1TDNA 4EIQA 3REDA 3ZDNA 2R0GA 2BRAA 4LU6A 5FS8A 5JCNA 2VR0A 3ALMA 3SXIA 3LOVA 4DSHA 4U8NA 2O9ZA 3H8LA 2GVCA 2V3BA 5ER0A 4J33A 3LGQA 2GR3A 2TPRA 4USRA 3D1IA 1JRXA 2CVJA 1H82A 2WPFA 4WCTA 1GT8A 1MXTA 4H4WA 2HQMA 4G9KA 2WDQA 1DODA 1XPQA 4C3XA 2WQYA 2B7RA 3D1CA 3IF9A 4JY2A 3AE8A 3TORA 4AP1A 2OA1A 4YKFA 4CNKA 1OAHA 2J7AA 2GH5A 1PXCA 3HYWA 4H4UA 4MJWA 2ARDA 2X50A 1GNDA 4RG3A 4Y4MA 3DK8A 2XVIA 2GQFA 3UTHA 4A7AA 4Z2TA 5KRQA 1PXBA 1BZLA 3BNHA 3NG7X 3NYFA 5IQ4A 5KMRA 3H8IA 3QVPA 3FPZA 3CN8A 4G6GA 4BJYA 1L9CA 4Q17A 3NN6X 1YKJA 2YG3A 2B9XA 4A79A 2YLRA 1S2QA 1E1LA 4REKA 3G5SA 2ACZA 4JY3A 3QJ4A 3GMBA 1B37A 4DSGA 2AR8A 3WE0A
chains in the Genus database with same CATH topology
3RNMA 3DH9A 1SP3A 1Q1RA 1BWCA 1YY5A 4J31A 2YQUA 2V60A 2V5ZA 4AP3A 3GRTA 4NEWA 1JNRA 2YR6A 3AWIA 4I59A 4RSLA 5J7XA 4B64A 1GERA 2R0PA 4EIPA 5IPYA 4H4ZA 3NGCX 2BA9A 4U8JA 2YWLA 2Z5XA 3GM6A 2JAEA 2BS4A 2F5ZA 2GAHB 2C66A 4P9SA 4NZHA 4TM1A 4Y4NA 5EB5A 1LTXR 1L9EA 3UP5A 3DJGX 1YQZA 4U2SA 3ITJA 1TYTA 3NTDA 3AECA 3KPFA 4JNAA 5J60A 5FS7A 1QDBA 3LZXA 4H4YA 4YKGA 1ZP0A 1XHCA 2GMJA 2BC1A 2ZZ0A 5LV9A 2WP6A 5DBJA 3RP6A 2UZZA 3DGHA 1E1NA 5U63A 4ADWA 4A5LA 3CPHG 3NLCA 1JNIA 4GDEA 2BS2A 2CFYA 3SFEA 4FDCB 4JQ9A 3NN0X 4Z25A 4H7UA 4NWZA 1M64A 1M1PA 4U8PA 5KWFA 4C3YA 4OPGA 1LQUA 3F29A 5KVHA 1PBBA 3M0OA 3Q6JA 3PO7A 1DOEA 4J56A 4DGKA 3IHMA 4EQRA 1IUUA 4EMJA 4CCRA 3GWFA 1PXAA 1ZOYA 2BS3A 1F8SA 3KU9A 4M52A 1W4XA 5KVIA 1CC2A 1CJ3A 1E1MA 1Q1WA 1PJ5A 1ZMCA 1VG0A 2AAQA 1ZMDA 2H88A 1FS7A 2I0ZA 1Y0PA 2R4EA 3O0HA 2XVEA 3RP8A 2B7SA 3G5RA 1PS9A 4B65A 1TDOA 2WEUA 4EQXA 3P4PA 1DJNA 1GRTA 2RF7A 1DOBA 2BK3A 3NHOX 4LA1A 4XWRA 3SZ0A 3UKKA 4OPLA 4O5QA 1ZY8A 2YG4A 5BULA 4CBQA 2YLWA 3CGDA 3AD7B 4TM3A 1OJ9A 1GETA 3NT6A 1IUXA 4G73A 1CJCA 3P4RA 4H2RA 5FMHA 3UOVA 1GRFA 3AB1A 4IA6A 3UOXA 2YVJA 3LJPA 2RGJA 2K3VA 1E39A 1RYIA 3KA7A 2VRLA 1JRYA 4H4QA 2A8XA 1XDIA 4EMIA 2WDVA 4L3XA 1E1KA 2YG7A 1N1PA 4GF7A 1OJDA 4EMWA 5KNLA 2YLXA 1BKWA 3ABVA 3ALLA 1LQTA 4ZCCA 1NHPA 1LV0A 1OJCA 1B4VA 1FEBA 1BF3A 4GAVA 1PN0A 1JU2A 2C3CA 3URHA 2C75A 5HY5A 1F6MA 3II4A 1Y56B 2E1MA 3I3LA 5IQ1A 4AOSA 2C70A 3DMEA 3NTAA 3UU9A 4II3A 3AE9A 3CNDA 3COXA 2BACA 2CDUA 2FJBA 3AEEA 1GXFA 2YLTA 4IA5A 2GQWA 4USQA 2FJDA 2C67A 2R4JA 4OPIA 2QCUA 2GRTA 3SGLA 2VVMA 3GD4A 3KLJA 4UP3A 3UTGA 4Z43A 3AYIA 2RABA 3BI2A 3B3RA 3ATQA 2DKIA 3CIRA 2WOVA 1IUWA 2TMDA 4B63A 4J36A 2YAUA 2B9YA 3AD9B 3AEAA 4U2TA 4Y4LA 1KSUA 3LG1A 3NYCA 4YSYA 1FS9A 4FK1C 3QSSA 5EB4A 2Y6RA 3Q9TA 2XLRA 3UCLA 3BHFA 3ALJA 3NKSA 2C4CA 1LPFA 5GRTA 1ZDLA 4X9MA 3UP4A 3NK0X 1ONFA 4PABA 3AE5A 3UTFA 4BK1A 3L8KA 1ZKQA 3GYJA 1VRQB 1EL8A 3BNGA 4BJZA 1GSNA 2VQ7A 4YSXA 2ZBWA 3VRAA 5JCMA 3QFAA 1AOGA 1XANA 3QVRA 4H2QA 3UKPA 3SZWA 1LJ1A 2BXRA 2DKHA 3NYEA 3SCEA 3NK1X 4JNQA 4YWOA 3RP7A 2OAMA 3KD9A 2BABA 1FS8A 3IWAA 4X9NA 2LFCA 5BVAA 3KPKA 2YG5A 2WP5A 1PBEA 4G74A 1NEKA 2R46A 3DK9A 1H83A 1H86A 2WOWA 3BNMA 2X8CA 4CY6A 4EQWA 2WU2A 4U8OA 2WS3A 1X31B 2BRYA 3PVCA 1O5WA 3SM8A 3VQRA 2AQJA 4YSHA 1FL2A 3ATRA 3VRBA 4BK3A 3LXDA 1JOAA 3AE3A 2X8HA 3M12A 1D5TA 1NDAA 2Z5YA 2XYOA 3EF6A 3QFBA 3CPIG 3K7QX 3ZYXA 3T2YA 2XLSA 1NAAA 3AEDA 2GF3A 3AD8B 3AYLA 3EANA 4H2PA 3UOZA 3H4KA 2XFUA 1PBCA 2WU5A 4B1BA 4JDRA 4CY8A 1NENA 2WHDA 2BK5A 3UKAA 4OPDA 2C73A 3UOYA 2APGA 4Q0TA 4U2LA 2OLOA 1NHSA 1IJHA 1KDGA 5FS6A 4EM4A 3AE6A 1TDEA 2YR5A 2IVDA 4JN9A 1K4QA 2WP9A 4U8MA 3PS9A 5KXJA 2JB2A 3FIMB 3BI5A 2WDRA 1N4VA 1PBDA 3K7TA 4K5RA 4L3ZA 1GALA 3T2ZA 3VR9A 3SXQA 2GR0A 4C77A 3LB8A 2XVFA 1B5QA 4Z2RA 1GRAA 1VG9A 2YLZA 2QA2A 4ICYA 4C5OA 3AYJA 3GYXA 1OJAA 3AE7A 3M13A 1GEUA 1IUSA 1ZOVA 4TM0A 3S61A 2WESA 1PDHA 1NG4A 4J57A 3QSEA 4DNAA 3DJJA 1YQ3A 5M10A 2OALA 3EAOA 2EQ7A 3CGBA 5BRTA 4K7ZA 4Z44A 2OT4A 1KNPA 2XVJA 3LADA 4Q5BA 2RGHA 3DK4A 4UDQA 1HYUA 2PYXA 3BI4A 4TLZA 2X8GA 2ZO5A 5HYMA 2NPXA 1UKVG 1N4UA 2VZ2A 5C3JA 1BVBA 2PHHA 2Q7VA 4NTEA 4Z2UA 1GOSA 2XFOA 3L1TA 3UKLA 3B6DA 4IVOB 4LIIA 4WX1A 2YR4A 4XWZA 3VR8A 1GREA 1NHRA 1S2YA 4AT2A 5U1OA 2Q0KA 2XFQA 4B66A 5BUKA 3FO3A 1FCDA 2BYBA 2C3DA 3NK2X 1BGNA 1E6EA 1F3PA 1K0JA 4H50A 2XVHA 1QLBA 3S7WA 4U8IA 2E80A 3BNJA 3AE4A 1Z6LA 1ZK7A 2GMHA 4J2WA 4UDRA 2V3AA 5EOWA 3UBRA 2BCGG 3F8PA 3GDNA 4D04A 3OZ2A 1DOCA 5GSNA 1PBFA 2ZZBA 3CPJG 1VQWA 3L1RA 4AT0A 3SZFA 2XDOA 1BGJA 4N9XA 5TR3A 1RP0A 2R9ZA 5L46A 3NNEA 3UKQA 2JB1A 3P9UA 5U25A 3HYXA 4AOXA 4IVMB 2GEWA 2H89A 2VOUA 3NIXA 4KPRA 5JCLA 2R45A 3AE1A 4GR1A 4OPCA 1V59A 4IV9A 4TLXA 4EQSA 4A9WA 1KF6A 1H7WA 2GB0A 2A89A 1CL0A 1JRZA 1CHUA 1FT6A 1KNRA 4II2A 2JBVA 2V6OA 3ICSA 4B67A 4H4XA 1M1QA 2WETA 2Y6QA 4I58A 4BURA 4GRTA 3NH3X 4ZN0A 4H4PA 5JCKA 4APNA 2C7GA 1Y56A 4CCQA 3CGCA 2C76A 1GPEA 4O5UA 1RSGA 1CC4A 5JCIA 1E7PA 2R0CA 2XCGA 2VQBA 3BNUA 3C4AA 2OLNA 4U8LA 1L0VA 3P1WA 3SFDA 2YVFA 4BK2A 3UKHA 3RKHA 1K0LA 3BNFA 4H4TA 2GV8A 2FBWA 2GR2A 1GRGA 2CULA 5KMSA 3C4NA 3MMOA 3QSMA 3FBSA 1TDKA 4NTCA 2XLTA 3RHAA 4H2NA 3GWDA 2BC0A 4RG4A 3V76A 4OPUA 4YXDA 1MO9A 3T31A 1TDFA 5KMQA 1H6VA 3F8DA 4H4SA 5CQFA 1O94A 3AEBA 4B69A 4EM3A 3AXBA 2A87A 1PJ7A 3AEFA 4GCMA 3SX6A 1NG3A 1LVLA 3CNTA 1QJDA 1PJ6A 3DGZA 3G5QA 1YQ4A 1B8SA 1S3EA 1EBDA 2Q0LA 3C96A 3CMMA 3NRNA 2YVGA 5EBKA 1NHQA 2WOIA 3D8XA 2XLUA 4OPTA 4YTNA 2QAEA 4NEVA 3OWMA 2FJAA 4L38A 1FOHA 1GTHA 3ADAB 1GTEA 1MOKA 2NVKX 3CNJA 2XFNA 2E5VA 4FX9A 1L9DA 3V3NA 2BXSA 2E4GA 3AEGA 1SEZA 1ELIA 3GYIA 2FJEA 3CGEA 2RGOA 4K8DA 1H7XA 3SYIA 4A65A 5KOXA 3OC4A 1F8WA 1KSSA 1GRHA 1PHHA 1CF3A 2EQ8A 1FT5A 4XXGA 2RDZA 3ICRA 3IHGA 3P4QA 3AE2A 4Q1OA 3JSKA 2E81A 1COYA 4WJYA 1H81A 1CJ4A 5M0ZA 1DXLA 2C72A 3SZCA 4C74A 2JKCA 1ZX9A 1F8RA 3GMCA 4KX6A 4YT0A 4A99A 4X4JA 4NNJA 2Q6UA 1K0IA 4G6HA 4GAPA 4BV6A 1D4CA 1QO8A 3SQPA 1DJQA 1EL9A 3DA1A 3GDPA 1GESA 4HB9A 4K22A 2BK4A 4OCGA 1EL5A 3V3OA 4FK1A 3K30A 3T2KA 1H84A 1REOA 1TYPA 3KVEA 3SY4A 4OVIA 4E0VA 1Q9IA 4U8KA 1N4WA 2BCPA 5C2TA 1CJ2A 3HZLA 2B76A 3ICTA 1FEAA 4J34A 3CTYA 1CBOA 4Q4UA 4ECHA 2IIDA 1DNCA 1P2EA 2GR1A 2XFPA 1M1RA 3CNPA 3LZWA 1EL7A 3DJDA 2EQ6A 4GUVA 4UDPA 1JNZA 3E1TA 4ZCDA 5HHFA 3VRDB 1FECA 1GRBA 1D4DA 1KFYA 2YM2A 4B68A 5KOWA 3T14A 2JB3A 2X3NA 5FS9A 2IVEA 4Z26A 1IUVA 2YM1A 4K5SA 3T0KA 3CNSA 4PAAA 3DJEA 3GD3A 3FMWA 2XLPA 4YTMA 3I6DA 4L3YA 4YSZA 4NTDA 1S3BA 4TM4A 2VVLG 1VDCA 4Z24A 3TTBA 3P4SA 4H4VA 2JK6A 4Q5CA 2YLSA 2C64A 1D7LA 4GDPA 1D7YA 2ZZCA 3K7MX 3UKFA 1TRBA 3GRSA 4A6NB 1GU6A 3GSIA 1NPXA 3ISHA 3F8RA 2WPEA 4K2XA 4CNJA 5HXIA 2VRMA 2V61A 2YG6A 3FG2P 4CRTA 1JEHA 4D03A 3S5WA 1GV4A 1M6IA 2WBAA 2WPCA 2J3NA 3UTEA 3R9UA 2B9WA 1O95A 3HYVA 1D4EA 2C65A 3BHKA 4H4RA 2GAGB 2VVLA 2QA1A 3IC9A 3EPTA 1P2HA 5KMPA 2EQ9A 3KKJA 4HA6A 1CC6A 1OJTA 2X99A 1IUTA 5CKUA 2W0HA 4A6NA 4YTPA 3T37A 1TDNA 4EIQA 3REDA 3ZDNA 2R0GA 2BRAA 4LU6A 5FS8A 5JCNA 2VR0A 3ALMA 3SXIA 3LOVA 4DSHA 4U8NA 2O9ZA 3H8LA 2GVCA 2V3BA 5ER0A 4J33A 3LGQA 2GR3A 2TPRA 4USRA 3D1IA 1JRXA 2CVJA 1H82A 2WPFA 4WCTA 1GT8A 1MXTA 4H4WA 2HQMA 4G9KA 2WDQA 1DODA 1XPQA 4C3XA 2WQYA 2B7RA 3D1CA 3IF9A 4JY2A 3AE8A 3TORA 4AP1A 2OA1A 4YKFA 4CNKA 1OAHA 2J7AA 2GH5A 1PXCA 3HYWA 4H4UA 4MJWA 2ARDA 2X50A 1GNDA 4RG3A 4Y4MA 3DK8A 2XVIA 2GQFA 3UTHA 4A7AA 4Z2TA 5KRQA 1PXBA 1BZLA 3BNHA 3NG7X 3NYFA 5IQ4A 5KMRA 3H8IA 3QVPA 3FPZA 3CN8A 4G6GA 4BJYA 1L9CA 4Q17A 3NN6X 1YKJA 2YG3A 2B9XA 4A79A 2YLRA 1S2QA 1E1LA 4REKA 3G5SA 2ACZA 4JY3A 3QJ4A 3GMBA 1B37A 4DSGA 2AR8A 3WE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNM A;  3DH9 A;  1SP3 A;  1Q1R A;  1BWC A;  1YY5 A;  4J31 A;  2YQU A;  2V60 A;  2V5Z A;  4AP3 A;  3GRT A;  4NEW A;  1JNR A;  2YR6 A;  3AWI A;  4I59 A;  4RSL A;  5J7X A;  4B64 A;  1GER A;  2R0P A;  4EIP A;  5IPY A;  4H4Z A;  3NGC X;  2BA9 A;  4U8J A;  2YWL A;  2Z5X A;  3GM6 A;  2JAE A;  2BS4 A;  2F5Z A;  2GAH B;  2C66 A;  4P9S A;  4NZH A;  4TM1 A;  4Y4N A;  5EB5 A;  1LTX R;  1L9E A;  3UP5 A;  3DJG X;  1YQZ A;  4U2S A;  3ITJ A;  1TYT A;  3NTD A;  3AEC A;  3KPF A;  4JNA A;  5J60 A;  5FS7 A;  1QDB A;  3LZX A;  4H4Y A;  4YKG A;  1ZP0 A;  1XHC A;  2GMJ A;  2BC1 A;  2ZZ0 A;  5LV9 A;  2WP6 A;  5DBJ A;  3RP6 A;  2UZZ A;  3DGH A;  1E1N A;  5U63 A;  4ADW A;  4A5L A;  3CPH G;  3NLC A;  1JNI A;  4GDE A;  2BS2 A;  2CFY A;  3SFE A;  4FDC B;  4JQ9 A;  3NN0 X;  4Z25 A;  4H7U A;  1M64 A;  1M1P A;  4U8P A;  5KWF A;  4C3Y A;  4OPG A;  1LQU A;  3F29 A;  5KVH A;  1PBB A;  3M0O A;  3Q6J A;  3PO7 A;  1DOE A;  4J56 A;  4DGK A;  3IHM A;  4EQR A;  1IUU A;  4EMJ A;  4CCR A;  3GWF A;  1PXA A;  1ZOY A;  2BS3 A;  1F8S A;  3KU9 A;  4M52 A;  1W4X A;  5KVI A;  1CC2 A;  1CJ3 A;  1E1M A;  1Q1W A;  1PJ5 A;  1ZMC A;  1VG0 A;  2AAQ A;  1ZMD A;  2H88 A;  1FS7 A;  2I0Z A;  1Y0P A;  2R4E A;  3O0H A;  2XVE A;  3RP8 A;  2B7S A;  3G5R A;  1PS9 A;  4B65 A;  1TDO A;  2WEU A;  4EQX A;  3P4P A;  1DJN A;  1GRT A;  2RF7 A;  1DOB A;  2BK3 A;  3NHO X;  4LA1 A;  4XWR A;  5BUL A;  3UKK A;  4OPL A;  4O5Q A;  1ZY8 A;  2YG4 A;  4CBQ A;  2YLW A;  3CGD A;  3AD7 B;  4TM3 A;  1OJ9 A;  1GET A;  3NT6 A;  1IUX A;  1CJC A;  3P4R A;  4H2R A;  3UOV A;  1GRF A;  3AB1 A;  4IA6 A;  3UOX A;  2YVJ A;  3LJP A;  2RGJ A;  2K3V A;  1E39 A;  1RYI A;  3KA7 A;  2VRL A;  1JRY A;  4H4Q A;  2A8X A;  1XDI A;  4EMI A;  2WDV A;  4L3X A;  1E1K A;  2YG7 A;  1N1P A;  4GF7 A;  1OJD A;  4EMW A;  2YLX A;  1BKW A;  3ABV A;  3ALL A;  1LQT A;  4ZCC A;  1NHP A;  1LV0 A;  1OJC A;  1B4V A;  1FEB A;  1BF3 A;  1PN0 A;  1JU2 A;  2C3C A;  3URH A;  2C75 A;  5HY5 A;  1F6M A;  3II4 A;  1Y56 B;  2E1M A;  3I3L A;  5IQ1 A;  4AOS A;  2C70 A;  3DME A;  3NTA A;  3UU9 A;  3AE9 A;  3CND A;  3COX A;  2BAC A;  2CDU A;  2FJB A;  3AEE A;  1GXF A;  2YLT A;  4IA5 A;  2GQW A;  4USQ A;  2FJD A;  2C67 A;  2R4J A;  4OPI A;  2QCU A;  2GRT A;  3SGL A;  2VVM A;  3GD4 A;  3KLJ A;  4UP3 A;  3UTG A;  4Z43 A;  3AYI A;  2RAB A;  3BI2 A;  3B3R A;  3ATQ A;  2DKI A;  3CIR A;  2WOV A;  1IUW A;  2TMD A;  4B63 A;  4J36 A;  2YAU A;  2B9Y A;  3AD9 B;  3AEA A;  4U2T A;  4Y4L A;  1KSU A;  3LG1 A;  3NYC A;  4YSY A;  1FS9 A;  4FK1 C;  3QSS A;  5EB4 A;  2Y6R A;  3Q9T A;  2XLR A;  3UCL A;  3BHF A;  3ALJ A;  3NKS A;  1LPF A;  5GRT A;  1ZDL A;  4X9M A;  3UP4 A;  3NK0 X;  1ONF A;  4PAB A;  3AE5 A;  3UTF A;  4BK1 A;  3L8K A;  1ZKQ A;  3GYJ A;  1VRQ B;  1EL8 A;  3BNG A;  4BJZ A;  1GSN A;  2VQ7 A;  4YSX A;  2ZBW A;  3VRA A;  5JCM A;  3QFA A;  1AOG A;  1XAN A;  3QVR A;  4H2Q A;  3UKP A;  1LJ1 A;  2BXR A;  2DKH A;  3NYE A;  3SCE A;  3NK1 X;  4JNQ A;  4YWO A;  3RP7 A;  2OAM A;  3KD9 A;  2BAB A;  1FS8 A;  3IWA A;  4X9N A;  2LFC A;  5BVA A;  2YG5 A;  2WP5 A;  1PBE A;  1NEK A;  2R46 A;  3DK9 A;  1H83 A;  1H86 A;  2WOW A;  3BNM A;  2X8C A;  4CY6 A;  4EQW A;  2WU2 A;  4U8O A;  2WS3 A;  1X31 B;  3PVC A;  1O5W A;  3SM8 A;  3VQR A;  2AQJ A;  4YSH A;  1FL2 A;  3ATR A;  3VRB A;  4BK3 A;  3LXD A;  1JOA A;  3AE3 A;  2X8H A;  3M12 A;  1D5T A;  1NDA A;  2Z5Y A;  2XYO A;  3EF6 A;  3QFB A;  3CPI G;  3K7Q X;  3ZYX A;  2XLS A;  1NAA A;  3AED A;  2GF3 A;  3AD8 B;  3AYL A;  3EAN A;  4H2P A;  3UOZ A;  3H4K A;  2XFU A;  1PBC A;  2WU5 A;  4B1B A;  4JDR A;  4CY8 A;  1NEN A;  2WHD A;  2BK5 A;  3UKA A;  4OPD A;  2C73 A;  3UOY A;  2APG A;  4Q0T A;  4U2L A;  2OLO A;  1NHS A;  1IJH A;  1KDG A;  5FS6 A;  4EM4 A;  3AE6 A;  1TDE A;  2YR5 A;  2IVD A;  4JN9 A;  1K4Q A;  2WP9 A;  4U8M A;  3PS9 A;  5KXJ A;  2JB2 A;  3FIM B;  3BI5 A;  2WDR A;  1N4V A;  1PBD A;  3K7T A;  4K5R A;  4L3Z A;  1GAL A;  3VR9 A;  3SXQ A;  2GR0 A;  4C77 A;  3LB8 A;  2XVF A;  1B5Q A;  4Z2R A;  1GRA A;  1VG9 A;  2YLZ A;  2QA2 A;  4ICY A;  4C5O A;  3AYJ A;  3M13 A;  1OJA A;  3AE7 A;  4CNJ A;  1GEU A;  1IUS A;  1ZOV A;  4TM0 A;  3S61 A;  2WES A;  1PDH A;  1NG4 A;  4J57 A;  3QSE A;  4DNA A;  3DJJ A;  1YQ3 A;  5M10 A;  2OAL A;  3EAO A;  2EQ7 A;  3CGB A;  5BRT A;  4K7Z A;  4Z44 A;  2OT4 A;  1KNP A;  2XVJ A;  3LAD A;  4Q5B A;  2RGH A;  3DK4 A;  4UDQ A;  1HYU A;  2PYX A;  3BI4 A;  4TLZ A;  2X8G A;  2ZO5 A;  5HYM A;  2NPX A;  1UKV G;  1N4U A;  2VZ2 A;  5C3J A;  1BVB A;  2PHH A;  2Q7V A;  4NTE A;  4Z2U A;  1GOS A;  2XFO A;  3L1T A;  3UKL A;  3B6D A;  4IVO B;  4LII A;  4WX1 A;  2YR4 A;  4XWZ A;  3VR8 A;  1GRE A;  1NHR A;  1S2Y A;  4AT2 A;  5U1O A;  2Q0K A;  2XFQ A;  4B66 A;  5BUK A;  3FO3 A;  1FCD A;  2BYB A;  2C3D A;  3NK2 X;  1BGN A;  1E6E A;  1F3P A;  1K0J A;  4H50 A;  2XVH A;  1QLB A;  3S7W A;  4U8I A;  2E80 A;  3BNJ A;  3AE4 A;  1Z6L A;  1ZK7 A;  2GMH A;  4J2W A;  4UDR A;  2V3A A;  5EOW A;  3UBR A;  2BCG G;  3F8P A;  3GDN A;  4D04 A;  3OZ2 A;  1DOC A;  5GSN A;  1PBF A;  2ZZB A;  3CPJ G;  1VQW A;  3L1R A;  4AT0 A;  2XDO A;  1BGJ A;  4N9X A;  5TR3 A;  1RP0 A;  2R9Z A;  5L46 A;  3NNE A;  3UKQ A;  2JB1 A;  3P9U A;  5U25 A;  4AOX A;  4IVM B;  2GEW A;  2H89 A;  2VOU A;  3NIX A;  4KPR A;  5JCL A;  2R45 A;  3AE1 A;  4GR1 A;  4OPC A;  1V59 A;  4IV9 A;  4TLX A;  4EQS A;  4A9W A;  1KF6 A;  1H7W A;  2GB0 A;  2A89 A;  1CL0 A;  1JRZ A;  1CHU A;  1FT6 A;  1KNR A;  2JBV A;  2V6O A;  3ICS A;  4B67 A;  4H4X A;  1M1Q A;  2WET A;  2Y6Q A;  4I58 A;  4BUR A;  4GRT A;  3NH3 X;  4ZN0 A;  4H4P A;  5JCK A;  4APN A;  2C7G A;  1Y56 A;  4CCQ A;  3CGC A;  2C76 A;  1GPE A;  4O5U A;  1RSG A;  1CC4 A;  5JCI A;  1E7P A;  2R0C A;  2XCG A;  2VQB A;  3BNU A;  3C4A A;  2OLN A;  4U8L A;  1L0V A;  3P1W A;  3SFD A;  2YVF A;  4BK2 A;  3UKH A;  3RKH A;  1K0L A;  3BNF A;  4H4T A;  2GV8 A;  2FBW A;  2GR2 A;  1GRG A;  2CUL A;  3C4N A;  3MMO A;  3QSM A;  3FBS A;  1TDK A;  4NTC A;  2XLT A;  3RHA A;  4H2N A;  3GWD A;  2BC0 A;  4RG4 A;  3V76 A;  4OPU A;  4YXD A;  1MO9 A;  1TDF A;  1H6V A;  3F8D A;  4H4S A;  5CQF A;  1O94 A;  3AEB A;  4B69 A;  4EM3 A;  3AXB A;  2A87 A;  1PJ7 A;  3AEF A;  4GCM A;  1NG3 A;  1LVL A;  3CNT A;  1QJD A;  1PJ6 A;  3DGZ A;  3G5Q A;  1YQ4 A;  1B8S A;  1S3E A;  1EBD A;  2Q0L A;  3C96 A;  3NRN A;  5FMH A;  2YVG A;  5EBK A;  1NHQ A;  2WOI A;  3D8X A;  2XLU A;  4OPT A;  4YTN A;  2QAE A;  4NEV A;  3OWM A;  2FJA A;  4L38 A;  1FOH A;  1GTH A;  3ADA B;  1GTE A;  1MOK A;  2NVK X;  3CNJ A;  2XFN A;  2E5V A;  4FX9 A;  1L9D A;  3V3N A;  2BXS A;  2E4G A;  3AEG A;  1SEZ A;  1ELI A;  3GYI A;  2FJE A;  3CGE A;  2RGO A;  4K8D A;  1H7X A;  4A65 A;  5KOX A;  3OC4 A;  1F8W A;  1KSS A;  1GRH A;  1PHH A;  1CF3 A;  2EQ8 A;  1FT5 A;  4XXG A;  2RDZ A;  3ICR A;  3IHG A;  3P4Q A;  3AE2 A;  4Q1O A;  3JSK A;  2E81 A;  1COY A;  4WJY A;  1H81 A;  1CJ4 A;  5M0Z A;  1DXL A;  2C72 A;  4C74 A;  2JKC A;  1ZX9 A;  1F8R A;  3GMC A;  4KX6 A;  4YT0 A;  4A99 A;  4X4J A;  2Q6U A;  1K0I A;  4BV6 A;  1D4C A;  1QO8 A;  3SQP A;  1DJQ A;  1EL9 A;  3DA1 A;  3GDP A;  1GES A;  4HB9 A;  4K22 A;  2BK4 A;  4OCG A;  1EL5 A;  3V3O A;  4FK1 A;  3K30 A;  1H84 A;  1REO A;  1TYP A;  3KVE A;  4E0V A;  4OVI A;  1Q9I A;  4U8K A;  1N4W A;  2BCP A;  5C2T A;  1CJ2 A;  3HZL A;  2B76 A;  3ICT A;  1FEA A;  4J34 A;  3CTY A;  1CBO A;  4Q4U A;  4ECH A;  2IID A;  3GYX A;  1DNC A;  1P2E A;  2GR1 A;  2XFP A;  1M1R A;  3CNP A;  3LZW A;  1EL7 A;  3DJD A;  2EQ6 A;  4GUV A;  4UDP A;  1JNZ A;  3E1T A;  4ZCD A;  5HHF A;  3VRD B;  1FEC A;  1GRB A;  1D4D A;  1KFY A;  2YM2 A;  4B68 A;  5KOW A;  2JB3 A;  2X3N A;  5FS9 A;  2IVE A;  4Z26 A;  1IUV A;  2YM1 A;  4K5S A;  3CNS A;  4PAA A;  3DJE A;  3GD3 A;  3FMW A;  2XLP A;  4YTM A;  3I6D A;  4L3Y A;  4YSZ A;  4NTD A;  1S3B A;  4TM4 A;  2VVL G;  1VDC A;  4Z24 A;  3TTB A;  3P4S A;  4H4V A;  2JK6 A;  4Q5C A;  2YLS A;  2C64 A;  1D7L A;  4GDP A;  1D7Y A;  2ZZC A;  3K7M X;  3UKF A;  1TRB A;  3GRS A;  4A6N B;  1GU6 A;  3GSI A;  1NPX A;  3ISH A;  3F8R A;  2WPE A;  4K2X A;  5HXI A;  2VRM A;  2V61 A;  2YG6 A;  3FG2 P;  4CRT A;  1JEH A;  4D03 A;  3S5W A;  1GV4 A;  1M6I A;  2WBA A;  2WPC A;  2J3N A;  3UTE A;  3R9U A;  2B9W A;  1O95 A;  1D4E A;  2C65 A;  3BHK A;  4H4R A;  2GAG B;  2VVL A;  2QA1 A;  3IC9 A;  3EPT A;  1P2H A;  2EQ9 A;  3KKJ A;  4HA6 A;  1CC6 A;  1OJT A;  2X99 A;  1IUT A;  5CKU A;  2W0H A;  4A6N A;  4YTP A;  3T37 A;  1TDN A;  4EIQ A;  3RED A;  3ZDN A;  2R0G A;  4LU6 A;  5FS8 A;  5JCN A;  2VR0 A;  3ALM A;  3LOV A;  4DSH A;  4U8N A;  2O9Z A;  3H8L A;  2GVC A;  2V3B A;  5ER0 A;  4J33 A;  3LGQ A;  2GR3 A;  2TPR A;  4USR A;  3D1I A;  1JRX A;  2CVJ A;  1H82 A;  2WPF A;  4WCT A;  1GT8 A;  1MXT A;  4H4W A;  2HQM A;  2WDQ A;  1DOD A;  1XPQ A;  4C3X A;  2WQY A;  2B7R A;  3D1C A;  3IF9 A;  4JY2 A;  3AE8 A;  3TOR A;  4AP1 A;  2OA1 A;  4YKF A;  4CNK A;  1OAH A;  2J7A A;  2GH5 A;  1PXC A;  4H4U A;  4MJW A;  2ARD A;  2X50 A;  1GND A;  4RG3 A;  4Y4M A;  3DK8 A;  2XVI A;  2GQF A;  3UTH A;  4A7A A;  4Z2T A;  5KRQ A;  1PXB A;  1BZL A;  3BNH A;  3NG7 X;  3NYF A;  5IQ4 A;  3H8I A;  3QVP A;  3FPZ A;  3CN8 A;  4BJY A;  1L9C A;  4Q17 A;  3NN6 X;  1YKJ A;  2YG3 A;  2B9X A;  4A79 A;  2YLR A;  1S2Q A;  1E1L A;  4REK A;  3G5S A;  2ACZ A;  4JY3 A;  3QJ4 A;  3GMB A;  1B37 A;  4DSG A;  2AR8 A;  3WE0 A; 
#chains in the Genus database with same CATH topology
 3RNM A;  3DH9 A;  1SP3 A;  1Q1R A;  1BWC A;  1YY5 A;  4J31 A;  2YQU A;  2V60 A;  2V5Z A;  4AP3 A;  3GRT A;  4NEW A;  1JNR A;  2YR6 A;  3AWI A;  4I59 A;  4RSL A;  5J7X A;  4B64 A;  1GER A;  2R0P A;  4EIP A;  5IPY A;  4H4Z A;  3NGC X;  2BA9 A;  4U8J A;  2YWL A;  2Z5X A;  3GM6 A;  2JAE A;  2BS4 A;  2F5Z A;  2GAH B;  2C66 A;  4P9S A;  4NZH A;  4TM1 A;  4Y4N A;  5EB5 A;  1LTX R;  1L9E A;  3UP5 A;  3DJG X;  1YQZ A;  4U2S A;  3ITJ A;  1TYT A;  3NTD A;  3AEC A;  3KPF A;  4JNA A;  5J60 A;  5FS7 A;  1QDB A;  3LZX A;  4H4Y A;  4YKG A;  1ZP0 A;  1XHC A;  2GMJ A;  2BC1 A;  2ZZ0 A;  5LV9 A;  2WP6 A;  5DBJ A;  3RP6 A;  2UZZ A;  3DGH A;  1E1N A;  5U63 A;  4ADW A;  4A5L A;  3CPH G;  3NLC A;  1JNI A;  4GDE A;  2BS2 A;  2CFY A;  3SFE A;  4FDC B;  4JQ9 A;  3NN0 X;  4Z25 A;  4H7U A;  4NWZ A;  1M64 A;  1M1P A;  4U8P A;  5KWF A;  4C3Y A;  4OPG A;  1LQU A;  3F29 A;  5KVH A;  1PBB A;  3M0O A;  3Q6J A;  3PO7 A;  1DOE A;  4J56 A;  4DGK A;  3IHM A;  4EQR A;  1IUU A;  4EMJ A;  4CCR A;  3GWF A;  1PXA A;  1ZOY A;  2BS3 A;  1F8S A;  3KU9 A;  4M52 A;  1W4X A;  5KVI A;  1CC2 A;  1CJ3 A;  1E1M A;  1Q1W A;  1PJ5 A;  1ZMC A;  1VG0 A;  2AAQ A;  1ZMD A;  2H88 A;  1FS7 A;  2I0Z A;  1Y0P A;  2R4E A;  3O0H A;  2XVE A;  3RP8 A;  2B7S A;  3G5R A;  1PS9 A;  4B65 A;  1TDO A;  2WEU A;  4EQX A;  3P4P A;  1DJN A;  1GRT A;  2RF7 A;  1DOB A;  2BK3 A;  3NHO X;  4LA1 A;  4XWR A;  3SZ0 A;  3UKK A;  4OPL A;  4O5Q A;  1ZY8 A;  2YG4 A;  5BUL A;  4CBQ A;  2YLW A;  3CGD A;  3AD7 B;  4TM3 A;  1OJ9 A;  1GET A;  3NT6 A;  1IUX A;  4G73 A;  1CJC A;  3P4R A;  4H2R A;  5FMH A;  3UOV A;  1GRF A;  3AB1 A;  4IA6 A;  3UOX A;  2YVJ A;  3LJP A;  2RGJ A;  2K3V A;  1E39 A;  1RYI A;  3KA7 A;  2VRL A;  1JRY A;  4H4Q A;  2A8X A;  1XDI A;  4EMI A;  2WDV A;  4L3X A;  1E1K A;  2YG7 A;  1N1P A;  4GF7 A;  1OJD A;  4EMW A;  5KNL A;  2YLX A;  1BKW A;  3ABV A;  3ALL A;  1LQT A;  4ZCC A;  1NHP A;  1LV0 A;  1OJC A;  1B4V A;  1FEB A;  1BF3 A;  4GAV A;  1PN0 A;  1JU2 A;  2C3C A;  3URH A;  2C75 A;  5HY5 A;  1F6M A;  3II4 A;  1Y56 B;  2E1M A;  3I3L A;  5IQ1 A;  4AOS A;  2C70 A;  3DME A;  3NTA A;  3UU9 A;  4II3 A;  3AE9 A;  3CND A;  3COX A;  2BAC A;  2CDU A;  2FJB A;  3AEE A;  1GXF A;  2YLT A;  4IA5 A;  2GQW A;  4USQ A;  2FJD A;  2C67 A;  2R4J A;  4OPI A;  2QCU A;  2GRT A;  3SGL A;  2VVM A;  3GD4 A;  3KLJ A;  2CZS A;  4UP3 A;  3UTG A;  4Z43 A;  3AYI A;  2RAB A;  3BI2 A;  3B3R A;  3ATQ A;  2DKI A;  3CIR A;  2WOV A;  1IUW A;  2TMD A;  4B63 A;  4J36 A;  2YAU A;  2B9Y A;  3AD9 B;  3AEA A;  4U2T A;  4Y4L A;  1KSU A;  3LG1 A;  3NYC A;  4YSY A;  1FS9 A;  4FK1 C;  3QSS A;  5EB4 A;  2Y6R A;  3Q9T A;  2XLR A;  3UCL A;  3BHF A;  3ALJ A;  3NKS A;  2C4C A;  1LPF A;  5GRT A;  1ZDL A;  4X9M A;  3UP4 A;  3NK0 X;  1ONF A;  4PAB A;  3AE5 A;  3UTF A;  4BK1 A;  3L8K A;  1ZKQ A;  3GYJ A;  1VRQ B;  1EL8 A;  3BNG A;  4BJZ A;  1GSN A;  2VQ7 A;  4YSX A;  2ZBW A;  3VRA A;  5JCM A;  3QFA A;  1AOG A;  1XAN A;  3QVR A;  4H2Q A;  3UKP A;  3SZW A;  1LJ1 A;  2BXR A;  2DKH A;  3NYE A;  3SCE A;  3NK1 X;  4JNQ A;  4YWO A;  3RP7 A;  2OAM A;  3KD9 A;  2BAB A;  1FS8 A;  3IWA A;  4X9N A;  2LFC A;  5BVA A;  3KPK A;  2YG5 A;  2WP5 A;  1PBE A;  4G74 A;  1NEK A;  2R46 A;  3DK9 A;  1H83 A;  1H86 A;  2WOW A;  3BNM A;  2X8C A;  4CY6 A;  4EQW A;  2WU2 A;  4U8O A;  2WS3 A;  1X31 B;  2BRY A;  3PVC A;  1O5W A;  3SM8 A;  3VQR A;  2AQJ A;  4YSH A;  1FL2 A;  3ATR A;  3VRB A;  4BK3 A;  3LXD A;  1JOA A;  3AE3 A;  2X8H A;  3M12 A;  1D5T A;  1NDA A;  2Z5Y A;  2XYO A;  3EF6 A;  3QFB A;  3CPI G;  3K7Q X;  3ZYX A;  3T2Y A;  2XLS A;  1NAA A;  3AED A;  2GF3 A;  3AD8 B;  3AYL A;  3EAN A;  4H2P A;  3UOZ A;  3H4K A;  2XFU A;  1PBC A;  2WU5 A;  4B1B A;  4JDR A;  4CY8 A;  1NEN A;  2WHD A;  2BK5 A;  3UKA A;  4OPD A;  2C73 A;  3UOY A;  2APG A;  4Q0T A;  4U2L A;  2OLO A;  1NHS A;  1IJH A;  1KDG A;  5FS6 A;  4EM4 A;  3AE6 A;  1TDE A;  2YR5 A;  2IVD A;  4JN9 A;  1K4Q A;  2WP9 A;  4U8M A;  3PS9 A;  5KXJ A;  2JB2 A;  3FIM B;  3BI5 A;  2WDR A;  1N4V A;  1PBD A;  3K7T A;  4K5R A;  4L3Z A;  1GAL A;  3T2Z A;  3VR9 A;  3SXQ A;  2GR0 A;  4C77 A;  3LB8 A;  2XVF A;  1B5Q A;  4Z2R A;  1GRA A;  1VG9 A;  2YLZ A;  2QA2 A;  4ICY A;  4C5O A;  3AYJ A;  3GYX A;  1OJA A;  3AE7 A;  3M13 A;  1GEU A;  1IUS A;  1ZOV A;  4TM0 A;  3S61 A;  2WES A;  1PDH A;  1NG4 A;  4J57 A;  3QSE A;  4DNA A;  3DJJ A;  1YQ3 A;  5M10 A;  2OAL A;  3EAO A;  2EQ7 A;  3CGB A;  5BRT A;  4K7Z A;  4Z44 A;  2OT4 A;  1KNP A;  2XVJ A;  3LAD A;  4Q5B A;  2RGH A;  3DK4 A;  4UDQ A;  1HYU A;  2PYX A;  3BI4 A;  4TLZ A;  2X8G A;  2ZO5 A;  5HYM A;  2NPX A;  1UKV G;  1N4U A;  2VZ2 A;  5C3J A;  1BVB A;  2PHH A;  2Q7V A;  4NTE A;  4Z2U A;  1GOS A;  2XFO A;  3L1T A;  3UKL A;  3B6D A;  4IVO B;  4LII A;  4WX1 A;  2YR4 A;  4XWZ A;  3VR8 A;  1GRE A;  1NHR A;  1S2Y A;  4AT2 A;  5U1O A;  2Q0K A;  2XFQ A;  4B66 A;  5BUK A;  3FO3 A;  1FCD A;  2BYB A;  2C3D A;  3NK2 X;  1BGN A;  1E6E A;  1F3P A;  1K0J A;  4H50 A;  2XVH A;  1QLB A;  3S7W A;  4U8I A;  2E80 A;  3BNJ A;  3AE4 A;  1Z6L A;  1ZK7 A;  2GMH A;  4J2W A;  4UDR A;  2V3A A;  5EOW A;  3UBR A;  2BCG G;  3F8P A;  3GDN A;  4D04 A;  3OZ2 A;  1DOC A;  5GSN A;  1PBF A;  2ZZB A;  3CPJ G;  1VQW A;  3L1R A;  4AT0 A;  3SZF A;  2XDO A;  1BGJ A;  4N9X A;  5TR3 A;  1RP0 A;  2R9Z A;  5L46 A;  3NNE A;  3UKQ A;  2JB1 A;  3P9U A;  5U25 A;  3HYX A;  4AOX A;  4IVM B;  2GEW A;  2H89 A;  2VOU A;  3NIX A;  4KPR A;  5JCL A;  2R45 A;  3AE1 A;  4GR1 A;  4OPC A;  1V59 A;  4IV9 A;  4TLX A;  4EQS A;  4A9W A;  1KF6 A;  1H7W A;  2GB0 A;  2A89 A;  1CL0 A;  1JRZ A;  1CHU A;  1FT6 A;  1KNR A;  4II2 A;  2JBV A;  2V6O A;  3ICS A;  4B67 A;  4H4X A;  1M1Q A;  2WET A;  2Y6Q A;  4I58 A;  4BUR A;  4GRT A;  3NH3 X;  4ZN0 A;  4H4P A;  5JCK A;  4APN A;  2C7G A;  1Y56 A;  4CCQ A;  3CGC A;  2C76 A;  1GPE A;  4O5U A;  1RSG A;  1CC4 A;  5JCI A;  1E7P A;  2R0C A;  2XCG A;  2VQB A;  3BNU A;  3C4A A;  2OLN A;  4U8L A;  1L0V A;  3P1W A;  3SFD A;  2YVF A;  4BK2 A;  3UKH A;  3RKH A;  1K0L A;  3BNF A;  4H4T A;  2GV8 A;  2FBW A;  2GR2 A;  1GRG A;  2CUL A;  5KMS A;  3C4N A;  3MMO A;  3QSM A;  3FBS A;  1TDK A;  4NTC A;  2XLT A;  3RHA A;  4H2N A;  3GWD A;  2BC0 A;  4RG4 A;  3V76 A;  4OPU A;  4YXD A;  1MO9 A;  3T31 A;  1TDF A;  5KMQ A;  1H6V A;  3F8D A;  4H4S A;  5CQF A;  1O94 A;  3AEB A;  4B69 A;  4EM3 A;  3AXB A;  2A87 A;  1PJ7 A;  3AEF A;  4GCM A;  3SX6 A;  1NG3 A;  1LVL A;  3CNT A;  1QJD A;  1PJ6 A;  3DGZ A;  3G5Q A;  1YQ4 A;  1B8S A;  1S3E A;  1EBD A;  2Q0L A;  3C96 A;  3CMM A;  3NRN A;  2YVG A;  5EBK A;  1NHQ A;  2WOI A;  3D8X A;  2XLU A;  4OPT A;  4YTN A;  2QAE A;  4NEV A;  3OWM A;  2FJA A;  4L38 A;  1FOH A;  1GTH A;  3ADA B;  1GTE A;  1MOK A;  2NVK X;  3CNJ A;  2XFN A;  2E5V A;  4FX9 A;  1L9D A;  3V3N A;  2BXS A;  2E4G A;  3AEG A;  1SEZ A;  1ELI A;  3GYI A;  2FJE A;  3CGE A;  2RGO A;  4K8D A;  1H7X A;  3SYI A;  4A65 A;  5KOX A;  3OC4 A;  1F8W A;  1KSS A;  1GRH A;  1PHH A;  1CF3 A;  2EQ8 A;  1FT5 A;  4XXG A;  2RDZ A;  3ICR A;  3IHG A;  3P4Q A;  3AE2 A;  4Q1O A;  3JSK A;  2E81 A;  1COY A;  4WJY A;  1H81 A;  1CJ4 A;  5M0Z A;  1DXL A;  2C72 A;  3SZC A;  4C74 A;  2JKC A;  1ZX9 A;  1F8R A;  3GMC A;  4KX6 A;  4YT0 A;  4A99 A;  4X4J A;  4NNJ A;  2Q6U A;  1K0I A;  4G6H A;  4GAP A;  4BV6 A;  1D4C A;  1QO8 A;  3SQP A;  1DJQ A;  1EL9 A;  3DA1 A;  3GDP A;  1GES A;  4HB9 A;  4K22 A;  2BK4 A;  4OCG A;  1EL5 A;  3V3O A;  4FK1 A;  3K30 A;  3T2K A;  1H84 A;  1REO A;  1TYP A;  3KVE A;  3SY4 A;  4OVI A;  4E0V A;  1Q9I A;  4U8K A;  1N4W A;  2BCP A;  5C2T A;  1CJ2 A;  3HZL A;  2B76 A;  3ICT A;  1FEA A;  4J34 A;  3CTY A;  1CBO A;  4Q4U A;  4ECH A;  2IID A;  1DNC A;  1P2E A;  2GR1 A;  2XFP A;  1M1R A;  3CNP A;  3LZW A;  1EL7 A;  3DJD A;  2EQ6 A;  4GUV A;  4UDP A;  1JNZ A;  3E1T A;  4ZCD A;  5HHF A;  3VRD B;  1FEC A;  1GRB A;  1D4D A;  1KFY A;  2YM2 A;  4B68 A;  5KOW A;  3T14 A;  2JB3 A;  2X3N A;  5FS9 A;  2IVE A;  4Z26 A;  1IUV A;  2YM1 A;  4K5S A;  3T0K A;  3CNS A;  4PAA A;  3DJE A;  3GD3 A;  3FMW A;  2XLP A;  4YTM A;  3I6D A;  4L3Y A;  4YSZ A;  4NTD A;  1S3B A;  4TM4 A;  2VVL G;  1VDC A;  4Z24 A;  3TTB A;  3P4S A;  4H4V A;  2JK6 A;  4Q5C A;  2YLS A;  2C64 A;  1D7L A;  4GDP A;  1D7Y A;  2ZZC A;  3K7M X;  3UKF A;  1TRB A;  3GRS A;  4A6N B;  1GU6 A;  3GSI A;  1NPX A;  3ISH A;  3F8R A;  2WPE A;  4K2X A;  4CNJ A;  5HXI A;  2VRM A;  2V61 A;  2YG6 A;  3FG2 P;  4CRT A;  1JEH A;  4D03 A;  3S5W A;  1GV4 A;  1M6I A;  2WBA A;  2WPC A;  2J3N A;  3UTE A;  3R9U A;  2B9W A;  1O95 A;  3HYV A;  1D4E A;  2C65 A;  3BHK A;  4H4R A;  2GAG B;  2VVL A;  2QA1 A;  3IC9 A;  3EPT A;  1P2H A;  5KMP A;  2EQ9 A;  3KKJ A;  4HA6 A;  1CC6 A;  1OJT A;  2X99 A;  1IUT A;  5CKU A;  2W0H A;  4A6N A;  4YTP A;  3T37 A;  1TDN A;  4EIQ A;  3RED A;  3ZDN A;  2R0G A;  2BRA A;  4LU6 A;  5FS8 A;  5JCN A;  2VR0 A;  3ALM A;  3SXI A;  3LOV A;  4DSH A;  4U8N A;  2O9Z A;  3H8L A;  2GVC A;  2V3B A;  5ER0 A;  4J33 A;  3LGQ A;  2GR3 A;  2TPR A;  4USR A;  3D1I A;  1JRX A;  2CVJ A;  1H82 A;  2WPF A;  4WCT A;  1GT8 A;  1MXT A;  4H4W A;  2HQM A;  4G9K A;  2WDQ A;  1DOD A;  1XPQ A;  4C3X A;  2WQY A;  2B7R A;  3D1C A;  3IF9 A;  4JY2 A;  3AE8 A;  3TOR A;  4AP1 A;  2OA1 A;  4YKF A;  4CNK A;  1OAH A;  2J7A A;  2GH5 A;  1PXC A;  3HYW A;  4H4U A;  4MJW A;  2ARD A;  2X50 A;  1GND A;  4RG3 A;  4Y4M A;  3DK8 A;  2XVI A;  2GQF A;  3UTH A;  4A7A A;  4Z2T A;  5KRQ A;  1PXB A;  1BZL A;  3BNH A;  3NG7 X;  3NYF A;  5IQ4 A;  5KMR A;  3H8I A;  3QVP A;  3FPZ A;  3CN8 A;  4G6G A;  4BJY A;  1L9C A;  4Q17 A;  3NN6 X;  1YKJ A;  2YG3 A;  2B9X A;  4A79 A;  2YLR A;  1S2Q A;  1E1L A;  4REK A;  3G5S A;  2ACZ A;  4JY3 A;  3QJ4 A;  3GMB A;  1B37 A;  4DSG A;  2AR8 A;  3WE0 A; 
#chains in the Genus database with same CATH homology
 3RNM A;  3DH9 A;  1SP3 A;  1Q1R A;  1BWC A;  1YY5 A;  4J31 A;  2YQU A;  2V60 A;  2V5Z A;  4AP3 A;  3GRT A;  4NEW A;  1JNR A;  2YR6 A;  3AWI A;  4I59 A;  4RSL A;  5J7X A;  4B64 A;  1GER A;  2R0P A;  4EIP A;  5IPY A;  4H4Z A;  3NGC X;  2BA9 A;  4U8J A;  2YWL A;  2Z5X A;  3GM6 A;  2JAE A;  2BS4 A;  2F5Z A;  2GAH B;  2C66 A;  4P9S A;  4NZH A;  4TM1 A;  4Y4N A;  5EB5 A;  1LTX R;  1L9E A;  3UP5 A;  3DJG X;  1YQZ A;  4U2S A;  3ITJ A;  1TYT A;  3NTD A;  3AEC A;  3KPF A;  4JNA A;  5J60 A;  5FS7 A;  1QDB A;  3LZX A;  4H4Y A;  4YKG A;  1ZP0 A;  1XHC A;  2GMJ A;  2BC1 A;  2ZZ0 A;  5LV9 A;  2WP6 A;  5DBJ A;  3RP6 A;  2UZZ A;  3DGH A;  1E1N A;  5U63 A;  4ADW A;  4A5L A;  3CPH G;  3NLC A;  1JNI A;  4GDE A;  2BS2 A;  2CFY A;  3SFE A;  4FDC B;  4JQ9 A;  3NN0 X;  4Z25 A;  4H7U A;  4NWZ A;  1M64 A;  1M1P A;  4U8P A;  5KWF A;  4C3Y A;  4OPG A;  1LQU A;  3F29 A;  5KVH A;  1PBB A;  3M0O A;  3Q6J A;  3PO7 A;  1DOE A;  4J56 A;  4DGK A;  3IHM A;  4EQR A;  1IUU A;  4EMJ A;  4CCR A;  3GWF A;  1PXA A;  1ZOY A;  2BS3 A;  1F8S A;  3KU9 A;  4M52 A;  1W4X A;  5KVI A;  1CC2 A;  1CJ3 A;  1E1M A;  1Q1W A;  1PJ5 A;  1ZMC A;  1VG0 A;  2AAQ A;  1ZMD A;  2H88 A;  1FS7 A;  2I0Z A;  1Y0P A;  2R4E A;  3O0H A;  2XVE A;  3RP8 A;  2B7S A;  3G5R A;  1PS9 A;  4B65 A;  1TDO A;  2WEU A;  4EQX A;  3P4P A;  1DJN A;  1GRT A;  2RF7 A;  1DOB A;  2BK3 A;  3NHO X;  4LA1 A;  4XWR A;  3SZ0 A;  3UKK A;  4OPL A;  4O5Q A;  1ZY8 A;  2YG4 A;  5BUL A;  4CBQ A;  2YLW A;  3CGD A;  3AD7 B;  4TM3 A;  1OJ9 A;  1GET A;  3NT6 A;  1IUX A;  4G73 A;  1CJC A;  3P4R A;  4H2R A;  5FMH A;  3UOV A;  1GRF A;  3AB1 A;  4IA6 A;  3UOX A;  2YVJ A;  3LJP A;  2RGJ A;  2K3V A;  1E39 A;  1RYI A;  3KA7 A;  2VRL A;  1JRY A;  4H4Q A;  2A8X A;  1XDI A;  4EMI A;  2WDV A;  4L3X A;  1E1K A;  2YG7 A;  1N1P A;  4GF7 A;  1OJD A;  4EMW A;  5KNL A;  2YLX A;  1BKW A;  3ABV A;  3ALL A;  1LQT A;  4ZCC A;  1NHP A;  1LV0 A;  1OJC A;  1B4V A;  1FEB A;  1BF3 A;  4GAV A;  1PN0 A;  1JU2 A;  2C3C A;  3URH A;  2C75 A;  5HY5 A;  1F6M A;  3II4 A;  1Y56 B;  2E1M A;  3I3L A;  5IQ1 A;  4AOS A;  2C70 A;  3DME A;  3NTA A;  3UU9 A;  4II3 A;  3AE9 A;  3CND A;  3COX A;  2BAC A;  2CDU A;  2FJB A;  3AEE A;  1GXF A;  2YLT A;  4IA5 A;  2GQW A;  4USQ A;  2FJD A;  2C67 A;  2R4J A;  4OPI A;  2QCU A;  2GRT A;  3SGL A;  2VVM A;  3GD4 A;  3KLJ A;  4UP3 A;  3UTG A;  4Z43 A;  3AYI A;  2RAB A;  3BI2 A;  3B3R A;  3ATQ A;  2DKI A;  3CIR A;  2WOV A;  1IUW A;  2TMD A;  4B63 A;  4J36 A;  2YAU A;  2B9Y A;  3AD9 B;  3AEA A;  4U2T A;  4Y4L A;  1KSU A;  3LG1 A;  3NYC A;  4YSY A;  1FS9 A;  4FK1 C;  3QSS A;  5EB4 A;  2Y6R A;  3Q9T A;  2XLR A;  3UCL A;  3BHF A;  3ALJ A;  3NKS A;  2C4C A;  1LPF A;  5GRT A;  1ZDL A;  4X9M A;  3UP4 A;  3NK0 X;  1ONF A;  4PAB A;  3AE5 A;  3UTF A;  4BK1 A;  3L8K A;  1ZKQ A;  3GYJ A;  1VRQ B;  1EL8 A;  3BNG A;  4BJZ A;  1GSN A;  2VQ7 A;  4YSX A;  2ZBW A;  3VRA A;  5JCM A;  3QFA A;  1AOG A;  1XAN A;  3QVR A;  4H2Q A;  3UKP A;  3SZW A;  1LJ1 A;  2BXR A;  2DKH A;  3NYE A;  3SCE A;  3NK1 X;  4JNQ A;  4YWO A;  3RP7 A;  2OAM A;  3KD9 A;  2BAB A;  1FS8 A;  3IWA A;  4X9N A;  2LFC A;  5BVA A;  3KPK A;  2YG5 A;  2WP5 A;  1PBE A;  4G74 A;  1NEK A;  2R46 A;  3DK9 A;  1H83 A;  1H86 A;  2WOW A;  3BNM A;  2X8C A;  4CY6 A;  4EQW A;  2WU2 A;  4U8O A;  2WS3 A;  1X31 B;  2BRY A;  3PVC A;  1O5W A;  3SM8 A;  3VQR A;  2AQJ A;  4YSH A;  1FL2 A;  3ATR A;  3VRB A;  4BK3 A;  3LXD A;  1JOA A;  3AE3 A;  2X8H A;  3M12 A;  1D5T A;  1NDA A;  2Z5Y A;  2XYO A;  3EF6 A;  3QFB A;  3CPI G;  3K7Q X;  3ZYX A;  3T2Y A;  2XLS A;  1NAA A;  3AED A;  2GF3 A;  3AD8 B;  3AYL A;  3EAN A;  4H2P A;  3UOZ A;  3H4K A;  2XFU A;  1PBC A;  2WU5 A;  4B1B A;  4JDR A;  4CY8 A;  1NEN A;  2WHD A;  2BK5 A;  3UKA A;  4OPD A;  2C73 A;  3UOY A;  2APG A;  4Q0T A;  4U2L A;  2OLO A;  1NHS A;  1IJH A;  1KDG A;  5FS6 A;  4EM4 A;  3AE6 A;  1TDE A;  2YR5 A;  2IVD A;  4JN9 A;  1K4Q A;  2WP9 A;  4U8M A;  3PS9 A;  5KXJ A;  2JB2 A;  3FIM B;  3BI5 A;  2WDR A;  1N4V A;  1PBD A;  3K7T A;  4K5R A;  4L3Z A;  1GAL A;  3T2Z A;  3VR9 A;  3SXQ A;  2GR0 A;  4C77 A;  3LB8 A;  2XVF A;  1B5Q A;  4Z2R A;  1GRA A;  1VG9 A;  2YLZ A;  2QA2 A;  4ICY A;  4C5O A;  3AYJ A;  3GYX A;  1OJA A;  3AE7 A;  3M13 A;  1GEU A;  1IUS A;  1ZOV A;  4TM0 A;  3S61 A;  2WES A;  1PDH A;  1NG4 A;  4J57 A;  3QSE A;  4DNA A;  3DJJ A;  1YQ3 A;  5M10 A;  2OAL A;  3EAO A;  2EQ7 A;  3CGB A;  5BRT A;  4K7Z A;  4Z44 A;  2OT4 A;  1KNP A;  2XVJ A;  3LAD A;  4Q5B A;  2RGH A;  3DK4 A;  4UDQ A;  1HYU A;  2PYX A;  3BI4 A;  4TLZ A;  2X8G A;  2ZO5 A;  5HYM A;  2NPX A;  1UKV G;  1N4U A;  2VZ2 A;  5C3J A;  1BVB A;  2PHH A;  2Q7V A;  4NTE A;  4Z2U A;  1GOS A;  2XFO A;  3L1T A;  3UKL A;  3B6D A;  4IVO B;  4LII A;  4WX1 A;  2YR4 A;  4XWZ A;  3VR8 A;  1GRE A;  1NHR A;  1S2Y A;  4AT2 A;  5U1O A;  2Q0K A;  2XFQ A;  4B66 A;  5BUK A;  3FO3 A;  1FCD A;  2BYB A;  2C3D A;  3NK2 X;  1BGN A;  1E6E A;  1F3P A;  1K0J A;  4H50 A;  2XVH A;  1QLB A;  3S7W A;  4U8I A;  2E80 A;  3BNJ A;  3AE4 A;  1Z6L A;  1ZK7 A;  2GMH A;  4J2W A;  4UDR A;  2V3A A;  5EOW A;  3UBR A;  2BCG G;  3F8P A;  3GDN A;  4D04 A;  3OZ2 A;  1DOC A;  5GSN A;  1PBF A;  2ZZB A;  3CPJ G;  1VQW A;  3L1R A;  4AT0 A;  3SZF A;  2XDO A;  1BGJ A;  4N9X A;  5TR3 A;  1RP0 A;  2R9Z A;  5L46 A;  3NNE A;  3UKQ A;  2JB1 A;  3P9U A;  5U25 A;  3HYX A;  4AOX A;  4IVM B;  2GEW A;  2H89 A;  2VOU A;  3NIX A;  4KPR A;  5JCL A;  2R45 A;  3AE1 A;  4GR1 A;  4OPC A;  1V59 A;  4IV9 A;  4TLX A;  4EQS A;  4A9W A;  1KF6 A;  1H7W A;  2GB0 A;  2A89 A;  1CL0 A;  1JRZ A;  1CHU A;  1FT6 A;  1KNR A;  4II2 A;  2JBV A;  2V6O A;  3ICS A;  4B67 A;  4H4X A;  1M1Q A;  2WET A;  2Y6Q A;  4I58 A;  4BUR A;  4GRT A;  3NH3 X;  4ZN0 A;  4H4P A;  5JCK A;  4APN A;  2C7G A;  1Y56 A;  4CCQ A;  3CGC A;  2C76 A;  1GPE A;  4O5U A;  1RSG A;  1CC4 A;  5JCI A;  1E7P A;  2R0C A;  2XCG A;  2VQB A;  3BNU A;  3C4A A;  2OLN A;  4U8L A;  1L0V A;  3P1W A;  3SFD A;  2YVF A;  4BK2 A;  3UKH A;  3RKH A;  1K0L A;  3BNF A;  4H4T A;  2GV8 A;  2FBW A;  2GR2 A;  1GRG A;  2CUL A;  5KMS A;  3C4N A;  3MMO A;  3QSM A;  3FBS A;  1TDK A;  4NTC A;  2XLT A;  3RHA A;  4H2N A;  3GWD A;  2BC0 A;  4RG4 A;  3V76 A;  4OPU A;  4YXD A;  1MO9 A;  3T31 A;  1TDF A;  5KMQ A;  1H6V A;  3F8D A;  4H4S A;  5CQF A;  1O94 A;  3AEB A;  4B69 A;  4EM3 A;  3AXB A;  2A87 A;  1PJ7 A;  3AEF A;  4GCM A;  3SX6 A;  1NG3 A;  1LVL A;  3CNT A;  1QJD A;  1PJ6 A;  3DGZ A;  3G5Q A;  1YQ4 A;  1B8S A;  1S3E A;  1EBD A;  2Q0L A;  3C96 A;  3CMM A;  3NRN A;  2YVG A;  5EBK A;  1NHQ A;  2WOI A;  3D8X A;  2XLU A;  4OPT A;  4YTN A;  2QAE A;  4NEV A;  3OWM A;  2FJA A;  4L38 A;  1FOH A;  1GTH A;  3ADA B;  1GTE A;  1MOK A;  2NVK X;  3CNJ A;  2XFN A;  2E5V A;  4FX9 A;  1L9D A;  3V3N A;  2BXS A;  2E4G A;  3AEG A;  1SEZ A;  1ELI A;  3GYI A;  2FJE A;  3CGE A;  2RGO A;  4K8D A;  1H7X A;  3SYI A;  4A65 A;  5KOX A;  3OC4 A;  1F8W A;  1KSS A;  1GRH A;  1PHH A;  1CF3 A;  2EQ8 A;  1FT5 A;  4XXG A;  2RDZ A;  3ICR A;  3IHG A;  3P4Q A;  3AE2 A;  4Q1O A;  3JSK A;  2E81 A;  1COY A;  4WJY A;  1H81 A;  1CJ4 A;  5M0Z A;  1DXL A;  2C72 A;  3SZC A;  4C74 A;  2JKC A;  1ZX9 A;  1F8R A;  3GMC A;  4KX6 A;  4YT0 A;  4A99 A;  4X4J A;  4NNJ A;  2Q6U A;  1K0I A;  4G6H A;  4GAP A;  4BV6 A;  1D4C A;  1QO8 A;  3SQP A;  1DJQ A;  1EL9 A;  3DA1 A;  3GDP A;  1GES A;  4HB9 A;  4K22 A;  2BK4 A;  4OCG A;  1EL5 A;  3V3O A;  4FK1 A;  3K30 A;  3T2K A;  1H84 A;  1REO A;  1TYP A;  3KVE A;  3SY4 A;  4OVI A;  4E0V A;  1Q9I A;  4U8K A;  1N4W A;  2BCP A;  5C2T A;  1CJ2 A;  3HZL A;  2B76 A;  3ICT A;  1FEA A;  4J34 A;  3CTY A;  1CBO A;  4Q4U A;  4ECH A;  2IID A;  1DNC A;  1P2E A;  2GR1 A;  2XFP A;  1M1R A;  3CNP A;  3LZW A;  1EL7 A;  3DJD A;  2EQ6 A;  4GUV A;  4UDP A;  1JNZ A;  3E1T A;  4ZCD A;  5HHF A;  3VRD B;  1FEC A;  1GRB A;  1D4D A;  1KFY A;  2YM2 A;  4B68 A;  5KOW A;  3T14 A;  2JB3 A;  2X3N A;  5FS9 A;  2IVE A;  4Z26 A;  1IUV A;  2YM1 A;  4K5S A;  3T0K A;  3CNS A;  4PAA A;  3DJE A;  3GD3 A;  3FMW A;  2XLP A;  4YTM A;  3I6D A;  4L3Y A;  4YSZ A;  4NTD A;  1S3B A;  4TM4 A;  2VVL G;  1VDC A;  4Z24 A;  3TTB A;  3P4S A;  4H4V A;  2JK6 A;  4Q5C A;  2YLS A;  2C64 A;  1D7L A;  4GDP A;  1D7Y A;  2ZZC A;  3K7M X;  3UKF A;  1TRB A;  3GRS A;  4A6N B;  1GU6 A;  3GSI A;  1NPX A;  3ISH A;  3F8R A;  2WPE A;  4K2X A;  4CNJ A;  5HXI A;  2VRM A;  2V61 A;  2YG6 A;  3FG2 P;  4CRT A;  1JEH A;  4D03 A;  3S5W A;  1GV4 A;  1M6I A;  2WBA A;  2WPC A;  2J3N A;  3UTE A;  3R9U A;  2B9W A;  1O95 A;  3HYV A;  1D4E A;  2C65 A;  3BHK A;  4H4R A;  2GAG B;  2VVL A;  2QA1 A;  3IC9 A;  3EPT A;  1P2H A;  5KMP A;  2EQ9 A;  3KKJ A;  4HA6 A;  1CC6 A;  1OJT A;  2X99 A;  1IUT A;  5CKU A;  2W0H A;  4A6N A;  4YTP A;  3T37 A;  1TDN A;  4EIQ A;  3RED A;  3ZDN A;  2R0G A;  2BRA A;  4LU6 A;  5FS8 A;  5JCN A;  2VR0 A;  3ALM A;  3SXI A;  3LOV A;  4DSH A;  4U8N A;  2O9Z A;  3H8L A;  2GVC A;  2V3B A;  5ER0 A;  4J33 A;  3LGQ A;  2GR3 A;  2TPR A;  4USR A;  3D1I A;  1JRX A;  2CVJ A;  1H82 A;  2WPF A;  4WCT A;  1GT8 A;  1MXT A;  4H4W A;  2HQM A;  4G9K A;  2WDQ A;  1DOD A;  1XPQ A;  4C3X A;  2WQY A;  2B7R A;  3D1C A;  3IF9 A;  4JY2 A;  3AE8 A;  3TOR A;  4AP1 A;  2OA1 A;  4YKF A;  4CNK A;  1OAH A;  2J7A A;  2GH5 A;  1PXC A;  3HYW A;  4H4U A;  4MJW A;  2ARD A;  2X50 A;  1GND A;  4RG3 A;  4Y4M A;  3DK8 A;  2XVI A;  2GQF A;  3UTH A;  4A7A A;  4Z2T A;  5KRQ A;  1PXB A;  1BZL A;  3BNH A;  3NG7 X;  3NYF A;  5IQ4 A;  5KMR A;  3H8I A;  3QVP A;  3FPZ A;  3CN8 A;  4G6G A;  4BJY A;  1L9C A;  4Q17 A;  3NN6 X;  1YKJ A;  2YG3 A;  2B9X A;  4A79 A;  2YLR A;  1S2Q A;  1E1L A;  4REK A;  3G5S A;  2ACZ A;  4JY3 A;  3QJ4 A;  3GMB A;  1B37 A;  4DSG A;  2AR8 A;  3WE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...