2B7SA

R381k mutant of flavocytochrome c3
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVKGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fumarate reductase flavoprotein subunit
publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 192
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7sA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7sA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7sA03
4WCTA 1F8SA 5M10A 4UP3A 1OJDA 3CPHG 2XLRA 1F3PA 1CJ4A 2WU2A 3KA7A 1Y0PA 3I6DA 3SGLA 1H81A 3IHMA 3S61A 3BNFA 4U8KA 1PBCA 4JNAA 3VR9A 1DODA 1ONFA 4JQ9A 2WU5A 4AP3A 3G5QA 3DK8A 1GREA 3NYCA 4H4ZA 3LZWA 2YQUA 1K0JA 2C67A 4KX6A 3UBRA 2YG5A 3E1TA 1JNRA 3NK0X 2Q0KA 4NTDA 5HYMA 4LU6A 3C96A 3QFAA 3DJGX 5DBJA 3LG1A 3DJJA 3ICTA 4L3YA 3V3NA 4CNKA 5L46A 2B7SA 4Q1OA 3RP7A 1JRYA 2BS3A 1VRQB 3V3OA 5JCNA 3UP4A 1KNPA 4KPRA 1B4VA 4JNQA 1EL5A 1PS9A 3K7QX 1L9EA 4C74A 4Z43A 4U2TA 4ZN0A 1JRXA 1GNDA 3P1WA 1NG3A 1Y56A 2YG6A 4Z24A 4CY6A 1YQZA 1REOA 2WOIA 2VQBA 1H83A 4DGKA 4H50A 4TM3A 3CNDA 4H4UA 1S3BA 3QSMA 3DK4A 2V3BA 1NHRA 3K30A 3COXA 5BUKA 2R4EA 4H2PA 2B9XA 2GQFA 4CY8A 5HHFA 3I3LA 1SEZA 5J60A 3L1TA 2OAMA 3AE7A 4AT0A 1PHHA 3BI4A 2A8XA 2YVFA 5FS6A 2QCUA 1X31B 2GH5A 4YT0A 1SP3A 4C77A 1FS7A 2K3VA 2O9ZA 4FDCB 3T37A 2YM2A 3V76A 3LADA 4A6NB 3CNJA 5M0ZA 5GRTA 2B76A 2B9WA 2RGOA 3ICSA 2GR1A 3CPJG 1DNCA 1E1LA 5BULA 2E80A 1E1NA 1PJ6A 1VQWA 3KKJA 3SQPA 1L0VA 1FS9A 2XCGA 4XWZA 5JCKA 5KWFA 1V59A 3URHA 5U63A 5TR3A 1IJHA 2F5ZA 3OWMA 3NG7X 4NEVA 4Q5CA 2BK4A 2FJAA 1NHQA 3TORA 2AR8A 2XVJA 4EMJA 1ELIA 4A79A 4J2WA 4Y4LA 2LFCA 2JKCA 4H4WA 3RP8A 4USRA 4TLXA 5KXJA 1IUTA 1TDKA 2RABA 1PXBA 3ZDNA 1PBFA 4Z44A 2JK6A 3DMEA 1PBEA 2PHHA 2BCGG 5ER0A 3RKHA 4L38A 3AEGA 2YR4A 4K8DA 2IIDA 2XVFA 4C3XA 4YXDA 3FBSA 4GF7A 3UKPA 1JRZA 2GF3A 3JSKA 4OPLA 1E1KA 3Q6JA 1PJ5A 2DKHA 2YR6A 1PN0A 2JB2A 2X3NA 1CBOA 2WDVA 4UDQA 3AE4A 4D03A 4EIQA 4H4YA 4EM4A 3QSEA 4YSHA 1ZKQA 1LTXR 2E4GA 3GD4A 2RDZA 3F8PA 4TLZA 4EQXA 4USQA 1E1MA 1TDOA 4Q5BA 3AWIA 4YSYA 1P2EA 2YLXA 1O5WA 3GYXA 3CN8A 3DH9A 3TTBA 3S5WA 1H7WA 3DGHA 3GMCA 2X50A 2R45A 5FMHA 2Q0LA 3M12A 3NH3X 3BI5A 3FIMB 3UTHA 3AE8A 1MOKA 3NYFA 4NZHA 1GESA 4U8PA 1EBDA 2VVMA 2C65A 4MJWA 1GTHA 1NENA 5C3JA 5JCIA 3ICRA 2QA1A 4Q17A 1CC2A 3KVEA 3ATQA 2WP5A 3DA1A 1GRFA 1QLBA 2C75A 3K7MX 4RSLA 1JOAA 3DK9A 2C73A 1BZLA 1K0IA 2CULA 3NKSA 4BJYA 4E0VA 1DOBA 2WP6A 3ALMA 3CNPA 2VVLG 2XVEA 3AEBA 2GQWA 3P4RA 3G5RA 4HB9A 3G5SA 2C3CA 2GRTA 3QFBA 3ALJA 3SFDA 4YWOA 4PABA 4U8OA 3AD8B 3KPFA 4EIPA 1F8RA 3RNMA 2CDUA 1GRGA 2YG3A 4GCMA 3BNUA 1GRBA 4IA5A 3AEFA 3L1RA 3NRNA 2VZ2A 1PBBA 2B9YA 3D1IA 2WDRA 3AE1A 2R9ZA 3UOYA 1NHPA 1MO9A 1OJTA 1ZOYA 1XPQA 1GU6A 2YVJA 2VR0A 3UU9A 1IUVA 2R0GA 4EMWA 1B8SA 3UOZA 1MXTA 2C72A 2BK3A 1D4EA 2JB1A 4IV9A 5EOWA 1EL7A 4APNA 3NHOX 2GVCA 3AEDA 4I59A 5U1OA 2Z5YA 1Q1WA 5CQFA 2GAGB 5GSNA 2XFOA 1VG9A 1LQUA 1S3EA 4K5RA 4EM3A 2GAHB 5FS8A 1IUSA 2JBVA 4TM1A 4B1BA 2WS3A 2XFQA 1IUWA 3PO7A 4JY2A 5HY5A 2C66A 2B7RA 4JY3A 3H4KA 3NN6X 4EQRA 3BNMA 3D8XA 2AQJA 3NK2X 1KFYA 2R4JA 1ZOVA 4XWRA 3P9UA 1JU2A 1GOSA 4EQWA 4H4XA 4AOXA 1M1PA 1E7PA 4H4VA 4U8NA 4HA6A 3CNSA 1DOCA 2J7AA 5KOWA 1LVLA 2EQ8A 4Q0TA 2ZO5A 3LOVA 4OPGA 3IC9A 3GD3A 2IVEA 1ZK7A 1YKJA 2JB3A 3MMOA 1CF3A 1NEKA 1N4WA 2GR0A 1GV4A 3DJDA 4ZCDA 2XFPA 3FPZA 1Y56B 4EMIA 2ZZCA 4TM4A 3WE0A 4ZCCA 1M64A 3NGCX 3RP6A 2WPEA 2TMDA 3UKHA 1E39A 1EL8A 1YQ3A 1D5TA 4OPCA 3AE9A 3Q9TA 4BJZA 3AE6A 2CVJA 4OPDA 2XYOA 4X9MA 1L9DA 4OPUA 4H2QA 4UDPA 2EQ9A 2X99A 3NIXA 3H8IA 3PVCA 1BGNA 4D04A 4ADWA 2JAEA 4LA1A 4REKA 1TYPA 1JEHA 3PS9A 4BK3A 4DSGA 4A7AA 1D4CA 4B64A 4CRTA 3P4QA 4U8IA 3UKLA 2APGA 2Q7VA 3AEAA 2VOUA 3CGEA 3IHGA 3LB8A 1L9CA 3NN0X 3GSIA 2BK5A 4NTEA 1QJDA 1LQTA 2R0CA 3C4NA 4FK1C 3ITJA 3GM6A 1BWCA 1OJ9A 1NPXA 1TYTA 2EQ6A 4B63A 4YSZA 5BRTA 1E6EA 4J56A 4K7ZA 2ZZBA 1CJ3A 3QSSA 3UCLA 1ZP0A 2V60A 4OCGA 3FO3A 1FS8A 3ABVA 3F29A 2XLTA 2BABA 1DOEA 5JCLA 4NTCA 2VRMA 2YLWA 3M13A 2VRLA 1BVBA 1TDEA 1PXAA 5KRQA 1IUXA 1GT8A 5EBKA 4Q4UA 4J36A 4AP1A 2BYBA 1N4UA 2BXSA 1N4VA 2C3DA 2WPCA 2WQYA 2XLSA 2Y6QA 2OT4A 1YQ4A 3OZ2A 2XDOA 1PBDA 4N9XA 2WESA 1VDCA 2OLOA 3NNEA 4RG4A 3GDPA 4ECHA 3AB1A 2GMHA 1FCDA 1GEUA 4FX9A 3GMBA 1KNRA 2BC1A 2WPFA 2YVGA 3D1CA 4GUVA 4YTPA 2BS2A 1H82A 1KDGA 2E81A 1H86A 3CGBA 4O5UA 2XFUA 4WJYA 4BURA 2X8HA 3ATRA 4Z25A 4IVMB 2IVDA 4YKFA 5EB4A 1D4DA 2XLUA 4H4PA 5HXIA 4CNJA 3VRDB 2Z5XA 5KVIA 2UZZA 2YR5A 2XFNA 1FT5A 3C4AA 2E1MA 4J34A 3NTDA 1W4XA 4JDRA 1DJQA 4U2SA 4GRTA 3UKFA 1RYIA 4O5QA 3VQRA 4OVIA 3UKAA 3SM8A 4WX1A 1M6IA 3KD9A 4GR1A 2WHDA 1FL2A 4IVOB 4NEWA 5FS7A 1TDNA 2H89A 3AE3A 1FOHA 1H84A 1YY5A 2RGJA 3SCEA 1COYA 2RGHA 4J57A 3UP5A 2AAQA 4K22A 2BACA 1FEAA 1BGJA 4GDEA 1B37A 4B66A 3DGZA 4I58A 1RSGA 3AECA 2YWLA 3AXBA 4Y4NA 1H7XA 4H4RA 1XANA 2A87A 4YTNA 1FECA 1NAAA 3KLJA 3LZXA 2GEWA 2YLZA 3B3RA 3LJPA 2WEUA 1CC6A 5JCMA 3CTYA 1O94A 2X8GA 1GALA 2J3NA 1S2YA 3BHKA 2V6OA 3QJ4A 3LGQA 5IQ1A 3GRTA 1N1PA 2V5ZA 4IA6A 4EQSA 2YAUA 4L3XA 2GB0A 2WOVA 2NVKX 2OA1A 1Q9IA 2Q6UA 1D7LA 1KSSA 2YG7A 3BNJA 1GETA 2C70A 4A5LA 2XLPA 4RG3A 1EL9A 4U8MA 2YG4A 3DJEA 4H2RA 4CCQA 1LJ1A 4K5SA 3O0HA 4OPTA 4A6NA 1FEBA 3BNGA 4A9WA 2GV8A 4B65A 5KVHA 2BXRA 1CC4A 4BK1A 1S2QA 1KSUA 3VR8A 3GYIA 2QA2A 2V61A 2E5VA 3RHAA 3S7WA 4H7UA 1GXFA 1DXLA 4Z2UA 1GRTA 3EPTA 1TRBA 3CGCA 1ZMDA 1LPFA 2OALA 5KOXA 3CGDA 4FK1A 5C2TA 5IPYA 2XVHA 2BA9A 3P4SA 4J33A 4LIIA 4GDPA 3UTFA 3AE5A 3FMWA 3VRBA 1CHUA 1M1QA 1QO8A 1O95A 2BS4A 1ZDLA 2CFYA 2HQMA 4Y4MA 4Z26A 3BNHA 2FJBA 3SXQA 2FJDA 2W0HA 3HZLA 3K7TA 3UOVA 3LXDA 5BVAA 1GPEA 3NYEA 1CJCA 5LV9A 2RF7A 3ISHA 5FS9A 2WDQA 1DJNA 2ARDA 4C5OA 1PDHA 1VG0A 3L8KA 4CBQA 4X4JA 3AYIA 2WOWA 1QDBA 4A65A 3NK1X 2WBAA 2YM1A 3SFEA 3GYJA 3AYJA 1F6MA 2GR3A 3IF9A 1F8WA 2PYXA 1GRAA 3AD9B 4OPIA 3VRAA 3UTEA 3AE2A 1PXCA 4BV6A 4DNAA 2XVIA 3REDA 4Z2TA 2FJEA 3KU9A 3NLCA 4A99A 3GWFA 1CL0A 3NTAA 1M1RA 3OC4A 1CJ2A 2VVLA 2X8CA 2GMJA 2NPXA 3CNTA 4J31A 4B67A 1B5QA 1Z6LA 1ZY8A 3AEEA 4DSHA 2C7GA 1OJAA 1K4QA 2H88A 1RP0A 1K0LA 1BKWA 2I0ZA 2ZZ0A 5IQ4A 1LV0A 2GR2A 4XXGA 2TPRA 2C76A 3ADAB 3R9UA 3NT6A 4YKGA 3II4A 4H2NA 2ACZA 3ALLA 1KF6A 4U8LA 3F8DA 1UKVG 3GWDA 4H4SA 2QAEA 4P9SA 2C64A 2WETA 4BK2A 1NHSA 3GRSA 4TM0A 3F8RA 1H6VA 2ZBWA 3EAOA 1GRHA 1Q1RA 2BCPA 3CIRA 3H8LA 5U25A 3UTGA 3ZYXA 1NG4A 4AOSA 2YLTA 4Z2RA 3UKKA 1D7YA 3BI2A 1ZX9A 1JNZA 4UDRA 4U2LA 2EQ7A 4PAAA 1XHCA 2YLRA 3FG2P 2OLNA 4L3ZA 4U8JA 3EF6A 1OAHA 1OJCA 3BHFA 1GTEA 3AYLA 1ZMCA 2VQ7A 4X9NA 1P2HA 4AT2A 1HYUA 4CCRA 1BF3A 4ICYA 1GSNA 1FT6A 1AOGA 2DKIA 3EANA 2R46A 2V3AA 2Y6RA 4M52A 4C3YA 4JN9A 3P4PA 4B69A 4B68A 4K2XA 1JNIA 1IUUA 1PJ7A 3B6DA 1GERA 1TDFA 2BC0A 3QVPA 2YLSA 3UKQA 2R0PA 2A89A 3M0OA 1NDAA 5EB5A 1XDIA 3AD7B 3GDNA 4YSXA 5CKUA 3IWAA 4H4TA 3QVRA 4YTMA 5J7XA 3UOXA 2FBWA 2WP9A 3CPIG 4H4QA
chains in the Genus database with same CATH superfamily
4WCTA 1F8SA 5M10A 4UP3A 1OJDA 3CPHG 2XLRA 1F3PA 1CJ4A 2WU2A 3KA7A 1Y0PA 3I6DA 3SGLA 3T0KA 1H81A 3IHMA 3S61A 3BNFA 4U8KA 1PBCA 4JNAA 3VR9A 1DODA 1ONFA 4JQ9A 2WU5A 4AP3A 3G5QA 3DK8A 1GREA 3NYCA 4H4ZA 3LZWA 2YQUA 3HYVA 1K0JA 2C67A 4KX6A 3UBRA 2YG5A 3E1TA 1JNRA 3NK0X 2Q0KA 4NTDA 5HYMA 4LU6A 3C96A 3QFAA 3DJGX 5DBJA 3LG1A 3DJJA 3ICTA 4L3YA 3V3NA 4CNKA 5L46A 2B7SA 4Q1OA 3HYXA 3RP7A 1JRYA 2BS3A 1VRQB 3V3OA 5JCNA 3UP4A 1KNPA 4G74A 1B4VA 4JNQA 4KPRA 1EL5A 1PS9A 3K7QX 1L9EA 4C74A 4Z43A 4U2TA 4ZN0A 1JRXA 1GNDA 3P1WA 1NG3A 1Y56A 2YG6A 4Z24A 4CY6A 1YQZA 1REOA 2WOIA 2VQBA 1H83A 4DGKA 4H50A 4TM3A 3CNDA 4H4UA 1S3BA 3QSMA 3DK4A 2V3BA 1NHRA 3K30A 3COXA 5BUKA 2R4EA 4H2PA 2B9XA 2GQFA 4CY8A 5HHFA 3I3LA 1SEZA 5J60A 3L1TA 2OAMA 3AE7A 4AT0A 1PHHA 3BI4A 2A8XA 2YVFA 5FS6A 2QCUA 1X31B 2GH5A 4YT0A 1SP3A 4C77A 1FS7A 2K3VA 2O9ZA 4FDCB 3T37A 2YM2A 3V76A 3LADA 4A6NB 3CNJA 5M0ZA 5GRTA 2B76A 2B9WA 2RGOA 3ICSA 2GR1A 3CPJG 1DNCA 4G9KA 1E1LA 3SYIA 5BULA 2E80A 1E1NA 1PJ6A 1VQWA 3KKJA 3SQPA 1L0VA 1FS9A 2XCGA 4XWZA 5JCKA 5KWFA 1V59A 3URHA 5U63A 5TR3A 1IJHA 2F5ZA 3OWMA 3NG7X 4NEVA 4Q5CA 2BK4A 2FJAA 1NHQA 3TORA 2AR8A 2XVJA 4II3A 1ELIA 4A79A 4J2WA 4Y4LA 4EMJA 2LFCA 2JKCA 4H4WA 3RP8A 4USRA 4TLXA 5KXJA 1IUTA 1TDKA 2RABA 1PXBA 3ZDNA 1PBFA 4Z44A 2JK6A 3DMEA 1PBEA 2PHHA 2BCGG 5ER0A 3RKHA 4L38A 3AEGA 2YR4A 4K8DA 2IIDA 2XVFA 4C3XA 4YXDA 3FBSA 4GF7A 3SZ0A 1JRZA 3UKPA 2GF3A 3JSKA 4OPLA 1E1KA 3Q6JA 1PJ5A 2DKHA 2YR6A 1PN0A 2JB2A 2X3NA 1CBOA 2WDVA 4UDQA 3AE4A 4D03A 4EIQA 4H4YA 4EM4A 3QSEA 4YSHA 1ZKQA 1LTXR 2E4GA 3GD4A 2RDZA 3F8PA 4TLZA 4EQXA 4USQA 1E1MA 1TDOA 4Q5BA 3AWIA 4YSYA 1P2EA 2YLXA 1O5WA 3GYXA 3CN8A 3DH9A 3TTBA 3S5WA 1H7WA 3DGHA 3GMCA 2X50A 2R45A 5FMHA 2Q0LA 3M12A 3NH3X 3BI5A 3FIMB 3UTHA 3AE8A 1MOKA 3NYFA 4NZHA 1GESA 4U8PA 1EBDA 2VVMA 2C65A 4MJWA 1GTHA 1NENA 5C3JA 5JCIA 3ICRA 2QA1A 4Q17A 1CC2A 3KVEA 3ATQA 2WP5A 3DA1A 1GRFA 1QLBA 2C75A 3K7MX 4RSLA 4II2A 1JOAA 3DK9A 2C73A 1BZLA 1K0IA 2CULA 3NKSA 4BJYA 4E0VA 1DOBA 2WP6A 3ALMA 3CNPA 2VVLG 2XVEA 3AEBA 2GQWA 3P4RA 3G5RA 4HB9A 3G5SA 5KMRA 2C3CA 2GRTA 3QFBA 3ALJA 3SFDA 4YWOA 4PABA 4U8OA 3AD8B 3KPFA 4EIPA 1F8RA 3RNMA 2CDUA 1GRGA 2YG3A 4GCMA 3BNUA 1GRBA 4IA5A 3AEFA 3L1RA 3NRNA 2VZ2A 1PBBA 2B9YA 3D1IA 2WDRA 3AE1A 2R9ZA 3UOYA 1NHPA 1MO9A 1OJTA 1ZOYA 3SZWA 1XPQA 1GU6A 2YVJA 2VR0A 3UU9A 1IUVA 2R0GA 4EMWA 1B8SA 3UOZA 1MXTA 2C72A 2BK3A 1D4EA 2JB1A 4IV9A 5EOWA 3CMMA 1EL7A 4APNA 3NHOX 2GVCA 3AEDA 4I59A 5U1OA 2Z5YA 1Q1WA 5CQFA 2GAGB 5GSNA 2XFOA 1VG9A 1LQUA 1S3EA 4K5RA 4EM3A 2GAHB 5FS8A 1IUSA 2JBVA 4TM1A 4B1BA 2WS3A 2XFQA 1IUWA 3PO7A 4JY2A 5HY5A 2C66A 2B7RA 4JY3A 3H4KA 3NN6X 4EQRA 3BNMA 3D8XA 2AQJA 3NK2X 1KFYA 2R4JA 1ZOVA 2BRAA 3SXIA 4XWRA 3P9UA 1JU2A 1GOSA 4EQWA 4H4XA 4AOXA 1M1PA 1E7PA 4H4VA 4U8NA 4HA6A 3CNSA 4G6GA 1DOCA 2J7AA 5KOWA 1LVLA 2EQ8A 4Q0TA 2ZO5A 3LOVA 4OPGA 3IC9A 3GD3A 2IVEA 1ZK7A 1YKJA 2JB3A 3MMOA 1CF3A 1NEKA 1N4WA 2GR0A 1GV4A 3DJDA 4ZCDA 2XFPA 3FPZA 1Y56B 2C4CA 4EMIA 2ZZCA 4TM4A 3WE0A 4ZCCA 1M64A 3NGCX 3RP6A 2WPEA 3T31A 2TMDA 3UKHA 1E39A 1EL8A 1YQ3A 1D5TA 4OPCA 3AE9A 3Q9TA 4BJZA 3AE6A 2CVJA 4OPDA 2XYOA 4X9MA 1L9DA 4OPUA 4H2QA 4UDPA 2EQ9A 2X99A 3NIXA 3H8IA 3PVCA 1BGNA 4D04A 4NWZA 4ADWA 2JAEA 4LA1A 4REKA 1TYPA 1JEHA 3PS9A 4BK3A 4DSGA 4A7AA 1D4CA 4B64A 4CRTA 3P4QA 4U8IA 3UKLA 2APGA 2Q7VA 3AEAA 2VOUA 3CGEA 3IHGA 3LB8A 1L9CA 3NN0X 3GSIA 2BK5A 4NTEA 1QJDA 1LQTA 2R0CA 3C4NA 4FK1C 3ITJA 3GM6A 1BWCA 1OJ9A 1NPXA 1TYTA 2EQ6A 4B63A 4YSZA 5BRTA 1E6EA 4J56A 4K7ZA 2ZZBA 1CJ3A 3QSSA 3UCLA 1ZP0A 2V60A 4OCGA 3FO3A 1FS8A 3ABVA 3F29A 2XLTA 2BABA 1DOEA 5JCLA 4NTCA 2VRMA 2YLWA 3M13A 2VRLA 3KPKA 1BVBA 1TDEA 1PXAA 5KRQA 1IUXA 1GT8A 5EBKA 4Q4UA 4J36A 4AP1A 2BYBA 1N4UA 2BXSA 1N4VA 2C3DA 2WPCA 2WQYA 3SX6A 2XLSA 2Y6QA 2OT4A 1YQ4A 3OZ2A 2XDOA 1PBDA 4N9XA 2WESA 1VDCA 2OLOA 3NNEA 4RG4A 3GDPA 4ECHA 3AB1A 2GMHA 1FCDA 1GEUA 4FX9A 3GMBA 1KNRA 2BC1A 2WPFA 2YVGA 3D1CA 4GUVA 4YTPA 2BS2A 1H82A 1KDGA 2E81A 1H86A 3CGBA 4O5UA 2XFUA 4WJYA 4BURA 2X8HA 3ATRA 4Z25A 4IVMB 2IVDA 4YKFA 5EB4A 1D4DA 2XLUA 4H4PA 5HXIA 4CNJA 3VRDB 2Z5XA 5KVIA 2UZZA 3T2YA 2YR5A 2XFNA 1FT5A 3C4AA 2E1MA 4J34A 3NTDA 1W4XA 4JDRA 1DJQA 4U2SA 4GRTA 3UKFA 1RYIA 4O5QA 3VQRA 4OVIA 3UKAA 3SM8A 4WX1A 1M6IA 3KD9A 4GR1A 2WHDA 1FL2A 4IVOB 4NEWA 5FS7A 1TDNA 2H89A 3AE3A 1FOHA 1H84A 1YY5A 2RGJA 3SCEA 1COYA 2RGHA 4J57A 3UP5A 2AAQA 4K22A 2BACA 1FEAA 1BGJA 4GDEA 1B37A 4B66A 3DGZA 4I58A 1RSGA 3AECA 2YWLA 3AXBA 4Y4NA 1H7XA 4H4RA 5KMQA 1XANA 2A87A 4YTNA 3SZFA 1FECA 1NAAA 3KLJA 3LZXA 2GEWA 2YLZA 3B3RA 3LJPA 2WEUA 1CC6A 5JCMA 3CTYA 1O94A 2X8GA 1GALA 2J3NA 1S2YA 3BHKA 2V6OA 3QJ4A 3LGQA 5IQ1A 3GRTA 1N1PA 2V5ZA 4IA6A 4EQSA 2YAUA 4L3XA 2GB0A 2WOVA 2NVKX 2OA1A 1Q9IA 2Q6UA 3T2ZA 1D7LA 1KSSA 2YG7A 3BNJA 1GETA 2C70A 4A5LA 2XLPA 4RG3A 1EL9A 4U8MA 2YG4A 3DJEA 4H2RA 4CCQA 1LJ1A 4K5SA 3O0HA 4OPTA 4A6NA 1FEBA 3BNGA 4A9WA 2GV8A 4B65A 5KMSA 2BXRA 5KVHA 1CC4A 4BK1A 1S2QA 1KSUA 3VR8A 3SZCA 3GYIA 2QA2A 2V61A 2E5VA 3RHAA 3T2KA 3S7WA 4H7UA 1GXFA 1DXLA 4Z2UA 1GRTA 3EPTA 1TRBA 3CGCA 1ZMDA 1LPFA 2OALA 4GAVA 5KOXA 3CGDA 4FK1A 5C2TA 5IPYA 2XVHA 2BA9A 3P4SA 4J33A 4LIIA 4GDPA 3UTFA 3AE5A 3FMWA 3VRBA 1CHUA 1M1QA 1QO8A 1O95A 2BS4A 1ZDLA 2CFYA 2HQMA 4Y4MA 4Z26A 3BNHA 2FJBA 3SXQA 2FJDA 2W0HA 3HZLA 3K7TA 3UOVA 3LXDA 5BVAA 1GPEA 3NYEA 1CJCA 5LV9A 2RF7A 3ISHA 5FS9A 2WDQA 1DJNA 2ARDA 4C5OA 1PDHA 1VG0A 3L8KA 5KMPA 4CBQA 2CZSA 4X4JA 3AYIA 2WOWA 1QDBA 4A65A 3NK1X 2WBAA 2YM1A 3SFEA 3GYJA 3AYJA 1F6MA 2GR3A 3IF9A 1F8WA 2PYXA 1GRAA 3AD9B 4OPIA 3T14A 3VRAA 3UTEA 3AE2A 1PXCA 4BV6A 4DNAA 2XVIA 3REDA 4Z2TA 2FJEA 3KU9A 3NLCA 4A99A 3GWFA 1CL0A 3NTAA 1M1RA 3OC4A 1CJ2A 2VVLA 2X8CA 2GMJA 2NPXA 3CNTA 4J31A 4B67A 1B5QA 1Z6LA 1ZY8A 3AEEA 4DSHA 5KNLA 2C7GA 1OJAA 1K4QA 2H88A 1RP0A 1K0LA 1BKWA 2I0ZA 2ZZ0A 3HYWA 1LV0A 2GR2A 4XXGA 5IQ4A 2TPRA 2C76A 3ADAB 3R9UA 3NT6A 4YKGA 3II4A 4H2NA 2ACZA 3ALLA 1KF6A 4U8LA 3F8DA 1UKVG 3GWDA 4H4SA 2QAEA 4P9SA 2C64A 2WETA 4BK2A 1NHSA 3GRSA 4TM0A 3F8RA 1H6VA 2ZBWA 3EAOA 1GRHA 1Q1RA 2BCPA 3CIRA 3H8LA 5U25A 3UTGA 3ZYXA 1NG4A 4AOSA 2YLTA 4Z2RA 3UKKA 1D7YA 3BI2A 3SY4A 1ZX9A 1JNZA 4UDRA 4GAPA 4U2LA 2EQ7A 4PAAA 1XHCA 2YLRA 3FG2P 2OLNA 4L3ZA 4U8JA 3EF6A 1OAHA 1OJCA 3BHFA 2BRYA 1GTEA 3AYLA 1ZMCA 2VQ7A 4G6HA 4X9NA 1P2HA 4NNJA 1HYUA 4AT2A 4CCRA 1BF3A 4ICYA 1GSNA 1FT6A 1AOGA 2DKIA 3EANA 2R46A 2V3AA 2Y6RA 4M52A 4C3YA 4JN9A 3P4PA 4B69A 4B68A 4K2XA 1JNIA 1IUUA 1PJ7A 3B6DA 1GERA 1TDFA 2BC0A 3QVPA 2YLSA 4G73A 3UKQA 2R0PA 2A89A 3M0OA 1NDAA 5EB5A 1XDIA 3AD7B 3GDNA 4YSXA 5CKUA 3IWAA 4H4TA 3QVRA 4YTMA 5J7XA 3UOXA 2FBWA 2WP9A 3CPIG 4H4QA
chains in the Genus database with same CATH topology
4WCTA 1F8SA 5M10A 4UP3A 1OJDA 3CPHG 2XLRA 1F3PA 1CJ4A 2WU2A 3KA7A 1Y0PA 3I6DA 3SGLA 3T0KA 1H81A 3IHMA 3S61A 3BNFA 4U8KA 1PBCA 4JNAA 3VR9A 1DODA 1ONFA 4JQ9A 2WU5A 4AP3A 3G5QA 3DK8A 1GREA 3NYCA 4H4ZA 3LZWA 2YQUA 3HYVA 1K0JA 2C67A 4KX6A 3UBRA 2YG5A 3E1TA 1JNRA 3NK0X 2Q0KA 4NTDA 5HYMA 4LU6A 3C96A 3QFAA 3DJGX 5DBJA 3LG1A 3DJJA 3ICTA 4L3YA 3V3NA 4CNKA 5L46A 2B7SA 4Q1OA 3HYXA 3RP7A 1JRYA 2BS3A 1VRQB 3V3OA 5JCNA 3UP4A 1KNPA 4G74A 1B4VA 4JNQA 4KPRA 1EL5A 1PS9A 3K7QX 1L9EA 4C74A 4Z43A 4U2TA 4ZN0A 1JRXA 1GNDA 3P1WA 1NG3A 1Y56A 2YG6A 4Z24A 4CY6A 1YQZA 1REOA 2WOIA 2VQBA 1H83A 4DGKA 4H50A 4TM3A 3CNDA 4H4UA 1S3BA 3QSMA 3DK4A 2V3BA 1NHRA 3K30A 3COXA 5BUKA 2R4EA 4H2PA 2B9XA 2GQFA 4CY8A 5HHFA 3I3LA 1SEZA 5J60A 3L1TA 2OAMA 3AE7A 4AT0A 1PHHA 3BI4A 2A8XA 2YVFA 5FS6A 2QCUA 1X31B 2GH5A 4YT0A 1SP3A 4C77A 1FS7A 2K3VA 2O9ZA 4FDCB 3T37A 2YM2A 3V76A 3LADA 4A6NB 3CNJA 5M0ZA 5GRTA 2B76A 2B9WA 2RGOA 3ICSA 2GR1A 3CPJG 1DNCA 4G9KA 1E1LA 3SYIA 5BULA 2E80A 1E1NA 1PJ6A 1VQWA 3KKJA 3SQPA 1L0VA 1FS9A 2XCGA 4XWZA 5JCKA 5KWFA 1V59A 3URHA 5U63A 5TR3A 1IJHA 2F5ZA 3OWMA 3NG7X 4NEVA 4Q5CA 2BK4A 2FJAA 1NHQA 3TORA 2AR8A 2XVJA 4II3A 1ELIA 4A79A 4J2WA 4Y4LA 4EMJA 2LFCA 2JKCA 4H4WA 3RP8A 4USRA 4TLXA 5KXJA 1IUTA 1TDKA 2RABA 1PXBA 3ZDNA 1PBFA 4Z44A 2JK6A 3DMEA 1PBEA 2PHHA 2BCGG 5ER0A 3RKHA 4L38A 3AEGA 2YR4A 4K8DA 2IIDA 2XVFA 4C3XA 4YXDA 3FBSA 4GF7A 3SZ0A 1JRZA 3UKPA 2GF3A 3JSKA 4OPLA 1E1KA 3Q6JA 1PJ5A 2DKHA 2YR6A 1PN0A 2JB2A 2X3NA 1CBOA 2WDVA 4UDQA 3AE4A 4D03A 4EIQA 4H4YA 4EM4A 3QSEA 4YSHA 1ZKQA 1LTXR 2E4GA 3GD4A 2RDZA 3F8PA 4TLZA 4EQXA 4USQA 1E1MA 1TDOA 4Q5BA 3AWIA 4YSYA 1P2EA 2YLXA 1O5WA 3GYXA 3CN8A 3DH9A 3TTBA 3S5WA 1H7WA 3DGHA 3GMCA 2X50A 2R45A 5FMHA 2Q0LA 3M12A 3NH3X 3BI5A 3FIMB 3UTHA 3AE8A 1MOKA 3NYFA 4NZHA 1GESA 4U8PA 1EBDA 2VVMA 2C65A 4MJWA 1GTHA 1NENA 5C3JA 5JCIA 3ICRA 2QA1A 4Q17A 1CC2A 3KVEA 3ATQA 2WP5A 3DA1A 1GRFA 1QLBA 2C75A 3K7MX 4RSLA 4II2A 1JOAA 3DK9A 2C73A 1BZLA 1K0IA 2CULA 3NKSA 4BJYA 4E0VA 1DOBA 2WP6A 3ALMA 3CNPA 2VVLG 2XVEA 3AEBA 2GQWA 3P4RA 3G5RA 4HB9A 3G5SA 5KMRA 2C3CA 2GRTA 3QFBA 3ALJA 3SFDA 4YWOA 4PABA 4U8OA 3AD8B 3KPFA 4EIPA 1F8RA 3RNMA 2CDUA 1GRGA 2YG3A 4GCMA 3BNUA 1GRBA 4IA5A 3AEFA 3L1RA 3NRNA 2VZ2A 1PBBA 2B9YA 3D1IA 2WDRA 3AE1A 2R9ZA 3UOYA 1NHPA 1MO9A 1OJTA 1ZOYA 3SZWA 1XPQA 1GU6A 2YVJA 2VR0A 3UU9A 1IUVA 2R0GA 4EMWA 1B8SA 3UOZA 1MXTA 2C72A 2BK3A 1D4EA 2JB1A 4IV9A 5EOWA 3CMMA 1EL7A 4APNA 3NHOX 2GVCA 3AEDA 4I59A 5U1OA 2Z5YA 1Q1WA 5CQFA 2GAGB 5GSNA 2XFOA 1VG9A 1LQUA 1S3EA 4K5RA 4EM3A 2GAHB 5FS8A 1IUSA 2JBVA 4TM1A 4B1BA 2WS3A 2XFQA 1IUWA 3PO7A 4JY2A 5HY5A 2C66A 2B7RA 4JY3A 3H4KA 3NN6X 4EQRA 3BNMA 3D8XA 2AQJA 3NK2X 1KFYA 2R4JA 1ZOVA 2BRAA 3SXIA 4XWRA 3P9UA 1JU2A 1GOSA 4EQWA 4H4XA 4AOXA 1M1PA 1E7PA 4H4VA 4U8NA 4HA6A 3CNSA 4G6GA 1DOCA 2J7AA 5KOWA 1LVLA 2EQ8A 4Q0TA 2ZO5A 3LOVA 4OPGA 3IC9A 3GD3A 2IVEA 1ZK7A 1YKJA 2JB3A 3MMOA 1CF3A 1NEKA 1N4WA 2GR0A 1GV4A 3DJDA 4ZCDA 2XFPA 3FPZA 1Y56B 2C4CA 4EMIA 2ZZCA 4TM4A 3WE0A 4ZCCA 1M64A 3NGCX 3RP6A 2WPEA 3T31A 2TMDA 3UKHA 1E39A 1EL8A 1YQ3A 1D5TA 4OPCA 3AE9A 3Q9TA 4BJZA 3AE6A 2CVJA 4OPDA 2XYOA 4X9MA 1L9DA 4OPUA 4H2QA 4UDPA 2EQ9A 2X99A 3NIXA 3H8IA 3PVCA 1BGNA 4D04A 4NWZA 4ADWA 2JAEA 4LA1A 4REKA 1TYPA 1JEHA 3PS9A 4BK3A 4DSGA 4A7AA 1D4CA 4B64A 4CRTA 3P4QA 4U8IA 3UKLA 2APGA 2Q7VA 3AEAA 2VOUA 3CGEA 3IHGA 3LB8A 1L9CA 3NN0X 3GSIA 2BK5A 4NTEA 1QJDA 1LQTA 2R0CA 3C4NA 4FK1C 3ITJA 3GM6A 1BWCA 1OJ9A 1NPXA 1TYTA 2EQ6A 4B63A 4YSZA 5BRTA 1E6EA 4J56A 4K7ZA 2ZZBA 1CJ3A 3QSSA 3UCLA 1ZP0A 2V60A 4OCGA 3FO3A 1FS8A 3ABVA 3F29A 2XLTA 2BABA 1DOEA 5JCLA 4NTCA 2VRMA 2YLWA 3M13A 2VRLA 3KPKA 1BVBA 1TDEA 1PXAA 5KRQA 1IUXA 1GT8A 5EBKA 4Q4UA 4J36A 4AP1A 2BYBA 1N4UA 2BXSA 1N4VA 2C3DA 2WPCA 2WQYA 3SX6A 2XLSA 2Y6QA 2OT4A 1YQ4A 3OZ2A 2XDOA 1PBDA 4N9XA 2WESA 1VDCA 2OLOA 3NNEA 4RG4A 3GDPA 4ECHA 3AB1A 2GMHA 1FCDA 1GEUA 4FX9A 3GMBA 1KNRA 2BC1A 2WPFA 2YVGA 3D1CA 4GUVA 4YTPA 2BS2A 1H82A 1KDGA 2E81A 1H86A 3CGBA 4O5UA 2XFUA 4WJYA 4BURA 2X8HA 3ATRA 4Z25A 4IVMB 2IVDA 4YKFA 5EB4A 1D4DA 2XLUA 4H4PA 5HXIA 4CNJA 3VRDB 2Z5XA 5KVIA 2UZZA 3T2YA 2YR5A 2XFNA 1FT5A 3C4AA 2E1MA 4J34A 3NTDA 1W4XA 4JDRA 1DJQA 4U2SA 4GRTA 3UKFA 1RYIA 4O5QA 3VQRA 4OVIA 3UKAA 3SM8A 4WX1A 1M6IA 3KD9A 4GR1A 2WHDA 1FL2A 4IVOB 4NEWA 5FS7A 1TDNA 2H89A 3AE3A 1FOHA 1H84A 1YY5A 2RGJA 3SCEA 1COYA 2RGHA 4J57A 3UP5A 2AAQA 4K22A 2BACA 1FEAA 1BGJA 4GDEA 1B37A 4B66A 3DGZA 4I58A 1RSGA 3AECA 2YWLA 3AXBA 4Y4NA 1H7XA 4H4RA 5KMQA 1XANA 2A87A 4YTNA 3SZFA 1FECA 1NAAA 3KLJA 3LZXA 2GEWA 2YLZA 3B3RA 3LJPA 2WEUA 1CC6A 5JCMA 3CTYA 1O94A 2X8GA 1GALA 2J3NA 1S2YA 3BHKA 2V6OA 3QJ4A 3LGQA 5IQ1A 3GRTA 1N1PA 2V5ZA 4IA6A 4EQSA 2YAUA 4L3XA 2GB0A 2WOVA 2NVKX 2OA1A 1Q9IA 2Q6UA 3T2ZA 1D7LA 1KSSA 2YG7A 3BNJA 1GETA 2C70A 4A5LA 2XLPA 4RG3A 1EL9A 4U8MA 2YG4A 3DJEA 4H2RA 4CCQA 1LJ1A 4K5SA 3O0HA 4OPTA 4A6NA 1FEBA 3BNGA 4A9WA 2GV8A 4B65A 5KMSA 2BXRA 5KVHA 1CC4A 4BK1A 1S2QA 1KSUA 3VR8A 3SZCA 3GYIA 2QA2A 2V61A 2E5VA 3RHAA 3T2KA 3S7WA 4H7UA 1GXFA 1DXLA 4Z2UA 1GRTA 3EPTA 1TRBA 3CGCA 1ZMDA 1LPFA 2OALA 4GAVA 5KOXA 3CGDA 4FK1A 5C2TA 5IPYA 2XVHA 2BA9A 3P4SA 4J33A 4LIIA 4GDPA 3UTFA 3AE5A 3FMWA 3VRBA 1CHUA 1M1QA 1QO8A 1O95A 2BS4A 1ZDLA 2CFYA 2HQMA 4Y4MA 4Z26A 3BNHA 2FJBA 3SXQA 2FJDA 2W0HA 3HZLA 3K7TA 3UOVA 3LXDA 5BVAA 1GPEA 3NYEA 1CJCA 5LV9A 2RF7A 3ISHA 5FS9A 2WDQA 1DJNA 2ARDA 4C5OA 1PDHA 1VG0A 3L8KA 5KMPA 4CBQA 4X4JA 3AYIA 2WOWA 1QDBA 4A65A 3NK1X 2WBAA 2YM1A 3SFEA 3GYJA 3AYJA 1F6MA 2GR3A 3IF9A 1F8WA 2PYXA 1GRAA 3AD9B 4OPIA 3T14A 3VRAA 3UTEA 3AE2A 1PXCA 4BV6A 4DNAA 2XVIA 3REDA 4Z2TA 2FJEA 3KU9A 3NLCA 4A99A 3GWFA 1CL0A 3NTAA 1M1RA 3OC4A 1CJ2A 2VVLA 2X8CA 2GMJA 2NPXA 3CNTA 4J31A 4B67A 1B5QA 1Z6LA 1ZY8A 3AEEA 4DSHA 5KNLA 2C7GA 1OJAA 1K4QA 2H88A 1RP0A 1K0LA 1BKWA 2I0ZA 2ZZ0A 3HYWA 1LV0A 2GR2A 4XXGA 5IQ4A 2TPRA 2C76A 3ADAB 3R9UA 3NT6A 4YKGA 3II4A 4H2NA 2ACZA 3ALLA 1KF6A 4U8LA 3F8DA 1UKVG 3GWDA 4H4SA 2QAEA 4P9SA 2C64A 2WETA 4BK2A 1NHSA 3GRSA 4TM0A 3F8RA 1H6VA 2ZBWA 3EAOA 1GRHA 1Q1RA 2BCPA 3CIRA 3H8LA 5U25A 3UTGA 3ZYXA 1NG4A 4AOSA 2YLTA 4Z2RA 3UKKA 1D7YA 3BI2A 3SY4A 1ZX9A 1JNZA 4UDRA 4GAPA 4U2LA 2EQ7A 4PAAA 1XHCA 2YLRA 3FG2P 2OLNA 4L3ZA 4U8JA 3EF6A 1OAHA 1OJCA 3BHFA 2BRYA 1GTEA 3AYLA 1ZMCA 2VQ7A 4G6HA 4X9NA 1P2HA 4NNJA 1HYUA 4AT2A 4CCRA 1BF3A 4ICYA 1GSNA 1FT6A 1AOGA 2DKIA 3EANA 2R46A 2V3AA 2Y6RA 4M52A 4C3YA 4JN9A 3P4PA 4B69A 4B68A 4K2XA 1JNIA 1IUUA 1PJ7A 3B6DA 1GERA 1TDFA 2BC0A 3QVPA 2YLSA 4G73A 3UKQA 2R0PA 2A89A 3M0OA 1NDAA 5EB5A 1XDIA 3AD7B 3GDNA 4YSXA 5CKUA 3IWAA 4H4TA 3QVRA 4YTMA 5J7XA 3UOXA 2FBWA 2WP9A 3CPIG 4H4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCT A;  1F8S A;  5M10 A;  4UP3 A;  1OJD A;  3CPH G;  2XLR A;  1F3P A;  1CJ4 A;  2WU2 A;  3KA7 A;  1Y0P A;  3I6D A;  3SGL A;  1H81 A;  3IHM A;  3S61 A;  3BNF A;  4U8K A;  1PBC A;  4JNA A;  3VR9 A;  1DOD A;  1ONF A;  4JQ9 A;  2WU5 A;  4AP3 A;  3G5Q A;  3DK8 A;  1GRE A;  3NYC A;  4H4Z A;  3LZW A;  2YQU A;  1K0J A;  2C67 A;  4KX6 A;  3UBR A;  2YG5 A;  3E1T A;  1JNR A;  3NK0 X;  2Q0K A;  4NTD A;  5HYM A;  4LU6 A;  3C96 A;  3QFA A;  3DJG X;  5DBJ A;  3LG1 A;  3DJJ A;  3ICT A;  4L3Y A;  3V3N A;  4CNK A;  5L46 A;  2B7S A;  4Q1O A;  3RP7 A;  1JRY A;  2BS3 A;  1VRQ B;  3V3O A;  5JCN A;  3UP4 A;  1KNP A;  4KPR A;  1B4V A;  4JNQ A;  1EL5 A;  1PS9 A;  3K7Q X;  1L9E A;  4C74 A;  4Z43 A;  4U2T A;  4ZN0 A;  1JRX A;  1GND A;  3P1W A;  1NG3 A;  1Y56 A;  2YG6 A;  4Z24 A;  4CY6 A;  1YQZ A;  1REO A;  2WOI A;  2VQB A;  1H83 A;  4DGK A;  4H50 A;  4TM3 A;  3CND A;  4H4U A;  1S3B A;  3QSM A;  3DK4 A;  2V3B A;  1NHR A;  3K30 A;  3COX A;  5BUK A;  2R4E A;  4H2P A;  2B9X A;  2GQF A;  4CY8 A;  5HHF A;  3I3L A;  1SEZ A;  5J60 A;  3L1T A;  2OAM A;  3AE7 A;  4AT0 A;  1PHH A;  3BI4 A;  2A8X A;  2YVF A;  5FS6 A;  2QCU A;  1X31 B;  2GH5 A;  4YT0 A;  1SP3 A;  4C77 A;  1FS7 A;  2K3V A;  2O9Z A;  4FDC B;  3T37 A;  2YM2 A;  3V76 A;  3LAD A;  4A6N B;  3CNJ A;  5M0Z A;  5GRT A;  2B76 A;  2B9W A;  2RGO A;  3ICS A;  2GR1 A;  3CPJ G;  1DNC A;  1E1L A;  5BUL A;  2E80 A;  1E1N A;  1PJ6 A;  1VQW A;  3KKJ A;  3SQP A;  1L0V A;  1FS9 A;  2XCG A;  4XWZ A;  5JCK A;  5KWF A;  1V59 A;  3URH A;  5U63 A;  5TR3 A;  1IJH A;  2F5Z A;  3OWM A;  3NG7 X;  4NEV A;  4Q5C A;  2BK4 A;  2FJA A;  1NHQ A;  3TOR A;  2AR8 A;  2XVJ A;  4EMJ A;  1ELI A;  4A79 A;  4J2W A;  4Y4L A;  2LFC A;  2JKC A;  4H4W A;  3RP8 A;  4USR A;  4TLX A;  5KXJ A;  1IUT A;  1TDK A;  2RAB A;  1PXB A;  3ZDN A;  1PBF A;  4Z44 A;  2JK6 A;  3DME A;  1PBE A;  2PHH A;  2BCG G;  5ER0 A;  3RKH A;  4L38 A;  3AEG A;  2YR4 A;  4K8D A;  2IID A;  2XVF A;  4C3X A;  4YXD A;  3FBS A;  4GF7 A;  3UKP A;  1JRZ A;  2GF3 A;  3JSK A;  4OPL A;  1E1K A;  3Q6J A;  1PJ5 A;  2DKH A;  2YR6 A;  1PN0 A;  2JB2 A;  2X3N A;  1CBO A;  2WDV A;  4UDQ A;  3AE4 A;  4D03 A;  4EIQ A;  4H4Y A;  4EM4 A;  3QSE A;  4YSH A;  1ZKQ A;  1LTX R;  2E4G A;  3GD4 A;  2RDZ A;  3F8P A;  4TLZ A;  4EQX A;  4USQ A;  1E1M A;  1TDO A;  4Q5B A;  3AWI A;  4YSY A;  1P2E A;  2YLX A;  1O5W A;  3GYX A;  3CN8 A;  3DH9 A;  3TTB A;  3S5W A;  1H7W A;  3DGH A;  3GMC A;  2X50 A;  2R45 A;  5FMH A;  2Q0L A;  3M12 A;  3NH3 X;  3BI5 A;  3FIM B;  3UTH A;  3AE8 A;  1MOK A;  3NYF A;  4NZH A;  1GES A;  4U8P A;  1EBD A;  2VVM A;  2C65 A;  4MJW A;  1GTH A;  1NEN A;  5C3J A;  5JCI A;  3ICR A;  2QA1 A;  4Q17 A;  1CC2 A;  3KVE A;  3ATQ A;  2WP5 A;  3DA1 A;  1GRF A;  1QLB A;  2C75 A;  3K7M X;  4RSL A;  1JOA A;  3DK9 A;  2C73 A;  1BZL A;  1K0I A;  2CUL A;  3NKS A;  4BJY A;  4E0V A;  1DOB A;  2WP6 A;  3ALM A;  3CNP A;  2VVL G;  2XVE A;  3AEB A;  2GQW A;  3P4R A;  3G5R A;  4HB9 A;  3G5S A;  2C3C A;  2GRT A;  3QFB A;  3ALJ A;  3SFD A;  4YWO A;  4PAB A;  4U8O A;  3AD8 B;  3KPF A;  4EIP A;  1F8R A;  3RNM A;  2CDU A;  1GRG A;  2YG3 A;  4GCM A;  3BNU A;  1GRB A;  4IA5 A;  3AEF A;  3L1R A;  3NRN A;  2VZ2 A;  1PBB A;  2B9Y A;  3D1I A;  2WDR A;  3AE1 A;  2R9Z A;  3UOY A;  1NHP A;  1MO9 A;  1OJT A;  1ZOY A;  1XPQ A;  1GU6 A;  2YVJ A;  2VR0 A;  3UU9 A;  1IUV A;  2R0G A;  4EMW A;  1B8S A;  3UOZ A;  1MXT A;  2C72 A;  2BK3 A;  1D4E A;  2JB1 A;  4IV9 A;  5EOW A;  1EL7 A;  4APN A;  3NHO X;  2GVC A;  3AED A;  4I59 A;  5U1O A;  2Z5Y A;  1Q1W A;  5CQF A;  2GAG B;  5GSN A;  2XFO A;  1VG9 A;  1LQU A;  1S3E A;  4K5R A;  4EM3 A;  2GAH B;  5FS8 A;  1IUS A;  2JBV A;  4TM1 A;  4B1B A;  2WS3 A;  2XFQ A;  1IUW A;  3PO7 A;  4JY2 A;  5HY5 A;  2C66 A;  2B7R A;  4JY3 A;  3H4K A;  3NN6 X;  4EQR A;  3BNM A;  3D8X A;  2AQJ A;  3NK2 X;  1KFY A;  2R4J A;  1ZOV A;  4XWR A;  3P9U A;  1JU2 A;  1GOS A;  4EQW A;  4H4X A;  4AOX A;  1M1P A;  1E7P A;  4H4V A;  4U8N A;  4HA6 A;  3CNS A;  1DOC A;  2J7A A;  5KOW A;  1LVL A;  2EQ8 A;  4Q0T A;  2ZO5 A;  3LOV A;  4OPG A;  3IC9 A;  3GD3 A;  2IVE A;  1ZK7 A;  1YKJ A;  2JB3 A;  3MMO A;  1CF3 A;  1NEK A;  1N4W A;  2GR0 A;  1GV4 A;  3DJD A;  4ZCD A;  2XFP A;  3FPZ A;  1Y56 B;  4EMI A;  2ZZC A;  4TM4 A;  3WE0 A;  4ZCC A;  1M64 A;  3NGC X;  3RP6 A;  2WPE A;  2TMD A;  3UKH A;  1E39 A;  1EL8 A;  1YQ3 A;  1D5T A;  4OPC A;  3AE9 A;  3Q9T A;  4BJZ A;  3AE6 A;  2CVJ A;  4OPD A;  2XYO A;  4X9M A;  1L9D A;  4OPU A;  4H2Q A;  4UDP A;  2EQ9 A;  2X99 A;  3NIX A;  3H8I A;  3PVC A;  1BGN A;  4D04 A;  4ADW A;  2JAE A;  4LA1 A;  4REK A;  1TYP A;  1JEH A;  3PS9 A;  4BK3 A;  4DSG A;  4A7A A;  1D4C A;  4B64 A;  4CRT A;  3P4Q A;  4U8I A;  3UKL A;  2APG A;  2Q7V A;  3AEA A;  2VOU A;  3CGE A;  3IHG A;  3LB8 A;  1L9C A;  3NN0 X;  3GSI A;  2BK5 A;  4NTE A;  1QJD A;  1LQT A;  2R0C A;  3C4N A;  4FK1 C;  3ITJ A;  3GM6 A;  1BWC A;  1OJ9 A;  1NPX A;  1TYT A;  2EQ6 A;  4B63 A;  4YSZ A;  5BRT A;  1E6E A;  4J56 A;  4K7Z A;  2ZZB A;  1CJ3 A;  3QSS A;  3UCL A;  1ZP0 A;  2V60 A;  4OCG A;  3FO3 A;  1FS8 A;  3ABV A;  3F29 A;  2XLT A;  2BAB A;  1DOE A;  5JCL A;  4NTC A;  2VRM A;  2YLW A;  3M13 A;  2VRL A;  1BVB A;  1TDE A;  1PXA A;  5KRQ A;  1IUX A;  1GT8 A;  5EBK A;  4Q4U A;  4J36 A;  4AP1 A;  2BYB A;  1N4U A;  2BXS A;  1N4V A;  2C3D A;  2WPC A;  2WQY A;  2XLS A;  2Y6Q A;  2OT4 A;  1YQ4 A;  3OZ2 A;  2XDO A;  1PBD A;  4N9X A;  2WES A;  1VDC A;  2OLO A;  3NNE A;  4RG4 A;  3GDP A;  4ECH A;  3AB1 A;  2GMH A;  1FCD A;  1GEU A;  4FX9 A;  3GMB A;  1KNR A;  2BC1 A;  2WPF A;  2YVG A;  3D1C A;  4GUV A;  4YTP A;  2BS2 A;  1H82 A;  1KDG A;  2E81 A;  1H86 A;  3CGB A;  4O5U A;  2XFU A;  4WJY A;  4BUR A;  2X8H A;  3ATR A;  4Z25 A;  4IVM B;  2IVD A;  4YKF A;  5EB4 A;  1D4D A;  2XLU A;  4H4P A;  5HXI A;  4CNJ A;  3VRD B;  2Z5X A;  5KVI A;  2UZZ A;  2YR5 A;  2XFN A;  1FT5 A;  3C4A A;  2E1M A;  4J34 A;  3NTD A;  1W4X A;  4JDR A;  1DJQ A;  4U2S A;  4GRT A;  3UKF A;  1RYI A;  4O5Q A;  3VQR A;  4OVI A;  3UKA A;  3SM8 A;  4WX1 A;  1M6I A;  3KD9 A;  4GR1 A;  2WHD A;  1FL2 A;  4IVO B;  4NEW A;  5FS7 A;  1TDN A;  2H89 A;  3AE3 A;  1FOH A;  1H84 A;  1YY5 A;  2RGJ A;  3SCE A;  1COY A;  2RGH A;  4J57 A;  3UP5 A;  2AAQ A;  4K22 A;  2BAC A;  1FEA A;  1BGJ A;  4GDE A;  1B37 A;  4B66 A;  3DGZ A;  4I58 A;  1RSG A;  3AEC A;  2YWL A;  3AXB A;  4Y4N A;  1H7X A;  4H4R A;  1XAN A;  2A87 A;  4YTN A;  1FEC A;  1NAA A;  3KLJ A;  3LZX A;  2GEW A;  2YLZ A;  3B3R A;  3LJP A;  2WEU A;  1CC6 A;  5JCM A;  3CTY A;  1O94 A;  2X8G A;  1GAL A;  2J3N A;  1S2Y A;  3BHK A;  2V6O A;  3QJ4 A;  3LGQ A;  5IQ1 A;  3GRT A;  1N1P A;  2V5Z A;  4IA6 A;  4EQS A;  2YAU A;  4L3X A;  2GB0 A;  2WOV A;  2NVK X;  2OA1 A;  1Q9I A;  2Q6U A;  1D7L A;  1KSS A;  2YG7 A;  3BNJ A;  1GET A;  2C70 A;  4A5L A;  2XLP A;  4RG3 A;  1EL9 A;  4U8M A;  2YG4 A;  3DJE A;  4H2R A;  4CCQ A;  1LJ1 A;  4K5S A;  3O0H A;  4OPT A;  4A6N A;  1FEB A;  3BNG A;  4A9W A;  2GV8 A;  4B65 A;  5KVH A;  2BXR A;  1CC4 A;  4BK1 A;  1S2Q A;  1KSU A;  3VR8 A;  3GYI A;  2QA2 A;  2V61 A;  2E5V A;  3RHA A;  3S7W A;  4H7U A;  1GXF A;  1DXL A;  4Z2U A;  1GRT A;  3EPT A;  1TRB A;  3CGC A;  1ZMD A;  1LPF A;  2OAL A;  5KOX A;  3CGD A;  4FK1 A;  5C2T A;  5IPY A;  2XVH A;  2BA9 A;  3P4S A;  4J33 A;  4LII A;  4GDP A;  3UTF A;  3AE5 A;  3FMW A;  3VRB A;  1CHU A;  1M1Q A;  1QO8 A;  1O95 A;  2BS4 A;  1ZDL A;  2CFY A;  2HQM A;  4Y4M A;  4Z26 A;  3BNH A;  2FJB A;  3SXQ A;  2FJD A;  2W0H A;  3HZL A;  3K7T A;  3UOV A;  3LXD A;  5BVA A;  1GPE A;  3NYE A;  1CJC A;  5LV9 A;  2RF7 A;  3ISH A;  5FS9 A;  2WDQ A;  1DJN A;  2ARD A;  4C5O A;  1PDH A;  1VG0 A;  3L8K A;  4CBQ A;  4X4J A;  3AYI A;  2WOW A;  1QDB A;  4A65 A;  3NK1 X;  2WBA A;  2YM1 A;  3SFE A;  3GYJ A;  3AYJ A;  1F6M A;  2GR3 A;  3IF9 A;  1F8W A;  2PYX A;  1GRA A;  3AD9 B;  4OPI A;  3VRA A;  3UTE A;  3AE2 A;  1PXC A;  4BV6 A;  4DNA A;  2XVI A;  3RED A;  4Z2T A;  2FJE A;  3KU9 A;  3NLC A;  4A99 A;  3GWF A;  1CL0 A;  3NTA A;  1M1R A;  3OC4 A;  1CJ2 A;  2VVL A;  2X8C A;  2GMJ A;  2NPX A;  3CNT A;  4J31 A;  4B67 A;  1B5Q A;  1Z6L A;  1ZY8 A;  3AEE A;  4DSH A;  2C7G A;  1OJA A;  1K4Q A;  2H88 A;  1RP0 A;  1K0L A;  1BKW A;  2I0Z A;  2ZZ0 A;  5IQ4 A;  1LV0 A;  2GR2 A;  4XXG A;  2TPR A;  2C76 A;  3ADA B;  3R9U A;  3NT6 A;  4YKG A;  3II4 A;  4H2N A;  2ACZ A;  3ALL A;  1KF6 A;  4U8L A;  3F8D A;  1UKV G;  3GWD A;  4H4S A;  2QAE A;  4P9S A;  2C64 A;  2WET A;  4BK2 A;  1NHS A;  3GRS A;  4TM0 A;  3F8R A;  1H6V A;  2ZBW A;  3EAO A;  1GRH A;  1Q1R A;  2BCP A;  3CIR A;  3H8L A;  5U25 A;  3UTG A;  3ZYX A;  1NG4 A;  4AOS A;  2YLT A;  4Z2R A;  3UKK A;  1D7Y A;  3BI2 A;  1ZX9 A;  1JNZ A;  4UDR A;  4U2L A;  2EQ7 A;  4PAA A;  1XHC A;  2YLR A;  3FG2 P;  2OLN A;  4L3Z A;  4U8J A;  3EF6 A;  1OAH A;  1OJC A;  3BHF A;  1GTE A;  3AYL A;  1ZMC A;  2VQ7 A;  4X9N A;  1P2H A;  4AT2 A;  1HYU A;  4CCR A;  1BF3 A;  4ICY A;  1GSN A;  1FT6 A;  1AOG A;  2DKI A;  3EAN A;  2R46 A;  2V3A A;  2Y6R A;  4M52 A;  4C3Y A;  4JN9 A;  3P4P A;  4B69 A;  4B68 A;  4K2X A;  1JNI A;  1IUU A;  1PJ7 A;  3B6D A;  1GER A;  1TDF A;  2BC0 A;  3QVP A;  2YLS A;  3UKQ A;  2R0P A;  2A89 A;  3M0O A;  1NDA A;  5EB5 A;  1XDI A;  3AD7 B;  3GDN A;  4YSX A;  5CKU A;  3IWA A;  4H4T A;  3QVR A;  4YTM A;  5J7X A;  3UOX A;  2FBW A;  2WP9 A;  3CPI G;  4H4Q A; 
#chains in the Genus database with same CATH topology
 4WCT A;  1F8S A;  5M10 A;  4UP3 A;  1OJD A;  3CPH G;  2XLR A;  1F3P A;  1CJ4 A;  2WU2 A;  3KA7 A;  1Y0P A;  3I6D A;  3SGL A;  3T0K A;  1H81 A;  3IHM A;  3S61 A;  3BNF A;  4U8K A;  1PBC A;  4JNA A;  3VR9 A;  1DOD A;  1ONF A;  4JQ9 A;  2WU5 A;  4AP3 A;  3G5Q A;  3DK8 A;  1GRE A;  3NYC A;  4H4Z A;  3LZW A;  2YQU A;  3HYV A;  1K0J A;  2C67 A;  4KX6 A;  3UBR A;  2YG5 A;  3E1T A;  1JNR A;  3NK0 X;  2Q0K A;  4NTD A;  5HYM A;  4LU6 A;  3C96 A;  3QFA A;  3DJG X;  5DBJ A;  3LG1 A;  3DJJ A;  3ICT A;  4L3Y A;  3V3N A;  4CNK A;  5L46 A;  2B7S A;  4Q1O A;  3HYX A;  3RP7 A;  1JRY A;  2BS3 A;  1VRQ B;  3V3O A;  5JCN A;  3UP4 A;  1KNP A;  4G74 A;  1B4V A;  4JNQ A;  4KPR A;  1EL5 A;  1PS9 A;  3K7Q X;  1L9E A;  4C74 A;  4Z43 A;  4U2T A;  4ZN0 A;  1JRX A;  1GND A;  3P1W A;  1NG3 A;  1Y56 A;  2YG6 A;  4Z24 A;  4CY6 A;  1YQZ A;  1REO A;  2WOI A;  2VQB A;  1H83 A;  4DGK A;  4H50 A;  4TM3 A;  3CND A;  4H4U A;  1S3B A;  3QSM A;  3DK4 A;  2V3B A;  1NHR A;  3K30 A;  3COX A;  5BUK A;  2R4E A;  4H2P A;  2B9X A;  2GQF A;  4CY8 A;  5HHF A;  3I3L A;  1SEZ A;  5J60 A;  3L1T A;  2OAM A;  3AE7 A;  4AT0 A;  1PHH A;  3BI4 A;  2A8X A;  2YVF A;  5FS6 A;  2QCU A;  1X31 B;  2GH5 A;  4YT0 A;  1SP3 A;  4C77 A;  1FS7 A;  2K3V A;  2O9Z A;  4FDC B;  3T37 A;  2YM2 A;  3V76 A;  3LAD A;  4A6N B;  3CNJ A;  5M0Z A;  5GRT A;  2B76 A;  2B9W A;  2RGO A;  3ICS A;  2GR1 A;  3CPJ G;  1DNC A;  4G9K A;  1E1L A;  3SYI A;  5BUL A;  2E80 A;  1E1N A;  1PJ6 A;  1VQW A;  3KKJ A;  3SQP A;  1L0V A;  1FS9 A;  2XCG A;  4XWZ A;  5JCK A;  5KWF A;  1V59 A;  3URH A;  5U63 A;  5TR3 A;  1IJH A;  2F5Z A;  3OWM A;  3NG7 X;  4NEV A;  4Q5C A;  2BK4 A;  2FJA A;  1NHQ A;  3TOR A;  2AR8 A;  2XVJ A;  4II3 A;  1ELI A;  4A79 A;  4J2W A;  4Y4L A;  4EMJ A;  2LFC A;  2JKC A;  4H4W A;  3RP8 A;  4USR A;  4TLX A;  5KXJ A;  1IUT A;  1TDK A;  2RAB A;  1PXB A;  3ZDN A;  1PBF A;  4Z44 A;  2JK6 A;  3DME A;  1PBE A;  2PHH A;  2BCG G;  5ER0 A;  3RKH A;  4L38 A;  3AEG A;  2YR4 A;  4K8D A;  2IID A;  2XVF A;  4C3X A;  4YXD A;  3FBS A;  4GF7 A;  3SZ0 A;  1JRZ A;  3UKP A;  2GF3 A;  3JSK A;  4OPL A;  1E1K A;  3Q6J A;  1PJ5 A;  2DKH A;  2YR6 A;  1PN0 A;  2JB2 A;  2X3N A;  1CBO A;  2WDV A;  4UDQ A;  3AE4 A;  4D03 A;  4EIQ A;  4H4Y A;  4EM4 A;  3QSE A;  4YSH A;  1ZKQ A;  1LTX R;  2E4G A;  3GD4 A;  2RDZ A;  3F8P A;  4TLZ A;  4EQX A;  4USQ A;  1E1M A;  1TDO A;  4Q5B A;  3AWI A;  4YSY A;  1P2E A;  2YLX A;  1O5W A;  3GYX A;  3CN8 A;  3DH9 A;  3TTB A;  3S5W A;  1H7W A;  3DGH A;  3GMC A;  2X50 A;  2R45 A;  5FMH A;  2Q0L A;  3M12 A;  3NH3 X;  3BI5 A;  3FIM B;  3UTH A;  3AE8 A;  1MOK A;  3NYF A;  4NZH A;  1GES A;  4U8P A;  1EBD A;  2VVM A;  2C65 A;  4MJW A;  1GTH A;  1NEN A;  5C3J A;  5JCI A;  3ICR A;  2QA1 A;  4Q17 A;  1CC2 A;  3KVE A;  3ATQ A;  2WP5 A;  3DA1 A;  1GRF A;  1QLB A;  2C75 A;  3K7M X;  4RSL A;  4II2 A;  1JOA A;  3DK9 A;  2C73 A;  1BZL A;  1K0I A;  2CUL A;  3NKS A;  4BJY A;  4E0V A;  1DOB A;  2WP6 A;  3ALM A;  3CNP A;  2VVL G;  2XVE A;  3AEB A;  2GQW A;  3P4R A;  3G5R A;  4HB9 A;  3G5S A;  5KMR A;  2C3C A;  2GRT A;  3QFB A;  3ALJ A;  3SFD A;  4YWO A;  4PAB A;  4U8O A;  3AD8 B;  3KPF A;  4EIP A;  1F8R A;  3RNM A;  2CDU A;  1GRG A;  2YG3 A;  4GCM A;  3BNU A;  1GRB A;  4IA5 A;  3AEF A;  3L1R A;  3NRN A;  2VZ2 A;  1PBB A;  2B9Y A;  3D1I A;  2WDR A;  3AE1 A;  2R9Z A;  3UOY A;  1NHP A;  1MO9 A;  1OJT A;  1ZOY A;  3SZW A;  1XPQ A;  1GU6 A;  2YVJ A;  2VR0 A;  3UU9 A;  1IUV A;  2R0G A;  4EMW A;  1B8S A;  3UOZ A;  1MXT A;  2C72 A;  2BK3 A;  1D4E A;  2JB1 A;  4IV9 A;  5EOW A;  3CMM A;  1EL7 A;  4APN A;  3NHO X;  2GVC A;  3AED A;  4I59 A;  5U1O A;  2Z5Y A;  1Q1W A;  5CQF A;  2GAG B;  5GSN A;  2XFO A;  1VG9 A;  1LQU A;  1S3E A;  4K5R A;  4EM3 A;  2GAH B;  5FS8 A;  1IUS A;  2JBV A;  4TM1 A;  4B1B A;  2WS3 A;  2XFQ A;  1IUW A;  3PO7 A;  4JY2 A;  5HY5 A;  2C66 A;  2B7R A;  4JY3 A;  3H4K A;  3NN6 X;  4EQR A;  3BNM A;  3D8X A;  2AQJ A;  3NK2 X;  1KFY A;  2R4J A;  1ZOV A;  2BRA A;  3SXI A;  4XWR A;  3P9U A;  1JU2 A;  1GOS A;  4EQW A;  4H4X A;  4AOX A;  1M1P A;  1E7P A;  4H4V A;  4U8N A;  4HA6 A;  3CNS A;  4G6G A;  1DOC A;  2J7A A;  5KOW A;  1LVL A;  2EQ8 A;  4Q0T A;  2ZO5 A;  3LOV A;  4OPG A;  3IC9 A;  3GD3 A;  2IVE A;  1ZK7 A;  1YKJ A;  2JB3 A;  3MMO A;  1CF3 A;  1NEK A;  1N4W A;  2GR0 A;  1GV4 A;  3DJD A;  4ZCD A;  2XFP A;  3FPZ A;  1Y56 B;  2C4C A;  4EMI A;  2ZZC A;  4TM4 A;  3WE0 A;  4ZCC A;  1M64 A;  3NGC X;  3RP6 A;  2WPE A;  3T31 A;  2TMD A;  3UKH A;  1E39 A;  1EL8 A;  1YQ3 A;  1D5T A;  4OPC A;  3AE9 A;  3Q9T A;  4BJZ A;  3AE6 A;  2CVJ A;  4OPD A;  2XYO A;  4X9M A;  1L9D A;  4OPU A;  4H2Q A;  4UDP A;  2EQ9 A;  2X99 A;  3NIX A;  3H8I A;  3PVC A;  1BGN A;  4D04 A;  4NWZ A;  4ADW A;  2JAE A;  4LA1 A;  4REK A;  1TYP A;  1JEH A;  3PS9 A;  4BK3 A;  4DSG A;  4A7A A;  1D4C A;  4B64 A;  4CRT A;  3P4Q A;  4U8I A;  3UKL A;  2APG A;  2Q7V A;  3AEA A;  2VOU A;  3CGE A;  3IHG A;  3LB8 A;  1L9C A;  3NN0 X;  3GSI A;  2BK5 A;  4NTE A;  1QJD A;  1LQT A;  2R0C A;  3C4N A;  4FK1 C;  3ITJ A;  3GM6 A;  1BWC A;  1OJ9 A;  1NPX A;  1TYT A;  2EQ6 A;  4B63 A;  4YSZ A;  5BRT A;  1E6E A;  4J56 A;  4K7Z A;  2ZZB A;  1CJ3 A;  3QSS A;  3UCL A;  1ZP0 A;  2V60 A;  4OCG A;  3FO3 A;  1FS8 A;  3ABV A;  3F29 A;  2XLT A;  2BAB A;  1DOE A;  5JCL A;  4NTC A;  2VRM A;  2YLW A;  3M13 A;  2VRL A;  3KPK A;  1BVB A;  1TDE A;  1PXA A;  5KRQ A;  1IUX A;  1GT8 A;  5EBK A;  4Q4U A;  4J36 A;  4AP1 A;  2BYB A;  1N4U A;  2BXS A;  1N4V A;  2C3D A;  2WPC A;  2WQY A;  3SX6 A;  2XLS A;  2Y6Q A;  2OT4 A;  1YQ4 A;  3OZ2 A;  2XDO A;  1PBD A;  4N9X A;  2WES A;  1VDC A;  2OLO A;  3NNE A;  4RG4 A;  3GDP A;  4ECH A;  3AB1 A;  2GMH A;  1FCD A;  1GEU A;  4FX9 A;  3GMB A;  1KNR A;  2BC1 A;  2WPF A;  2YVG A;  3D1C A;  4GUV A;  4YTP A;  2BS2 A;  1H82 A;  1KDG A;  2E81 A;  1H86 A;  3CGB A;  4O5U A;  2XFU A;  4WJY A;  4BUR A;  2X8H A;  3ATR A;  4Z25 A;  4IVM B;  2IVD A;  4YKF A;  5EB4 A;  1D4D A;  2XLU A;  4H4P A;  5HXI A;  4CNJ A;  3VRD B;  2Z5X A;  5KVI A;  2UZZ A;  3T2Y A;  2YR5 A;  2XFN A;  1FT5 A;  3C4A A;  2E1M A;  4J34 A;  3NTD A;  1W4X A;  4JDR A;  1DJQ A;  4U2S A;  4GRT A;  3UKF A;  1RYI A;  4O5Q A;  3VQR A;  4OVI A;  3UKA A;  3SM8 A;  4WX1 A;  1M6I A;  3KD9 A;  4GR1 A;  2WHD A;  1FL2 A;  4IVO B;  4NEW A;  5FS7 A;  1TDN A;  2H89 A;  3AE3 A;  1FOH A;  1H84 A;  1YY5 A;  2RGJ A;  3SCE A;  1COY A;  2RGH A;  4J57 A;  3UP5 A;  2AAQ A;  4K22 A;  2BAC A;  1FEA A;  1BGJ A;  4GDE A;  1B37 A;  4B66 A;  3DGZ A;  4I58 A;  1RSG A;  3AEC A;  2YWL A;  3AXB A;  4Y4N A;  1H7X A;  4H4R A;  5KMQ A;  1XAN A;  2A87 A;  4YTN A;  3SZF A;  1FEC A;  1NAA A;  3KLJ A;  3LZX A;  2GEW A;  2YLZ A;  3B3R A;  3LJP A;  2WEU A;  1CC6 A;  5JCM A;  3CTY A;  1O94 A;  2X8G A;  1GAL A;  2J3N A;  1S2Y A;  3BHK A;  2V6O A;  3QJ4 A;  3LGQ A;  5IQ1 A;  3GRT A;  1N1P A;  2V5Z A;  4IA6 A;  4EQS A;  2YAU A;  4L3X A;  2GB0 A;  2WOV A;  2NVK X;  2OA1 A;  1Q9I A;  2Q6U A;  3T2Z A;  1D7L A;  1KSS A;  2YG7 A;  3BNJ A;  1GET A;  2C70 A;  4A5L A;  2XLP A;  4RG3 A;  1EL9 A;  4U8M A;  2YG4 A;  3DJE A;  4H2R A;  4CCQ A;  1LJ1 A;  4K5S A;  3O0H A;  4OPT A;  4A6N A;  1FEB A;  3BNG A;  4A9W A;  2GV8 A;  4B65 A;  5KMS A;  2BXR A;  5KVH A;  1CC4 A;  4BK1 A;  1S2Q A;  1KSU A;  3VR8 A;  3SZC A;  3GYI A;  2QA2 A;  2V61 A;  2E5V A;  3RHA A;  3T2K A;  3S7W A;  4H7U A;  1GXF A;  1DXL A;  4Z2U A;  1GRT A;  3EPT A;  1TRB A;  3CGC A;  1ZMD A;  1LPF A;  2OAL A;  4GAV A;  5KOX A;  3CGD A;  4FK1 A;  5C2T A;  5IPY A;  2XVH A;  2BA9 A;  3P4S A;  4J33 A;  4LII A;  4GDP A;  3UTF A;  3AE5 A;  3FMW A;  3VRB A;  1CHU A;  1M1Q A;  1QO8 A;  1O95 A;  2BS4 A;  1ZDL A;  2CFY A;  2HQM A;  4Y4M A;  4Z26 A;  3BNH A;  2FJB A;  3SXQ A;  2FJD A;  2W0H A;  3HZL A;  3K7T A;  3UOV A;  3LXD A;  5BVA A;  1GPE A;  3NYE A;  1CJC A;  5LV9 A;  2RF7 A;  3ISH A;  5FS9 A;  2WDQ A;  1DJN A;  2ARD A;  4C5O A;  1PDH A;  1VG0 A;  3L8K A;  5KMP A;  4CBQ A;  2CZS A;  4X4J A;  3AYI A;  2WOW A;  1QDB A;  4A65 A;  3NK1 X;  2WBA A;  2YM1 A;  3SFE A;  3GYJ A;  3AYJ A;  1F6M A;  2GR3 A;  3IF9 A;  1F8W A;  2PYX A;  1GRA A;  3AD9 B;  4OPI A;  3T14 A;  3VRA A;  3UTE A;  3AE2 A;  1PXC A;  4BV6 A;  4DNA A;  2XVI A;  3RED A;  4Z2T A;  2FJE A;  3KU9 A;  3NLC A;  4A99 A;  3GWF A;  1CL0 A;  3NTA A;  1M1R A;  3OC4 A;  1CJ2 A;  2VVL A;  2X8C A;  2GMJ A;  2NPX A;  3CNT A;  4J31 A;  4B67 A;  1B5Q A;  1Z6L A;  1ZY8 A;  3AEE A;  4DSH A;  5KNL A;  2C7G A;  1OJA A;  1K4Q A;  2H88 A;  1RP0 A;  1K0L A;  1BKW A;  2I0Z A;  2ZZ0 A;  3HYW A;  1LV0 A;  2GR2 A;  4XXG A;  5IQ4 A;  2TPR A;  2C76 A;  3ADA B;  3R9U A;  3NT6 A;  4YKG A;  3II4 A;  4H2N A;  2ACZ A;  3ALL A;  1KF6 A;  4U8L A;  3F8D A;  1UKV G;  3GWD A;  4H4S A;  2QAE A;  4P9S A;  2C64 A;  2WET A;  4BK2 A;  1NHS A;  3GRS A;  4TM0 A;  3F8R A;  1H6V A;  2ZBW A;  3EAO A;  1GRH A;  1Q1R A;  2BCP A;  3CIR A;  3H8L A;  5U25 A;  3UTG A;  3ZYX A;  1NG4 A;  4AOS A;  2YLT A;  4Z2R A;  3UKK A;  1D7Y A;  3BI2 A;  3SY4 A;  1ZX9 A;  1JNZ A;  4UDR A;  4GAP A;  4U2L A;  2EQ7 A;  4PAA A;  1XHC A;  2YLR A;  3FG2 P;  2OLN A;  4L3Z A;  4U8J A;  3EF6 A;  1OAH A;  1OJC A;  3BHF A;  2BRY A;  1GTE A;  3AYL A;  1ZMC A;  2VQ7 A;  4G6H A;  4X9N A;  1P2H A;  4NNJ A;  1HYU A;  4AT2 A;  4CCR A;  1BF3 A;  4ICY A;  1GSN A;  1FT6 A;  1AOG A;  2DKI A;  3EAN A;  2R46 A;  2V3A A;  2Y6R A;  4M52 A;  4C3Y A;  4JN9 A;  3P4P A;  4B69 A;  4B68 A;  4K2X A;  1JNI A;  1IUU A;  1PJ7 A;  3B6D A;  1GER A;  1TDF A;  2BC0 A;  3QVP A;  2YLS A;  4G73 A;  3UKQ A;  2R0P A;  2A89 A;  3M0O A;  1NDA A;  5EB5 A;  1XDI A;  3AD7 B;  3GDN A;  4YSX A;  5CKU A;  3IWA A;  4H4T A;  3QVR A;  4YTM A;  5J7X A;  3UOX A;  2FBW A;  2WP9 A;  3CPI G;  4H4Q A; 
#chains in the Genus database with same CATH homology
 4WCT A;  1F8S A;  5M10 A;  4UP3 A;  1OJD A;  3CPH G;  2XLR A;  1F3P A;  1CJ4 A;  2WU2 A;  3KA7 A;  1Y0P A;  3I6D A;  3SGL A;  3T0K A;  1H81 A;  3IHM A;  3S61 A;  3BNF A;  4U8K A;  1PBC A;  4JNA A;  3VR9 A;  1DOD A;  1ONF A;  4JQ9 A;  2WU5 A;  4AP3 A;  3G5Q A;  3DK8 A;  1GRE A;  3NYC A;  4H4Z A;  3LZW A;  2YQU A;  3HYV A;  1K0J A;  2C67 A;  4KX6 A;  3UBR A;  2YG5 A;  3E1T A;  1JNR A;  3NK0 X;  2Q0K A;  4NTD A;  5HYM A;  4LU6 A;  3C96 A;  3QFA A;  3DJG X;  5DBJ A;  3LG1 A;  3DJJ A;  3ICT A;  4L3Y A;  3V3N A;  4CNK A;  5L46 A;  2B7S A;  4Q1O A;  3HYX A;  3RP7 A;  1JRY A;  2BS3 A;  1VRQ B;  3V3O A;  5JCN A;  3UP4 A;  1KNP A;  4G74 A;  1B4V A;  4JNQ A;  4KPR A;  1EL5 A;  1PS9 A;  3K7Q X;  1L9E A;  4C74 A;  4Z43 A;  4U2T A;  4ZN0 A;  1JRX A;  1GND A;  3P1W A;  1NG3 A;  1Y56 A;  2YG6 A;  4Z24 A;  4CY6 A;  1YQZ A;  1REO A;  2WOI A;  2VQB A;  1H83 A;  4DGK A;  4H50 A;  4TM3 A;  3CND A;  4H4U A;  1S3B A;  3QSM A;  3DK4 A;  2V3B A;  1NHR A;  3K30 A;  3COX A;  5BUK A;  2R4E A;  4H2P A;  2B9X A;  2GQF A;  4CY8 A;  5HHF A;  3I3L A;  1SEZ A;  5J60 A;  3L1T A;  2OAM A;  3AE7 A;  4AT0 A;  1PHH A;  3BI4 A;  2A8X A;  2YVF A;  5FS6 A;  2QCU A;  1X31 B;  2GH5 A;  4YT0 A;  1SP3 A;  4C77 A;  1FS7 A;  2K3V A;  2O9Z A;  4FDC B;  3T37 A;  2YM2 A;  3V76 A;  3LAD A;  4A6N B;  3CNJ A;  5M0Z A;  5GRT A;  2B76 A;  2B9W A;  2RGO A;  3ICS A;  2GR1 A;  3CPJ G;  1DNC A;  4G9K A;  1E1L A;  3SYI A;  5BUL A;  2E80 A;  1E1N A;  1PJ6 A;  1VQW A;  3KKJ A;  3SQP A;  1L0V A;  1FS9 A;  2XCG A;  4XWZ A;  5JCK A;  5KWF A;  1V59 A;  3URH A;  5U63 A;  5TR3 A;  1IJH A;  2F5Z A;  3OWM A;  3NG7 X;  4NEV A;  4Q5C A;  2BK4 A;  2FJA A;  1NHQ A;  3TOR A;  2AR8 A;  2XVJ A;  4II3 A;  1ELI A;  4A79 A;  4J2W A;  4Y4L A;  4EMJ A;  2LFC A;  2JKC A;  4H4W A;  3RP8 A;  4USR A;  4TLX A;  5KXJ A;  1IUT A;  1TDK A;  2RAB A;  1PXB A;  3ZDN A;  1PBF A;  4Z44 A;  2JK6 A;  3DME A;  1PBE A;  2PHH A;  2BCG G;  5ER0 A;  3RKH A;  4L38 A;  3AEG A;  2YR4 A;  4K8D A;  2IID A;  2XVF A;  4C3X A;  4YXD A;  3FBS A;  4GF7 A;  3SZ0 A;  1JRZ A;  3UKP A;  2GF3 A;  3JSK A;  4OPL A;  1E1K A;  3Q6J A;  1PJ5 A;  2DKH A;  2YR6 A;  1PN0 A;  2JB2 A;  2X3N A;  1CBO A;  2WDV A;  4UDQ A;  3AE4 A;  4D03 A;  4EIQ A;  4H4Y A;  4EM4 A;  3QSE A;  4YSH A;  1ZKQ A;  1LTX R;  2E4G A;  3GD4 A;  2RDZ A;  3F8P A;  4TLZ A;  4EQX A;  4USQ A;  1E1M A;  1TDO A;  4Q5B A;  3AWI A;  4YSY A;  1P2E A;  2YLX A;  1O5W A;  3GYX A;  3CN8 A;  3DH9 A;  3TTB A;  3S5W A;  1H7W A;  3DGH A;  3GMC A;  2X50 A;  2R45 A;  5FMH A;  2Q0L A;  3M12 A;  3NH3 X;  3BI5 A;  3FIM B;  3UTH A;  3AE8 A;  1MOK A;  3NYF A;  4NZH A;  1GES A;  4U8P A;  1EBD A;  2VVM A;  2C65 A;  4MJW A;  1GTH A;  1NEN A;  5C3J A;  5JCI A;  3ICR A;  2QA1 A;  4Q17 A;  1CC2 A;  3KVE A;  3ATQ A;  2WP5 A;  3DA1 A;  1GRF A;  1QLB A;  2C75 A;  3K7M X;  4RSL A;  4II2 A;  1JOA A;  3DK9 A;  2C73 A;  1BZL A;  1K0I A;  2CUL A;  3NKS A;  4BJY A;  4E0V A;  1DOB A;  2WP6 A;  3ALM A;  3CNP A;  2VVL G;  2XVE A;  3AEB A;  2GQW A;  3P4R A;  3G5R A;  4HB9 A;  3G5S A;  5KMR A;  2C3C A;  2GRT A;  3QFB A;  3ALJ A;  3SFD A;  4YWO A;  4PAB A;  4U8O A;  3AD8 B;  3KPF A;  4EIP A;  1F8R A;  3RNM A;  2CDU A;  1GRG A;  2YG3 A;  4GCM A;  3BNU A;  1GRB A;  4IA5 A;  3AEF A;  3L1R A;  3NRN A;  2VZ2 A;  1PBB A;  2B9Y A;  3D1I A;  2WDR A;  3AE1 A;  2R9Z A;  3UOY A;  1NHP A;  1MO9 A;  1OJT A;  1ZOY A;  3SZW A;  1XPQ A;  1GU6 A;  2YVJ A;  2VR0 A;  3UU9 A;  1IUV A;  2R0G A;  4EMW A;  1B8S A;  3UOZ A;  1MXT A;  2C72 A;  2BK3 A;  1D4E A;  2JB1 A;  4IV9 A;  5EOW A;  3CMM A;  1EL7 A;  4APN A;  3NHO X;  2GVC A;  3AED A;  4I59 A;  5U1O A;  2Z5Y A;  1Q1W A;  5CQF A;  2GAG B;  5GSN A;  2XFO A;  1VG9 A;  1LQU A;  1S3E A;  4K5R A;  4EM3 A;  2GAH B;  5FS8 A;  1IUS A;  2JBV A;  4TM1 A;  4B1B A;  2WS3 A;  2XFQ A;  1IUW A;  3PO7 A;  4JY2 A;  5HY5 A;  2C66 A;  2B7R A;  4JY3 A;  3H4K A;  3NN6 X;  4EQR A;  3BNM A;  3D8X A;  2AQJ A;  3NK2 X;  1KFY A;  2R4J A;  1ZOV A;  2BRA A;  3SXI A;  4XWR A;  3P9U A;  1JU2 A;  1GOS A;  4EQW A;  4H4X A;  4AOX A;  1M1P A;  1E7P A;  4H4V A;  4U8N A;  4HA6 A;  3CNS A;  4G6G A;  1DOC A;  2J7A A;  5KOW A;  1LVL A;  2EQ8 A;  4Q0T A;  2ZO5 A;  3LOV A;  4OPG A;  3IC9 A;  3GD3 A;  2IVE A;  1ZK7 A;  1YKJ A;  2JB3 A;  3MMO A;  1CF3 A;  1NEK A;  1N4W A;  2GR0 A;  1GV4 A;  3DJD A;  4ZCD A;  2XFP A;  3FPZ A;  1Y56 B;  2C4C A;  4EMI A;  2ZZC A;  4TM4 A;  3WE0 A;  4ZCC A;  1M64 A;  3NGC X;  3RP6 A;  2WPE A;  3T31 A;  2TMD A;  3UKH A;  1E39 A;  1EL8 A;  1YQ3 A;  1D5T A;  4OPC A;  3AE9 A;  3Q9T A;  4BJZ A;  3AE6 A;  2CVJ A;  4OPD A;  2XYO A;  4X9M A;  1L9D A;  4OPU A;  4H2Q A;  4UDP A;  2EQ9 A;  2X99 A;  3NIX A;  3H8I A;  3PVC A;  1BGN A;  4D04 A;  4NWZ A;  4ADW A;  2JAE A;  4LA1 A;  4REK A;  1TYP A;  1JEH A;  3PS9 A;  4BK3 A;  4DSG A;  4A7A A;  1D4C A;  4B64 A;  4CRT A;  3P4Q A;  4U8I A;  3UKL A;  2APG A;  2Q7V A;  3AEA A;  2VOU A;  3CGE A;  3IHG A;  3LB8 A;  1L9C A;  3NN0 X;  3GSI A;  2BK5 A;  4NTE A;  1QJD A;  1LQT A;  2R0C A;  3C4N A;  4FK1 C;  3ITJ A;  3GM6 A;  1BWC A;  1OJ9 A;  1NPX A;  1TYT A;  2EQ6 A;  4B63 A;  4YSZ A;  5BRT A;  1E6E A;  4J56 A;  4K7Z A;  2ZZB A;  1CJ3 A;  3QSS A;  3UCL A;  1ZP0 A;  2V60 A;  4OCG A;  3FO3 A;  1FS8 A;  3ABV A;  3F29 A;  2XLT A;  2BAB A;  1DOE A;  5JCL A;  4NTC A;  2VRM A;  2YLW A;  3M13 A;  2VRL A;  3KPK A;  1BVB A;  1TDE A;  1PXA A;  5KRQ A;  1IUX A;  1GT8 A;  5EBK A;  4Q4U A;  4J36 A;  4AP1 A;  2BYB A;  1N4U A;  2BXS A;  1N4V A;  2C3D A;  2WPC A;  2WQY A;  3SX6 A;  2XLS A;  2Y6Q A;  2OT4 A;  1YQ4 A;  3OZ2 A;  2XDO A;  1PBD A;  4N9X A;  2WES A;  1VDC A;  2OLO A;  3NNE A;  4RG4 A;  3GDP A;  4ECH A;  3AB1 A;  2GMH A;  1FCD A;  1GEU A;  4FX9 A;  3GMB A;  1KNR A;  2BC1 A;  2WPF A;  2YVG A;  3D1C A;  4GUV A;  4YTP A;  2BS2 A;  1H82 A;  1KDG A;  2E81 A;  1H86 A;  3CGB A;  4O5U A;  2XFU A;  4WJY A;  4BUR A;  2X8H A;  3ATR A;  4Z25 A;  4IVM B;  2IVD A;  4YKF A;  5EB4 A;  1D4D A;  2XLU A;  4H4P A;  5HXI A;  4CNJ A;  3VRD B;  2Z5X A;  5KVI A;  2UZZ A;  3T2Y A;  2YR5 A;  2XFN A;  1FT5 A;  3C4A A;  2E1M A;  4J34 A;  3NTD A;  1W4X A;  4JDR A;  1DJQ A;  4U2S A;  4GRT A;  3UKF A;  1RYI A;  4O5Q A;  3VQR A;  4OVI A;  3UKA A;  3SM8 A;  4WX1 A;  1M6I A;  3KD9 A;  4GR1 A;  2WHD A;  1FL2 A;  4IVO B;  4NEW A;  5FS7 A;  1TDN A;  2H89 A;  3AE3 A;  1FOH A;  1H84 A;  1YY5 A;  2RGJ A;  3SCE A;  1COY A;  2RGH A;  4J57 A;  3UP5 A;  2AAQ A;  4K22 A;  2BAC A;  1FEA A;  1BGJ A;  4GDE A;  1B37 A;  4B66 A;  3DGZ A;  4I58 A;  1RSG A;  3AEC A;  2YWL A;  3AXB A;  4Y4N A;  1H7X A;  4H4R A;  5KMQ A;  1XAN A;  2A87 A;  4YTN A;  3SZF A;  1FEC A;  1NAA A;  3KLJ A;  3LZX A;  2GEW A;  2YLZ A;  3B3R A;  3LJP A;  2WEU A;  1CC6 A;  5JCM A;  3CTY A;  1O94 A;  2X8G A;  1GAL A;  2J3N A;  1S2Y A;  3BHK A;  2V6O A;  3QJ4 A;  3LGQ A;  5IQ1 A;  3GRT A;  1N1P A;  2V5Z A;  4IA6 A;  4EQS A;  2YAU A;  4L3X A;  2GB0 A;  2WOV A;  2NVK X;  2OA1 A;  1Q9I A;  2Q6U A;  3T2Z A;  1D7L A;  1KSS A;  2YG7 A;  3BNJ A;  1GET A;  2C70 A;  4A5L A;  2XLP A;  4RG3 A;  1EL9 A;  4U8M A;  2YG4 A;  3DJE A;  4H2R A;  4CCQ A;  1LJ1 A;  4K5S A;  3O0H A;  4OPT A;  4A6N A;  1FEB A;  3BNG A;  4A9W A;  2GV8 A;  4B65 A;  5KMS A;  2BXR A;  5KVH A;  1CC4 A;  4BK1 A;  1S2Q A;  1KSU A;  3VR8 A;  3SZC A;  3GYI A;  2QA2 A;  2V61 A;  2E5V A;  3RHA A;  3T2K A;  3S7W A;  4H7U A;  1GXF A;  1DXL A;  4Z2U A;  1GRT A;  3EPT A;  1TRB A;  3CGC A;  1ZMD A;  1LPF A;  2OAL A;  4GAV A;  5KOX A;  3CGD A;  4FK1 A;  5C2T A;  5IPY A;  2XVH A;  2BA9 A;  3P4S A;  4J33 A;  4LII A;  4GDP A;  3UTF A;  3AE5 A;  3FMW A;  3VRB A;  1CHU A;  1M1Q A;  1QO8 A;  1O95 A;  2BS4 A;  1ZDL A;  2CFY A;  2HQM A;  4Y4M A;  4Z26 A;  3BNH A;  2FJB A;  3SXQ A;  2FJD A;  2W0H A;  3HZL A;  3K7T A;  3UOV A;  3LXD A;  5BVA A;  1GPE A;  3NYE A;  1CJC A;  5LV9 A;  2RF7 A;  3ISH A;  5FS9 A;  2WDQ A;  1DJN A;  2ARD A;  4C5O A;  1PDH A;  1VG0 A;  3L8K A;  5KMP A;  4CBQ A;  4X4J A;  3AYI A;  2WOW A;  1QDB A;  4A65 A;  3NK1 X;  2WBA A;  2YM1 A;  3SFE A;  3GYJ A;  3AYJ A;  1F6M A;  2GR3 A;  3IF9 A;  1F8W A;  2PYX A;  1GRA A;  3AD9 B;  4OPI A;  3T14 A;  3VRA A;  3UTE A;  3AE2 A;  1PXC A;  4BV6 A;  4DNA A;  2XVI A;  3RED A;  4Z2T A;  2FJE A;  3KU9 A;  3NLC A;  4A99 A;  3GWF A;  1CL0 A;  3NTA A;  1M1R A;  3OC4 A;  1CJ2 A;  2VVL A;  2X8C A;  2GMJ A;  2NPX A;  3CNT A;  4J31 A;  4B67 A;  1B5Q A;  1Z6L A;  1ZY8 A;  3AEE A;  4DSH A;  5KNL A;  2C7G A;  1OJA A;  1K4Q A;  2H88 A;  1RP0 A;  1K0L A;  1BKW A;  2I0Z A;  2ZZ0 A;  3HYW A;  1LV0 A;  2GR2 A;  4XXG A;  5IQ4 A;  2TPR A;  2C76 A;  3ADA B;  3R9U A;  3NT6 A;  4YKG A;  3II4 A;  4H2N A;  2ACZ A;  3ALL A;  1KF6 A;  4U8L A;  3F8D A;  1UKV G;  3GWD A;  4H4S A;  2QAE A;  4P9S A;  2C64 A;  2WET A;  4BK2 A;  1NHS A;  3GRS A;  4TM0 A;  3F8R A;  1H6V A;  2ZBW A;  3EAO A;  1GRH A;  1Q1R A;  2BCP A;  3CIR A;  3H8L A;  5U25 A;  3UTG A;  3ZYX A;  1NG4 A;  4AOS A;  2YLT A;  4Z2R A;  3UKK A;  1D7Y A;  3BI2 A;  3SY4 A;  1ZX9 A;  1JNZ A;  4UDR A;  4GAP A;  4U2L A;  2EQ7 A;  4PAA A;  1XHC A;  2YLR A;  3FG2 P;  2OLN A;  4L3Z A;  4U8J A;  3EF6 A;  1OAH A;  1OJC A;  3BHF A;  2BRY A;  1GTE A;  3AYL A;  1ZMC A;  2VQ7 A;  4G6H A;  4X9N A;  1P2H A;  4NNJ A;  1HYU A;  4AT2 A;  4CCR A;  1BF3 A;  4ICY A;  1GSN A;  1FT6 A;  1AOG A;  2DKI A;  3EAN A;  2R46 A;  2V3A A;  2Y6R A;  4M52 A;  4C3Y A;  4JN9 A;  3P4P A;  4B69 A;  4B68 A;  4K2X A;  1JNI A;  1IUU A;  1PJ7 A;  3B6D A;  1GER A;  1TDF A;  2BC0 A;  3QVP A;  2YLS A;  4G73 A;  3UKQ A;  2R0P A;  2A89 A;  3M0O A;  1NDA A;  5EB5 A;  1XDI A;  3AD7 B;  3GDN A;  4YSX A;  5CKU A;  3IWA A;  4H4T A;  3QVR A;  4YTM A;  5J7X A;  3UOX A;  2FBW A;  2WP9 A;  3CPI G;  4H4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...