2B7SA

R381k mutant of flavocytochrome c3
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVKGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fumarate reductase flavoprotein subunit
publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 192
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7sA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7sA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7sA03
4YKFA 1EL8A 2IVDA 2XLRA 3M12A 4YSYA 2XLPA 4TLXA 1D7LA 1CL0A 1D5TA 1S3BA 4CRTA 4U8KA 1CBOA 2R45A 2R9ZA 4A79A 3AD7B 1RYIA 5BUKA 5JCNA 2TPRA 5JCMA 2YM2A 2C70A 3II4A 3QSMA 3CPIG 4Y4LA 4XXGA 4L38A 2J3NA 2VVMA 4Z44A 2GMJA 4A5LA 1S2YA 4NEVA 2ARDA 4BJYA 2E4GA 4DSHA 4J31A 1OJTA 3DGZA 4NEWA 1UKVG 1IUXA 4PABA 3SFEA 1BZLA 4L3ZA 4O5UA 5C3JA 2YG6A 4J33A 4OPCA 3DK4A 4EQXA 3ABVA 1FECA 1F8WA 3BI5A 2JB2A 2CVJA 3DMEA 3G5RA 4U8NA 2JK6A 2V3AA 3FPZA 3VRBA 1BWCA 3QJ4A 1NHRA 1Y0PA 1XHCA 3EAOA 2C75A 2UZZA 1EL5A 1W4XA 1L0VA 4CY6A 3NTDA 4IV9A 1MOKA 4U8IA 5HHFA 3SQPA 5JCIA 1TDFA 2E80A 3AE9A 2OAMA 2BC0A 2YLSA 3K7QX 4H4VA 3AYIA 2E1MA 2WU2A 1N4WA 3UOZA 3L1RA 4ECHA 2BXRA 4C5OA 2X99A 1NEKA 4FX9A 3LG1A 1GESA 1L9EA 4DSGA 4B66A 4OPUA 1L9DA 4H2QA 4H4PA 1ZY8A 3KU9A 3GMCA 4K5RA 3PO7A 2C66A 2XVIA 2ACZA 2YLZA 3ALLA 3UCLA 3URHA 2WPCA 2APGA 5CQFA 2Q6UA 3DJGX 3BI2A 2YVFA 4JNAA 4YTNA 4YTMA 1LV0A 2EQ9A 4WX1A 2WHDA 2JAEA 2VZ2A 3P9UA 4H2NA 3L1TA 3T37A 5IQ4A 3AEBA 3AEFA 4A6NA 2WETA 1E6EA 1H81A 3P4PA 3F8RA 4JQ9A 2GQWA 2YM1A 3SM8A 3CPJG 3QFAA 4J2WA 3DJJA 2GVCA 1JRZA 3D8XA 2X3NA 4A9WA 1PBCA 2FJAA 4YKGA 3BI4A 1BGJA 4TM3A 3ADAB 2E5VA 3GMBA 4K8DA 2C72A 4YT0A 3AB1A 3SGLA 1ZKQA 1FEBA 3UP5A 1XANA 2C76A 4H2RA 5KXJA 2E81A 3G5QA 2BK4A 4Y4NA 1FEAA 3LZWA 1PDHA 4I59A 2X8HA 4JDRA 4CNJA 4UDQA 2I0ZA 4C74A 1O95A 1TDOA 2Q0KA 1GXFA 5EB5A 5DBJA 2GR1A 2VVLA 1GRAA 2B7SA 2B9WA 5FS9A 3GDPA 3LJPA 4PAAA 4OPDA 4B65A 2CDUA 4BK3A 4WJYA 1H7XA 2GMHA 4REKA 5J7XA 4B1BA 3CGDA 5L46A 2WP5A 2B7RA 1BGNA 5FS6A 1K0LA 2BABA 1H7WA 1COYA 3Q9TA 3R9UA 4DGKA 2Y6RA 1N4VA 5GSNA 4Z2TA 1AOGA 3IHMA 3LZXA 3NIXA 4CCQA 1GRHA 5C2TA 1LQTA 4K7ZA 2XVJA 4B67A 4KX6A 1QJDA 2V61A 1ZX9A 3M13A 3ICTA 4D03A 2YWLA 1ZMCA 4B69A 2XDOA 3UP4A 4ADWA 3BNFA 4IA6A 3GWDA 1CJ3A 2BK3A 2BCPA 4OPIA 2YVGA 3O0HA 4ZN0A 1KFYA 2DKHA 2WDRA 1FCDA 1PXCA 1GSNA 3P1WA 1E39A 1M6IA 3F8PA 2NVKX 3H4KA 4AT0A 3V3OA 3VR8A 4JY2A 2ZZBA 3F8DA 3K7MX 1NHPA 3H8LA 1Q1RA 2WU5A 2XVHA 2YG3A 3L8KA 4Z26A 2CULA 1BKWA 1M1RA 3ATRA 3GRSA 4GR1A 3UKQA 1IUUA 4YXDA 1E1KA 2YAUA 5BVAA 3AE5A 3BNMA 4H4UA 4BK1A 3DA1A 2LFCA 2XFNA 2R46A 1B4VA 1B37A 1PBBA 3AYLA 3AE1A 3ICSA 1IUVA 2Q7VA 3UTFA 3VRDB 4E0VA 3UKHA 2VQ7A 3BHFA 2RDZA 1E1LA 4CNKA 1GRTA 3LXDA 2YG7A 3UKAA 2A89A 1M64A 4P9SA 1OJCA 3ATQA 2WOIA 4Z2RA 3OC4A 1HYUA 1QO8A 3FBSA 2V5ZA 2PYXA 3BNHA 4C3XA 3AE6A 4CY8A 3P4SA 2GF3A 4X4JA 1JRYA 1GT8A 1O94A 3COXA 3NT6A 4AP1A 1PN0A 1Q9IA 2GH5A 2GV8A 3C96A 4EMJA 3NYFA 4NZHA 1YQ3A 3RKHA 4K2XA 4X9NA 4A7AA 3S5WA 5HY5A 3ISHA 3AEDA 1ZP0A 2BS4A 1ZDLA 2JKCA 2O9ZA 2OALA 2R4EA 1LTXR 1CC4A 1E1NA 1PJ6A 1LJ1A 4L3XA 4USQA 3H8IA 4U8PA 4DNAA 3CNDA 3I6DA 3GD4A 1PBFA 1DOCA 1JU2A 3FMWA 3DJDA 4BV6A 1KNPA 1TRBA 2QCUA 3UU9A 2ZBWA 2RF7A 3SXQA 2RABA 2XVEA 2TMDA 5TR3A 3AEGA 2XYOA 3OZ2A 4FK1A 4RSLA 3WE0A 1ELIA 3LADA 1YKJA 2WESA 2YR5A 3CGBA 3JSKA 3NKSA 1OAHA 3EF6A 4LIIA 4GUVA 4RG4A 5FS7A 3QFBA 4OPGA 1GRGA 4YSHA 1VQWA 1L9CA 2CFYA 2VRLA 3NN0X 2B76A 2JBVA 4NTCA 1NHSA 1ONFA 4GCMA 1V59A 4IA5A 2Q0LA 4H4YA 2RGOA 5EOWA 1S3EA 4FK1C 1BVBA 3DH9A 2R0GA 4AP3A 3K30A 4J57A 5IQ1A 4Z25A 1OJAA 2XLSA 1VG0A 3GYIA 3KLJA 2A87A 4U8MA 4Q17A 2R4JA 4CCRA 1GNDA 4Z2UA 3TORA 1DNCA 1X31B 2IVEA 3KVEA 3C4AA 1M1QA 4HA6A 3CNPA 4APNA 1E7PA 1GPEA 2J7AA 4MJWA 2GR3A 3GSIA 5KVHA 2AR8A 1MO9A 4ICYA 4EIPA 1PJ5A 4YTPA 1D4DA 4IVMB 3B6DA 4GF7A 2RGHA 4LA1A 1IUTA 1OJDA 3ZYXA 2VOUA 4USRA 1ZOYA 3E1TA 1NPXA 1DODA 3M0OA 4YSZA 1DOEA 4ZCDA 3PS9A 2WP6A 4O5QA 2ZO5A 1LPFA 2GAHB 3UOXA 2OLOA 1P2EA 2BC1A 4NTEA 1RP0A 4BK2A 2X8GA 3B3RA 2WDQA 3C4NA 2ZZ0A 3RP8A 1IJHA 3AE2A 3UTGA 2Z5XA 1S2QA 2JB1A 1CJ2A 2C64A 4LU6A 3V3NA 3GDNA 1KSUA 3AD9B 4D04A 3KPFA 2F5ZA 1KNRA 2GAGB 2QA2A 4U8OA 4N9XA 1H82A 3ITJA 4IVOB 1NDAA 1YY5A 2FJEA 3AYJA 1FT5A 2YR6A 4H4SA 2OA1A 2DKIA 2X50A 4Q0TA 1REOA 4TLZA 5BRTA 2XFOA 4B68A 3FIMB 1Z6LA 4H4ZA 4C77A 3QSEA 3IWAA 3IC9A 4NTDA 2OT4A 1PXAA 2WBAA 2EQ7A 3UOYA 2YQUA 3AE3A 5U1OA 4H4RA 2XFUA 3RHAA 3DK8A 2XFQA 3HZLA 4J34A 1MXTA 4B63A 3CN8A 4U8JA 1KDGA 1PJ7A 1K0IA 3UTEA 4EMIA 3NHOX 2GB0A 3FG2P 1H6VA 1GRFA 4RG3A 1GEUA 1TYPA 2YLRA 2BXSA 4AOSA 5IPYA 5HXIA 3UKFA 3DK9A 4FDCB 4OPTA 1IUWA 1LVLA 3REDA 4EM4A 1JOAA 1E1MA 4TM1A 4ZCCA 4AT2A 2C65A 4H7UA 4UDPA 1PS9A 1BF3A 3UKPA 2C3DA 4I58A 2YLXA 3D1IA 1GREA 1NENA 4H4WA 3S61A 4EQRA 2EQ8A 4H4TA 2QA1A 4A6NB 3DGHA 3UBRA 1CJCA 1EBDA 1GU6A 1Y56A 2WDVA 1H84A 2WOWA 2YLTA 3CNSA 3CTYA 3K7TA 2BCGG 2QAEA 4Q5CA 2V3BA 1K0JA 1VG9A 2YVJA 2WPEA 1FS8A 2XLTA 3BHKA 4H4XA 3OWMA 3NG7X 1GTHA 2PHHA 3UKKA 4GRTA 2YR4A 3NYCA 3G5SA 3VQRA 2XFPA 3LOVA 4GDEA 5KVIA 4TM0A 3GM6A 5KOWA 2BK5A 4YWOA 3RNMA 1EL7A 4K22A 1Q1WA 4XWRA 1QLBA 2R0PA 1GRBA 4YSXA 4Q1OA 2C67A 2WPFA 2JB3A 2BYBA 2C7GA 4JN9A 4HB9A 2X8CA 3CIRA 3GRTA 3SCEA 3LB8A 3PVCA 1KSSA 4M52A 2WP9A 2BS3A 2C3CA 3NNEA 4Y4MA 4TM4A 1B5QA 1VRQB 4H50A 1GTEA 3EPTA 3NRNA 1VDCA 2W0HA 3AECA 5FS8A 4OCGA 3I3LA 2B9YA 1NG4A 2FBWA 4EQWA 5FMHA 2FJBA 3DJEA 3NYEA 1TDNA 4Z43A 2Z5YA 1YQ4A 1JNZA 4EQSA 4X9MA 2YG5A 5HYMA 4KPRA 2BS2A 2GEWA 3Q6JA 1GALA 1H83A 1DJNA 3GWFA 3MMOA 3AD8B 4Q4UA 1FS7A 3CNJA 3D1CA 3FO3A 4K5SA 1N1PA 3RP7A 3VRAA 3GYXA 2EQ6A 3UKLA 1JNIA 5EBKA 1GERA 3AEAA 3GYJA 3F29A 2R0CA 3NLCA 2RGJA 2AAQA 4B64A 1JNRA 2FJDA 3NK1X 3TTBA 1EL9A 5J60A 1KF6A 4U2SA 3GD3A 2V6OA 4U2TA 2WOVA 3V76A 2VRMA 4Q5BA 1NAAA 1F8RA 1D4CA 1GOSA 2OLNA 2XLUA 3KKJA 5U63A 5M0ZA 1CJ4A 5EB4A 3AE8A 1RSGA 1O5WA 2WQYA 5U25A 3LGQA 1PBDA 4OPLA 1NHQA 2VR0A 1DXLA 4WCTA 1K4QA 4EM3A 4H2PA 1FS9A 1DJQA 1F8SA 1SEZA 2GRTA 4GDPA 2GR2A 4J56A 1M1PA 1F3PA 1FOHA 3EANA 2K3VA 2H89A 2AQJA 3ALMA 1FL2A 3BNJA 3AE7A 1TDKA 1Y56B 1JRXA 3BNGA 3ICRA 2VVLG 4J36A 2IIDA 1DOBA 4CBQA 4L3YA 4BURA 3QVPA 3IHGA 1F6MA 3CPHG 3AEEA 1D4EA 2H88A 5GRTA 3S7WA 1YQZA 2V60A 4EMWA 1GV4A 1D7YA 3NK0X 1OJ9A 2HQMA 4UDRA 3ALJA 3P4RA 1ZOVA 2XVFA 5M10A 1P2HA 3BNUA 4JY3A 1PHHA 3IF9A 2WEUA 4U8LA 1PBEA 1LQUA 3AXBA 3ZDNA 5LV9A 1IUSA 3VR9A 5JCLA 3CGEA 3QSSA 2ZZCA 4H4QA 2B9XA 2A8XA 4EIQA 3AWIA 2YG4A 4C3YA 3CNTA 4U2LA 3RP6A 2BACA 3SFDA 4A99A 4BJZA 1SP3A 1TDEA 3NK2X 2GR0A 3UTHA 3UOVA 1ZK7A 4Z24A 1N4UA 4JNQA 2VQBA 4XWZA 3NN6X 4AOXA 5ER0A 1PXBA 2GQFA 2YLWA 3QVRA 5KOXA 1TYTA 1ZMDA 3CGCA 1CF3A 4OVIA 5JCKA 5CKUA 5KWFA 5KRQA 2Y6QA 2WS3A 3NTAA 1XDIA 1B8SA 3P4QA 3NH3X 3KA7A 5BULA 2XCGA 1QDBA 1NG3A 1FT6A 1CC2A 1GETA 2BA9A 3KD9A 1CC6A 3NGCX 4A65A 4UP3A 3AE4A 1H86A 1CHUA 1XPQA 2NPXA 2C73A 1JEHA
chains in the Genus database with same CATH superfamily
4YKFA 1EL8A 2IVDA 2XLRA 3M12A 4YSYA 2XLPA 4TLXA 1D7LA 1CL0A 1D5TA 1S3BA 4CRTA 4U8KA 1CBOA 2R45A 2R9ZA 4A79A 3AD7B 1RYIA 5BUKA 5JCNA 2TPRA 5JCMA 2YM2A 2C70A 4G6HA 3II4A 3QSMA 3CPIG 4Y4LA 4XXGA 3SX6A 4L38A 2J3NA 2VVMA 4Z44A 2GMJA 4A5LA 1S2YA 4NEVA 2ARDA 4BJYA 2E4GA 4DSHA 2C4CA 4J31A 1OJTA 3DGZA 4NEWA 1UKVG 1IUXA 4PABA 3SFEA 1BZLA 4L3ZA 4O5UA 5C3JA 2YG6A 4J33A 4OPCA 3DK4A 4EQXA 3ABVA 1FECA 1F8WA 3BI5A 2JB2A 3T14A 2CVJA 3DMEA 3G5RA 4U8NA 2JK6A 2V3AA 3FPZA 3VRBA 1BWCA 3QJ4A 1NHRA 1Y0PA 1XHCA 3EAOA 2C75A 2UZZA 1EL5A 1W4XA 1L0VA 4CY6A 3NTDA 4IV9A 1MOKA 4GAPA 4U8IA 5HHFA 3SQPA 5JCIA 1TDFA 2E80A 3AE9A 2OAMA 2BC0A 2YLSA 3K7QX 4H4VA 3AYIA 2E1MA 2WU2A 1N4WA 3UOZA 3L1RA 4ECHA 2BXRA 4C5OA 2X99A 1NEKA 3HYVA 3LG1A 1GESA 1L9EA 4FX9A 4DSGA 4B66A 4OPUA 1L9DA 4H2QA 4H4PA 1ZY8A 3KU9A 3GMCA 4K5RA 3PO7A 2C66A 2XVIA 2ACZA 2YLZA 3ALLA 3UCLA 3URHA 2WPCA 2APGA 5CQFA 2Q6UA 3DJGX 3BI2A 2YVFA 4JNAA 4YTNA 4YTMA 1LV0A 2EQ9A 4WX1A 3T2YA 2WHDA 2JAEA 2VZ2A 3P9UA 4H2NA 3L1TA 5KNLA 3T37A 5IQ4A 3AEBA 3AEFA 4A6NA 2WETA 1E6EA 1H81A 3T2ZA 3P4PA 3F8RA 4JQ9A 2GQWA 2YM1A 3SM8A 3CPJG 3QFAA 4J2WA 3DJJA 2GVCA 1JRZA 3D8XA 2X3NA 4A9WA 1PBCA 2FJAA 4YKGA 3BI4A 1BGJA 4TM3A 3ADAB 2E5VA 3GMBA 4K8DA 2C72A 4YT0A 3AB1A 3SGLA 1ZKQA 1FEBA 3UP5A 1XANA 2C76A 4H2RA 5KXJA 2E81A 3G5QA 2BK4A 4Y4NA 1FEAA 3LZWA 1PDHA 4I59A 2X8HA 4JDRA 4CNJA 4UDQA 2I0ZA 4C74A 1O95A 1TDOA 3SZCA 2Q0KA 1GXFA 5EB5A 5DBJA 2GR1A 2VVLA 1GRAA 2B7SA 2B9WA 5FS9A 2BRYA 5KMRA 3GDPA 3LJPA 4PAAA 4OPDA 4B65A 2CDUA 4BK3A 2BRAA 4WJYA 4NNJA 1H7XA 2GMHA 4REKA 5J7XA 4B1BA 3CGDA 5L46A 2WP5A 2B7RA 1BGNA 5FS6A 1K0LA 2BABA 1H7WA 1COYA 3Q9TA 3R9UA 4DGKA 2Y6RA 1N4VA 5GSNA 4Z2TA 1AOGA 3IHMA 3LZXA 3NIXA 4CCQA 1GRHA 5C2TA 1LQTA 4K7ZA 2XVJA 4B67A 4KX6A 1QJDA 2V61A 1ZX9A 3SZ0A 3M13A 3ICTA 4D03A 2YWLA 1ZMCA 4B69A 2XDOA 3UP4A 4ADWA 3BNFA 4IA6A 3GWDA 1CJ3A 2BK3A 2BCPA 4OPIA 2YVGA 3O0HA 4ZN0A 1KFYA 2DKHA 2WDRA 1FCDA 1PXCA 1GSNA 3P1WA 1E39A 1M6IA 3F8PA 2NVKX 3H4KA 4AT0A 3V3OA 3VR8A 4JY2A 2ZZBA 3F8DA 3K7MX 1NHPA 3H8LA 1Q1RA 2WU5A 2XVHA 2YG3A 3L8KA 4Z26A 2CULA 1BKWA 3CMMA 1M1RA 3ATRA 3GRSA 4GR1A 3UKQA 1IUUA 4YXDA 1E1KA 2YAUA 5BVAA 3AE5A 3BNMA 4H4UA 4BK1A 3DA1A 2LFCA 2XFNA 2R46A 1B4VA 1B37A 1PBBA 3AYLA 3AE1A 3ICSA 1IUVA 2Q7VA 3UTFA 3VRDB 4E0VA 3UKHA 2VQ7A 3BHFA 2RDZA 1E1LA 4CNKA 1GRTA 3LXDA 2YG7A 3UKAA 2A89A 1M64A 4P9SA 1OJCA 3ATQA 2WOIA 4Z2RA 3OC4A 1HYUA 3SZFA 1QO8A 3FBSA 2V5ZA 2PYXA 3BNHA 4C3XA 3AE6A 4CY8A 3P4SA 2GF3A 4X4JA 1JRYA 1GT8A 1O94A 3COXA 3NT6A 4AP1A 3SZWA 1PN0A 1Q9IA 2GH5A 2GV8A 3C96A 4EMJA 3NYFA 4NZHA 1YQ3A 3RKHA 4K2XA 4X9NA 4A7AA 3S5WA 5HY5A 3ISHA 3AEDA 1ZP0A 2BS4A 1ZDLA 2JKCA 2O9ZA 2OALA 2R4EA 1LTXR 1CC4A 1E1NA 1PJ6A 1LJ1A 4L3XA 4USQA 3H8IA 4U8PA 4DNAA 3CNDA 3I6DA 3GD4A 1PBFA 1DOCA 1JU2A 3FMWA 3DJDA 4BV6A 1KNPA 1TRBA 2QCUA 3UU9A 2ZBWA 2RF7A 3SXQA 2RABA 2XVEA 2TMDA 5TR3A 3AEGA 2XYOA 3OZ2A 4FK1A 4RSLA 2CZSA 3WE0A 1ELIA 3LADA 1YKJA 2WESA 2YR5A 3CGBA 3JSKA 3NKSA 1OAHA 3EF6A 4NWZA 4LIIA 4GUVA 4RG4A 5FS7A 3QFBA 4OPGA 1GRGA 4YSHA 1VQWA 3SY4A 3HYXA 1L9CA 2CFYA 2VRLA 3NN0X 2B76A 2JBVA 4NTCA 1NHSA 1ONFA 4GCMA 1V59A 4IA5A 2Q0LA 4H4YA 2RGOA 5EOWA 1S3EA 4FK1C 1BVBA 4II3A 3DH9A 2R0GA 4AP3A 3K30A 4J57A 5IQ1A 4Z25A 1OJAA 2XLSA 1VG0A 3GYIA 3KLJA 2A87A 4U8MA 4Q17A 2R4JA 4CCRA 1GNDA 4Z2UA 3TORA 1DNCA 1X31B 2IVEA 3KVEA 3C4AA 1M1QA 4HA6A 5KMSA 3CNPA 5KMPA 4APNA 1E7PA 1GPEA 4G9KA 2J7AA 4MJWA 2GR3A 3GSIA 4GAVA 5KVHA 2AR8A 1MO9A 4ICYA 4EIPA 1PJ5A 4YTPA 1D4DA 4IVMB 3B6DA 4GF7A 2RGHA 4LA1A 1IUTA 1OJDA 3ZYXA 2VOUA 4USRA 1ZOYA 3E1TA 1NPXA 1DODA 3M0OA 4YSZA 1DOEA 4ZCDA 3PS9A 2WP6A 4O5QA 2ZO5A 3SYIA 1LPFA 2GAHB 3UOXA 2OLOA 1P2EA 2BC1A 4NTEA 1RP0A 4BK2A 2X8GA 3B3RA 2WDQA 3C4NA 2ZZ0A 3RP8A 1IJHA 4G74A 3AE2A 3UTGA 2Z5XA 1S2QA 2JB1A 1CJ2A 3HYWA 2C64A 4LU6A 3V3NA 3GDNA 1KSUA 3AD9B 3T0KA 3KPFA 4D04A 2F5ZA 1KNRA 2GAGB 2QA2A 4U8OA 4N9XA 1H82A 3ITJA 4IVOB 1NDAA 1YY5A 2FJEA 3AYJA 1FT5A 2YR6A 4H4SA 2OA1A 2DKIA 2X50A 4Q0TA 1REOA 4TLZA 5BRTA 2XFOA 4B68A 3FIMB 1Z6LA 4H4ZA 4C77A 3QSEA 3IWAA 3IC9A 4NTDA 2OT4A 1PXAA 2WBAA 2EQ7A 3UOYA 2YQUA 3AE3A 5U1OA 4H4RA 2XFUA 3RHAA 3DK8A 2XFQA 3HZLA 4J34A 1MXTA 4B63A 3CN8A 4U8JA 1KDGA 1PJ7A 1K0IA 3UTEA 4EMIA 3NHOX 2GB0A 3FG2P 1H6VA 1GRFA 4RG3A 1GEUA 1TYPA 2YLRA 2BXSA 4AOSA 5IPYA 5HXIA 3UKFA 3DK9A 4FDCB 4OPTA 1IUWA 1LVLA 3REDA 4EM4A 1JOAA 1E1MA 4TM1A 4ZCCA 4AT2A 2C65A 4H7UA 4UDPA 1PS9A 1BF3A 3UKPA 2C3DA 4I58A 2YLXA 3D1IA 1GREA 1NENA 4H4WA 3S61A 4EQRA 2EQ8A 4H4TA 2QA1A 4A6NB 3DGHA 3UBRA 1CJCA 1EBDA 1GU6A 1Y56A 2WDVA 1H84A 2WOWA 2YLTA 3CNSA 3CTYA 3K7TA 2BCGG 2QAEA 4Q5CA 2V3BA 1K0JA 1VG9A 2YVJA 2WPEA 1FS8A 2XLTA 3BHKA 4H4XA 3OWMA 3NG7X 1GTHA 2PHHA 3UKKA 4GRTA 2YR4A 3NYCA 3G5SA 3VQRA 2XFPA 5KMQA 3LOVA 4GDEA 5KVIA 4TM0A 3GM6A 5KOWA 2BK5A 4YWOA 3RNMA 1EL7A 4K22A 1Q1WA 4XWRA 1QLBA 2R0PA 1GRBA 4YSXA 4Q1OA 2C67A 2WPFA 2JB3A 2BYBA 2C7GA 4JN9A 4HB9A 2X8CA 3CIRA 3GRTA 3SCEA 3LB8A 3PVCA 1KSSA 4M52A 2WP9A 2BS3A 2C3CA 3NNEA 4Y4MA 4TM4A 1B5QA 1VRQB 4H50A 1GTEA 3EPTA 3NRNA 1VDCA 2W0HA 3AECA 5FS8A 4OCGA 3I3LA 2B9YA 1NG4A 2FBWA 4EQWA 5FMHA 2FJBA 3DJEA 3NYEA 1TDNA 4Z43A 2Z5YA 1YQ4A 1JNZA 4EQSA 4X9MA 2YG5A 5HYMA 4KPRA 2BS2A 2GEWA 3Q6JA 1GALA 1H83A 1DJNA 3GWFA 3MMOA 3AD8B 4Q4UA 1FS7A 3CNJA 3D1CA 3FO3A 4K5SA 1N1PA 3RP7A 3VRAA 3GYXA 2EQ6A 3UKLA 1JNIA 5EBKA 1GERA 3AEAA 3GYJA 3F29A 2R0CA 3NLCA 2RGJA 2AAQA 4B64A 1JNRA 2FJDA 3NK1X 3TTBA 1EL9A 5J60A 1KF6A 4U2SA 3GD3A 2V6OA 4U2TA 2WOVA 3V76A 2VRMA 4Q5BA 1NAAA 1F8RA 1D4CA 1GOSA 2OLNA 2XLUA 3KKJA 5U63A 5M0ZA 1CJ4A 4II2A 3AE8A 5EB4A 1RSGA 1O5WA 2WQYA 5U25A 3LGQA 1PBDA 4OPLA 3SXIA 1NHQA 2VR0A 1DXLA 4WCTA 1K4QA 4EM3A 4H2PA 1FS9A 1DJQA 1F8SA 1SEZA 2GRTA 4GDPA 3KPKA 2GR2A 4J56A 1M1PA 1F3PA 1FOHA 3EANA 2K3VA 2H89A 2AQJA 3ALMA 1FL2A 3BNJA 3AE7A 1TDKA 1Y56B 1JRXA 3BNGA 3ICRA 2VVLG 4J36A 2IIDA 1DOBA 4CBQA 4L3YA 4BURA 3QVPA 3IHGA 1F6MA 3CPHG 3AEEA 1D4EA 2H88A 5GRTA 3S7WA 1YQZA 2V60A 4EMWA 1GV4A 1D7YA 3NK0X 1OJ9A 2HQMA 4UDRA 3ALJA 3P4RA 1ZOVA 2XVFA 5M10A 1P2HA 3BNUA 4JY3A 1PHHA 3IF9A 2WEUA 4U8LA 1PBEA 1LQUA 3AXBA 3ZDNA 5LV9A 1IUSA 3VR9A 5JCLA 3CGEA 3QSSA 2ZZCA 4H4QA 2B9XA 2A8XA 4EIQA 3AWIA 2YG4A 4C3YA 3CNTA 4G73A 4U2LA 3RP6A 2BACA 3SFDA 3T2KA 4A99A 1SP3A 4BJZA 1TDEA 3NK2X 2GR0A 3UTHA 3UOVA 1ZK7A 4Z24A 1N4UA 4JNQA 2VQBA 4XWZA 3NN6X 4AOXA 5ER0A 1PXBA 2GQFA 2YLWA 3QVRA 5KOXA 1TYTA 1ZMDA 3T31A 3CGCA 1CF3A 4OVIA 5JCKA 5CKUA 5KWFA 5KRQA 2Y6QA 2WS3A 3NTAA 1XDIA 1B8SA 3P4QA 4G6GA 3NH3X 3KA7A 5BULA 2XCGA 1QDBA 1NG3A 1FT6A 1CC2A 1GETA 2BA9A 3KD9A 1CC6A 3NGCX 4A65A 4UP3A 3AE4A 1H86A 1CHUA 1XPQA 2NPXA 2C73A 1JEHA
chains in the Genus database with same CATH topology
4YKFA 1EL8A 2IVDA 2XLRA 3M12A 4YSYA 2XLPA 4TLXA 1D7LA 1CL0A 1D5TA 1S3BA 4CRTA 4U8KA 1CBOA 2R45A 2R9ZA 4A79A 3AD7B 1RYIA 5BUKA 5JCNA 2TPRA 5JCMA 2YM2A 2C70A 4G6HA 3II4A 3QSMA 3CPIG 4Y4LA 4XXGA 3SX6A 4L38A 2J3NA 2VVMA 4Z44A 2GMJA 4A5LA 1S2YA 4NEVA 2ARDA 4BJYA 2E4GA 4DSHA 2C4CA 4J31A 1OJTA 3DGZA 4NEWA 1UKVG 1IUXA 4PABA 3SFEA 1BZLA 4L3ZA 4O5UA 5C3JA 2YG6A 4J33A 4OPCA 3DK4A 4EQXA 3ABVA 1FECA 1F8WA 3BI5A 2JB2A 3T14A 2CVJA 3DMEA 3G5RA 4U8NA 2JK6A 2V3AA 3FPZA 3VRBA 1BWCA 3QJ4A 1NHRA 1Y0PA 1XHCA 3EAOA 2C75A 2UZZA 1EL5A 1W4XA 1L0VA 4CY6A 3NTDA 4IV9A 1MOKA 4GAPA 4U8IA 5HHFA 3SQPA 5JCIA 1TDFA 2E80A 3AE9A 2OAMA 2BC0A 2YLSA 3K7QX 4H4VA 3AYIA 2E1MA 2WU2A 1N4WA 3UOZA 3L1RA 4ECHA 2BXRA 4C5OA 2X99A 1NEKA 3HYVA 3LG1A 1GESA 1L9EA 4FX9A 4DSGA 4B66A 4OPUA 1L9DA 4H2QA 4H4PA 1ZY8A 3KU9A 3GMCA 4K5RA 3PO7A 2C66A 2XVIA 2ACZA 2YLZA 3ALLA 3UCLA 3URHA 2WPCA 2APGA 5CQFA 2Q6UA 3DJGX 3BI2A 2YVFA 4JNAA 4YTNA 4YTMA 1LV0A 2EQ9A 4WX1A 3T2YA 2WHDA 2JAEA 2VZ2A 3P9UA 4H2NA 3L1TA 5KNLA 3T37A 5IQ4A 3AEBA 3AEFA 4A6NA 2WETA 1E6EA 1H81A 3T2ZA 3P4PA 3F8RA 4JQ9A 2GQWA 2YM1A 3SM8A 3CPJG 3QFAA 4J2WA 3DJJA 2GVCA 1JRZA 3D8XA 2X3NA 4A9WA 1PBCA 2FJAA 4YKGA 3BI4A 1BGJA 4TM3A 3ADAB 2E5VA 3GMBA 4K8DA 2C72A 4YT0A 3AB1A 3SGLA 1ZKQA 1FEBA 3UP5A 1XANA 2C76A 4H2RA 5KXJA 2E81A 3G5QA 2BK4A 4Y4NA 1FEAA 3LZWA 1PDHA 4I59A 2X8HA 4JDRA 4CNJA 4UDQA 2I0ZA 4C74A 1O95A 1TDOA 3SZCA 2Q0KA 1GXFA 5EB5A 5DBJA 2GR1A 2VVLA 1GRAA 2B7SA 2B9WA 5FS9A 2BRYA 5KMRA 3GDPA 3LJPA 4PAAA 4OPDA 4B65A 2CDUA 4BK3A 2BRAA 4WJYA 4NNJA 1H7XA 2GMHA 4REKA 5J7XA 4B1BA 3CGDA 5L46A 2WP5A 2B7RA 1BGNA 5FS6A 1K0LA 2BABA 1H7WA 1COYA 3Q9TA 3R9UA 4DGKA 2Y6RA 1N4VA 5GSNA 4Z2TA 1AOGA 3IHMA 3LZXA 3NIXA 4CCQA 1GRHA 5C2TA 1LQTA 4K7ZA 2XVJA 4B67A 4KX6A 1QJDA 2V61A 1ZX9A 3SZ0A 3M13A 3ICTA 4D03A 2YWLA 1ZMCA 4B69A 2XDOA 3UP4A 4ADWA 3BNFA 4IA6A 3GWDA 1CJ3A 2BK3A 2BCPA 4OPIA 2YVGA 3O0HA 4ZN0A 1KFYA 2DKHA 2WDRA 1FCDA 1PXCA 1GSNA 3P1WA 1E39A 1M6IA 3F8PA 2NVKX 3H4KA 4AT0A 3V3OA 3VR8A 4JY2A 2ZZBA 3F8DA 3K7MX 1NHPA 3H8LA 1Q1RA 2WU5A 2XVHA 2YG3A 3L8KA 4Z26A 2CULA 1BKWA 3CMMA 1M1RA 3ATRA 3GRSA 4GR1A 3UKQA 1IUUA 4YXDA 1E1KA 2YAUA 5BVAA 3AE5A 3BNMA 4H4UA 4BK1A 3DA1A 2LFCA 2XFNA 2R46A 1B4VA 1B37A 1PBBA 3AYLA 3AE1A 3ICSA 1IUVA 2Q7VA 3UTFA 3VRDB 4E0VA 3UKHA 2VQ7A 3BHFA 2RDZA 1E1LA 4CNKA 1GRTA 3LXDA 2YG7A 3UKAA 2A89A 1M64A 4P9SA 1OJCA 3ATQA 2WOIA 4Z2RA 3OC4A 1HYUA 3SZFA 1QO8A 3FBSA 2V5ZA 2PYXA 3BNHA 4C3XA 3AE6A 4CY8A 3P4SA 2GF3A 4X4JA 1JRYA 1GT8A 1O94A 3COXA 3NT6A 4AP1A 3SZWA 1PN0A 1Q9IA 2GH5A 2GV8A 3C96A 4EMJA 3NYFA 4NZHA 1YQ3A 3RKHA 4K2XA 4X9NA 4A7AA 3S5WA 5HY5A 3ISHA 3AEDA 1ZP0A 2BS4A 1ZDLA 2JKCA 2O9ZA 2OALA 2R4EA 1LTXR 1CC4A 1E1NA 1PJ6A 1LJ1A 4L3XA 4USQA 3H8IA 4U8PA 4DNAA 3CNDA 3I6DA 3GD4A 1PBFA 1DOCA 1JU2A 3FMWA 3DJDA 4BV6A 1KNPA 1TRBA 2QCUA 3UU9A 2ZBWA 2RF7A 3SXQA 2RABA 2XVEA 2TMDA 5TR3A 3AEGA 2XYOA 3OZ2A 4FK1A 4RSLA 3WE0A 1ELIA 3LADA 1YKJA 2WESA 2YR5A 3CGBA 3JSKA 3NKSA 1OAHA 3EF6A 4NWZA 4LIIA 4GUVA 4RG4A 5FS7A 3QFBA 4OPGA 1GRGA 4YSHA 1VQWA 3SY4A 3HYXA 1L9CA 2CFYA 2VRLA 3NN0X 2B76A 2JBVA 4NTCA 1NHSA 1ONFA 4GCMA 1V59A 4IA5A 2Q0LA 4H4YA 2RGOA 5EOWA 1S3EA 4FK1C 1BVBA 4II3A 3DH9A 2R0GA 4AP3A 3K30A 4J57A 5IQ1A 4Z25A 1OJAA 2XLSA 1VG0A 3GYIA 3KLJA 2A87A 4U8MA 4Q17A 2R4JA 4CCRA 1GNDA 4Z2UA 3TORA 1DNCA 1X31B 2IVEA 3KVEA 3C4AA 1M1QA 4HA6A 5KMSA 3CNPA 5KMPA 4APNA 1E7PA 1GPEA 4G9KA 2J7AA 4MJWA 2GR3A 3GSIA 4GAVA 5KVHA 2AR8A 1MO9A 4ICYA 4EIPA 1PJ5A 4YTPA 1D4DA 4IVMB 3B6DA 4GF7A 2RGHA 4LA1A 1IUTA 1OJDA 3ZYXA 2VOUA 4USRA 1ZOYA 3E1TA 1NPXA 1DODA 3M0OA 4YSZA 1DOEA 4ZCDA 3PS9A 2WP6A 4O5QA 2ZO5A 3SYIA 1LPFA 2GAHB 3UOXA 2OLOA 1P2EA 2BC1A 4NTEA 1RP0A 4BK2A 2X8GA 3B3RA 2WDQA 3C4NA 2ZZ0A 3RP8A 1IJHA 4G74A 3AE2A 3UTGA 2Z5XA 1S2QA 2JB1A 1CJ2A 3HYWA 2C64A 4LU6A 3V3NA 3GDNA 1KSUA 3AD9B 3T0KA 3KPFA 4D04A 2F5ZA 1KNRA 2GAGB 2QA2A 4U8OA 4N9XA 1H82A 3ITJA 4IVOB 1NDAA 1YY5A 2FJEA 3AYJA 1FT5A 2YR6A 4H4SA 2OA1A 2DKIA 2X50A 4Q0TA 1REOA 4TLZA 5BRTA 2XFOA 4B68A 3FIMB 1Z6LA 4H4ZA 4C77A 3QSEA 3IWAA 3IC9A 4NTDA 2OT4A 1PXAA 2WBAA 2EQ7A 3UOYA 2YQUA 3AE3A 5U1OA 4H4RA 2XFUA 3RHAA 3DK8A 2XFQA 3HZLA 4J34A 1MXTA 4B63A 3CN8A 4U8JA 1KDGA 1PJ7A 1K0IA 3UTEA 4EMIA 3NHOX 2GB0A 3FG2P 1H6VA 1GRFA 4RG3A 1GEUA 1TYPA 2YLRA 2BXSA 4AOSA 5IPYA 5HXIA 3UKFA 3DK9A 4FDCB 4OPTA 1IUWA 1LVLA 3REDA 4EM4A 1JOAA 1E1MA 4TM1A 4ZCCA 4AT2A 2C65A 4H7UA 4UDPA 1PS9A 1BF3A 3UKPA 2C3DA 4I58A 2YLXA 3D1IA 1GREA 1NENA 4H4WA 3S61A 4EQRA 2EQ8A 4H4TA 2QA1A 4A6NB 3DGHA 3UBRA 1CJCA 1EBDA 1GU6A 1Y56A 2WDVA 1H84A 2WOWA 2YLTA 3CNSA 3CTYA 3K7TA 2BCGG 2QAEA 4Q5CA 2V3BA 1K0JA 1VG9A 2YVJA 2WPEA 1FS8A 2XLTA 3BHKA 4H4XA 3OWMA 3NG7X 1GTHA 2PHHA 3UKKA 4GRTA 2YR4A 3NYCA 3G5SA 3VQRA 2XFPA 5KMQA 3LOVA 4GDEA 5KVIA 4TM0A 3GM6A 5KOWA 2BK5A 4YWOA 3RNMA 1EL7A 4K22A 1Q1WA 4XWRA 1QLBA 2R0PA 1GRBA 4YSXA 4Q1OA 2C67A 2WPFA 2JB3A 2BYBA 2C7GA 4JN9A 4HB9A 2X8CA 3CIRA 3GRTA 3SCEA 3LB8A 3PVCA 1KSSA 4M52A 2WP9A 2BS3A 2C3CA 3NNEA 4Y4MA 4TM4A 1B5QA 1VRQB 4H50A 1GTEA 3EPTA 3NRNA 1VDCA 2W0HA 3AECA 5FS8A 4OCGA 3I3LA 2B9YA 1NG4A 2FBWA 4EQWA 5FMHA 2FJBA 3DJEA 3NYEA 1TDNA 4Z43A 2Z5YA 1YQ4A 1JNZA 4EQSA 4X9MA 2YG5A 5HYMA 4KPRA 2BS2A 2GEWA 3Q6JA 1GALA 1H83A 1DJNA 3GWFA 3MMOA 3AD8B 4Q4UA 1FS7A 3CNJA 3D1CA 3FO3A 4K5SA 1N1PA 3RP7A 3VRAA 3GYXA 2EQ6A 3UKLA 1JNIA 5EBKA 1GERA 3AEAA 3GYJA 3F29A 2R0CA 3NLCA 2RGJA 2AAQA 4B64A 1JNRA 2FJDA 3NK1X 3TTBA 1EL9A 5J60A 1KF6A 4U2SA 3GD3A 2V6OA 4U2TA 2WOVA 3V76A 2VRMA 4Q5BA 1NAAA 1F8RA 1D4CA 1GOSA 2OLNA 2XLUA 3KKJA 5U63A 5M0ZA 1CJ4A 4II2A 3AE8A 5EB4A 1RSGA 1O5WA 2WQYA 5U25A 3LGQA 1PBDA 4OPLA 3SXIA 1NHQA 2VR0A 1DXLA 4WCTA 1K4QA 4EM3A 4H2PA 1FS9A 1DJQA 1F8SA 1SEZA 2GRTA 4GDPA 3KPKA 2GR2A 4J56A 1M1PA 1F3PA 1FOHA 3EANA 2K3VA 2H89A 2AQJA 3ALMA 1FL2A 3BNJA 3AE7A 1TDKA 1Y56B 1JRXA 3BNGA 3ICRA 2VVLG 4J36A 2IIDA 1DOBA 4CBQA 4L3YA 4BURA 3QVPA 3IHGA 1F6MA 3CPHG 3AEEA 1D4EA 2H88A 5GRTA 3S7WA 1YQZA 2V60A 4EMWA 1GV4A 1D7YA 3NK0X 1OJ9A 2HQMA 4UDRA 3ALJA 3P4RA 1ZOVA 2XVFA 5M10A 1P2HA 3BNUA 4JY3A 1PHHA 3IF9A 2WEUA 4U8LA 1PBEA 1LQUA 3AXBA 3ZDNA 5LV9A 1IUSA 3VR9A 5JCLA 3CGEA 3QSSA 2ZZCA 4H4QA 2B9XA 2A8XA 4EIQA 3AWIA 2YG4A 4C3YA 3CNTA 4G73A 4U2LA 3RP6A 2BACA 3SFDA 3T2KA 4A99A 1SP3A 4BJZA 1TDEA 3NK2X 2GR0A 3UTHA 3UOVA 1ZK7A 4Z24A 1N4UA 4JNQA 2VQBA 4XWZA 3NN6X 4AOXA 5ER0A 1PXBA 2GQFA 2YLWA 3QVRA 5KOXA 1TYTA 1ZMDA 3T31A 3CGCA 1CF3A 4OVIA 5JCKA 5CKUA 5KWFA 5KRQA 2Y6QA 2WS3A 3NTAA 1XDIA 1B8SA 3P4QA 4G6GA 3NH3X 3KA7A 5BULA 2XCGA 1QDBA 1NG3A 1FT6A 1CC2A 1GETA 2BA9A 3KD9A 1CC6A 3NGCX 4A65A 4UP3A 3AE4A 1H86A 1CHUA 1XPQA 2NPXA 2C73A 1JEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKF A;  1EL8 A;  2IVD A;  2XLR A;  3M12 A;  4YSY A;  2XLP A;  4TLX A;  1D7L A;  1CL0 A;  1D5T A;  1S3B A;  4CRT A;  4U8K A;  1CBO A;  2R45 A;  2R9Z A;  4A79 A;  3AD7 B;  1RYI A;  5BUK A;  5JCN A;  2TPR A;  5JCM A;  2YM2 A;  2C70 A;  3II4 A;  3QSM A;  3CPI G;  4Y4L A;  4XXG A;  4L38 A;  2J3N A;  2VVM A;  4Z44 A;  2GMJ A;  4A5L A;  1S2Y A;  4NEV A;  2ARD A;  4BJY A;  2E4G A;  4DSH A;  4J31 A;  1OJT A;  3DGZ A;  4NEW A;  1UKV G;  1IUX A;  4PAB A;  3SFE A;  1BZL A;  4L3Z A;  4O5U A;  5C3J A;  2YG6 A;  4J33 A;  4OPC A;  3DK4 A;  4EQX A;  3ABV A;  1FEC A;  1F8W A;  3BI5 A;  2JB2 A;  2CVJ A;  3DME A;  3G5R A;  4U8N A;  2JK6 A;  2V3A A;  3FPZ A;  3VRB A;  1BWC A;  3QJ4 A;  1NHR A;  1Y0P A;  1XHC A;  3EAO A;  2C75 A;  2UZZ A;  1EL5 A;  1W4X A;  1L0V A;  4CY6 A;  3NTD A;  4IV9 A;  1MOK A;  4U8I A;  5HHF A;  3SQP A;  5JCI A;  1TDF A;  2E80 A;  3AE9 A;  2OAM A;  2BC0 A;  2YLS A;  3K7Q X;  4H4V A;  3AYI A;  2E1M A;  2WU2 A;  1N4W A;  3UOZ A;  3L1R A;  4ECH A;  2BXR A;  4C5O A;  2X99 A;  1NEK A;  4FX9 A;  3LG1 A;  1GES A;  1L9E A;  4DSG A;  4B66 A;  4OPU A;  1L9D A;  4H2Q A;  4H4P A;  1ZY8 A;  3KU9 A;  3GMC A;  4K5R A;  3PO7 A;  2C66 A;  2XVI A;  2ACZ A;  2YLZ A;  3ALL A;  3UCL A;  3URH A;  2WPC A;  2APG A;  5CQF A;  2Q6U A;  3DJG X;  3BI2 A;  2YVF A;  4JNA A;  4YTN A;  4YTM A;  1LV0 A;  2EQ9 A;  4WX1 A;  2WHD A;  2JAE A;  2VZ2 A;  3P9U A;  4H2N A;  3L1T A;  3T37 A;  5IQ4 A;  3AEB A;  3AEF A;  4A6N A;  2WET A;  1E6E A;  1H81 A;  3P4P A;  3F8R A;  4JQ9 A;  2GQW A;  2YM1 A;  3SM8 A;  3CPJ G;  3QFA A;  4J2W A;  3DJJ A;  2GVC A;  1JRZ A;  3D8X A;  2X3N A;  4A9W A;  1PBC A;  2FJA A;  4YKG A;  3BI4 A;  1BGJ A;  4TM3 A;  3ADA B;  2E5V A;  3GMB A;  4K8D A;  2C72 A;  4YT0 A;  3AB1 A;  3SGL A;  1ZKQ A;  1FEB A;  3UP5 A;  1XAN A;  2C76 A;  4H2R A;  5KXJ A;  2E81 A;  3G5Q A;  2BK4 A;  4Y4N A;  1FEA A;  3LZW A;  1PDH A;  4I59 A;  2X8H A;  4JDR A;  4CNJ A;  4UDQ A;  2I0Z A;  4C74 A;  1O95 A;  1TDO A;  2Q0K A;  1GXF A;  5EB5 A;  5DBJ A;  2GR1 A;  2VVL A;  1GRA A;  2B7S A;  2B9W A;  5FS9 A;  3GDP A;  3LJP A;  4PAA A;  4OPD A;  4B65 A;  2CDU A;  4BK3 A;  4WJY A;  1H7X A;  2GMH A;  4REK A;  5J7X A;  4B1B A;  3CGD A;  5L46 A;  2WP5 A;  2B7R A;  1BGN A;  5FS6 A;  1K0L A;  2BAB A;  1H7W A;  1COY A;  3Q9T A;  3R9U A;  4DGK A;  2Y6R A;  1N4V A;  5GSN A;  4Z2T A;  1AOG A;  3IHM A;  3LZX A;  3NIX A;  4CCQ A;  1GRH A;  5C2T A;  1LQT A;  4K7Z A;  2XVJ A;  4B67 A;  4KX6 A;  1QJD A;  2V61 A;  1ZX9 A;  3M13 A;  3ICT A;  4D03 A;  2YWL A;  1ZMC A;  4B69 A;  2XDO A;  3UP4 A;  4ADW A;  3BNF A;  4IA6 A;  3GWD A;  1CJ3 A;  2BK3 A;  2BCP A;  4OPI A;  2YVG A;  3O0H A;  4ZN0 A;  1KFY A;  2DKH A;  2WDR A;  1FCD A;  1PXC A;  1GSN A;  3P1W A;  1E39 A;  1M6I A;  3F8P A;  2NVK X;  3H4K A;  4AT0 A;  3V3O A;  3VR8 A;  4JY2 A;  2ZZB A;  3F8D A;  3K7M X;  1NHP A;  3H8L A;  1Q1R A;  2WU5 A;  2XVH A;  2YG3 A;  3L8K A;  4Z26 A;  2CUL A;  1BKW A;  1M1R A;  3ATR A;  3GRS A;  4GR1 A;  3UKQ A;  1IUU A;  4YXD A;  1E1K A;  2YAU A;  5BVA A;  3AE5 A;  3BNM A;  4H4U A;  4BK1 A;  3DA1 A;  2LFC A;  2XFN A;  2R46 A;  1B4V A;  1B37 A;  1PBB A;  3AYL A;  3AE1 A;  3ICS A;  1IUV A;  2Q7V A;  3UTF A;  3VRD B;  4E0V A;  3UKH A;  2VQ7 A;  3BHF A;  2RDZ A;  1E1L A;  4CNK A;  1GRT A;  3LXD A;  2YG7 A;  3UKA A;  2A89 A;  1M64 A;  4P9S A;  1OJC A;  3ATQ A;  2WOI A;  4Z2R A;  3OC4 A;  1HYU A;  1QO8 A;  3FBS A;  2V5Z A;  2PYX A;  3BNH A;  4C3X A;  3AE6 A;  4CY8 A;  3P4S A;  2GF3 A;  4X4J A;  1JRY A;  1GT8 A;  1O94 A;  3COX A;  3NT6 A;  4AP1 A;  1PN0 A;  1Q9I A;  2GH5 A;  2GV8 A;  3C96 A;  4EMJ A;  3NYF A;  4NZH A;  1YQ3 A;  3RKH A;  4K2X A;  4X9N A;  4A7A A;  3S5W A;  5HY5 A;  3ISH A;  3AED A;  1ZP0 A;  2BS4 A;  1ZDL A;  2JKC A;  2O9Z A;  2OAL A;  2R4E A;  1LTX R;  1CC4 A;  1E1N A;  1PJ6 A;  1LJ1 A;  4L3X A;  4USQ A;  3H8I A;  4U8P A;  4DNA A;  3CND A;  3I6D A;  3GD4 A;  1PBF A;  1DOC A;  1JU2 A;  3FMW A;  3DJD A;  4BV6 A;  1KNP A;  1TRB A;  2QCU A;  3UU9 A;  2ZBW A;  2RF7 A;  3SXQ A;  2RAB A;  2XVE A;  2TMD A;  5TR3 A;  3AEG A;  2XYO A;  3OZ2 A;  4FK1 A;  4RSL A;  3WE0 A;  1ELI A;  3LAD A;  1YKJ A;  2WES A;  2YR5 A;  3CGB A;  3JSK A;  3NKS A;  1OAH A;  3EF6 A;  4LII A;  4GUV A;  4RG4 A;  5FS7 A;  3QFB A;  4OPG A;  1GRG A;  4YSH A;  1VQW A;  1L9C A;  2CFY A;  2VRL A;  3NN0 X;  2B76 A;  2JBV A;  4NTC A;  1NHS A;  1ONF A;  4GCM A;  1V59 A;  4IA5 A;  2Q0L A;  4H4Y A;  2RGO A;  5EOW A;  1S3E A;  4FK1 C;  1BVB A;  3DH9 A;  2R0G A;  4AP3 A;  3K30 A;  4J57 A;  5IQ1 A;  4Z25 A;  1OJA A;  2XLS A;  1VG0 A;  3GYI A;  3KLJ A;  2A87 A;  4U8M A;  4Q17 A;  2R4J A;  4CCR A;  1GND A;  4Z2U A;  3TOR A;  1DNC A;  1X31 B;  2IVE A;  3KVE A;  3C4A A;  1M1Q A;  4HA6 A;  3CNP A;  4APN A;  1E7P A;  1GPE A;  2J7A A;  4MJW A;  2GR3 A;  3GSI A;  5KVH A;  2AR8 A;  1MO9 A;  4ICY A;  4EIP A;  1PJ5 A;  4YTP A;  1D4D A;  4IVM B;  3B6D A;  4GF7 A;  2RGH A;  4LA1 A;  1IUT A;  1OJD A;  3ZYX A;  2VOU A;  4USR A;  1ZOY A;  3E1T A;  1NPX A;  1DOD A;  3M0O A;  4YSZ A;  1DOE A;  4ZCD A;  3PS9 A;  2WP6 A;  4O5Q A;  2ZO5 A;  1LPF A;  2GAH B;  3UOX A;  2OLO A;  1P2E A;  2BC1 A;  4NTE A;  1RP0 A;  4BK2 A;  2X8G A;  3B3R A;  2WDQ A;  3C4N A;  2ZZ0 A;  3RP8 A;  1IJH A;  3AE2 A;  3UTG A;  2Z5X A;  1S2Q A;  2JB1 A;  1CJ2 A;  2C64 A;  4LU6 A;  3V3N A;  3GDN A;  1KSU A;  3AD9 B;  4D04 A;  3KPF A;  2F5Z A;  1KNR A;  2GAG B;  2QA2 A;  4U8O A;  4N9X A;  1H82 A;  3ITJ A;  4IVO B;  1NDA A;  1YY5 A;  2FJE A;  3AYJ A;  1FT5 A;  2YR6 A;  4H4S A;  2OA1 A;  2DKI A;  2X50 A;  4Q0T A;  1REO A;  4TLZ A;  5BRT A;  2XFO A;  4B68 A;  3FIM B;  1Z6L A;  4H4Z A;  4C77 A;  3QSE A;  3IWA A;  3IC9 A;  4NTD A;  2OT4 A;  1PXA A;  2WBA A;  2EQ7 A;  3UOY A;  2YQU A;  3AE3 A;  5U1O A;  4H4R A;  2XFU A;  3RHA A;  3DK8 A;  2XFQ A;  3HZL A;  4J34 A;  1MXT A;  4B63 A;  3CN8 A;  4U8J A;  1KDG A;  1PJ7 A;  1K0I A;  3UTE A;  4EMI A;  3NHO X;  2GB0 A;  3FG2 P;  1H6V A;  1GRF A;  4RG3 A;  1GEU A;  1TYP A;  2YLR A;  2BXS A;  4AOS A;  5IPY A;  5HXI A;  3UKF A;  3DK9 A;  4FDC B;  4OPT A;  1IUW A;  1LVL A;  3RED A;  4EM4 A;  1JOA A;  1E1M A;  4TM1 A;  4ZCC A;  4AT2 A;  2C65 A;  4H7U A;  4UDP A;  1PS9 A;  1BF3 A;  3UKP A;  2C3D A;  4I58 A;  2YLX A;  3D1I A;  1GRE A;  1NEN A;  4H4W A;  3S61 A;  4EQR A;  2EQ8 A;  4H4T A;  2QA1 A;  4A6N B;  3DGH A;  3UBR A;  1CJC A;  1EBD A;  1GU6 A;  1Y56 A;  2WDV A;  1H84 A;  2WOW A;  2YLT A;  3CNS A;  3CTY A;  3K7T A;  2BCG G;  2QAE A;  4Q5C A;  2V3B A;  1K0J A;  1VG9 A;  2YVJ A;  2WPE A;  1FS8 A;  2XLT A;  3BHK A;  4H4X A;  3OWM A;  3NG7 X;  1GTH A;  2PHH A;  3UKK A;  4GRT A;  2YR4 A;  3NYC A;  3G5S A;  3VQR A;  2XFP A;  3LOV A;  4GDE A;  5KVI A;  4TM0 A;  3GM6 A;  5KOW A;  2BK5 A;  4YWO A;  3RNM A;  1EL7 A;  4K22 A;  1Q1W A;  4XWR A;  1QLB A;  2R0P A;  1GRB A;  4YSX A;  4Q1O A;  2C67 A;  2WPF A;  2JB3 A;  2BYB A;  2C7G A;  4JN9 A;  4HB9 A;  2X8C A;  3CIR A;  3GRT A;  3SCE A;  3LB8 A;  3PVC A;  1KSS A;  4M52 A;  2WP9 A;  2BS3 A;  2C3C A;  3NNE A;  4Y4M A;  4TM4 A;  1B5Q A;  1VRQ B;  4H50 A;  1GTE A;  3EPT A;  3NRN A;  1VDC A;  2W0H A;  3AEC A;  5FS8 A;  4OCG A;  3I3L A;  2B9Y A;  1NG4 A;  2FBW A;  4EQW A;  5FMH A;  2FJB A;  3DJE A;  3NYE A;  1TDN A;  4Z43 A;  2Z5Y A;  1YQ4 A;  1JNZ A;  4EQS A;  4X9M A;  2YG5 A;  5HYM A;  4KPR A;  2BS2 A;  2GEW A;  3Q6J A;  1GAL A;  1H83 A;  1DJN A;  3GWF A;  3MMO A;  3AD8 B;  4Q4U A;  1FS7 A;  3CNJ A;  3D1C A;  3FO3 A;  4K5S A;  1N1P A;  3RP7 A;  3VRA A;  3GYX A;  2EQ6 A;  3UKL A;  1JNI A;  5EBK A;  1GER A;  3AEA A;  3GYJ A;  3F29 A;  2R0C A;  3NLC A;  2RGJ A;  2AAQ A;  4B64 A;  1JNR A;  2FJD A;  3NK1 X;  3TTB A;  1EL9 A;  5J60 A;  1KF6 A;  4U2S A;  3GD3 A;  2V6O A;  4U2T A;  2WOV A;  3V76 A;  2VRM A;  4Q5B A;  1NAA A;  1F8R A;  1D4C A;  1GOS A;  2OLN A;  2XLU A;  3KKJ A;  5U63 A;  5M0Z A;  1CJ4 A;  5EB4 A;  3AE8 A;  1RSG A;  1O5W A;  2WQY A;  5U25 A;  3LGQ A;  1PBD A;  4OPL A;  1NHQ A;  2VR0 A;  1DXL A;  4WCT A;  1K4Q A;  4EM3 A;  4H2P A;  1FS9 A;  1DJQ A;  1F8S A;  1SEZ A;  2GRT A;  4GDP A;  2GR2 A;  4J56 A;  1M1P A;  1F3P A;  1FOH A;  3EAN A;  2K3V A;  2H89 A;  2AQJ A;  3ALM A;  1FL2 A;  3BNJ A;  3AE7 A;  1TDK A;  1Y56 B;  1JRX A;  3BNG A;  3ICR A;  2VVL G;  4J36 A;  2IID A;  1DOB A;  4CBQ A;  4L3Y A;  4BUR A;  3QVP A;  3IHG A;  1F6M A;  3CPH G;  3AEE A;  1D4E A;  2H88 A;  5GRT A;  3S7W A;  1YQZ A;  2V60 A;  4EMW A;  1GV4 A;  1D7Y A;  3NK0 X;  1OJ9 A;  2HQM A;  4UDR A;  3ALJ A;  3P4R A;  1ZOV A;  2XVF A;  5M10 A;  1P2H A;  3BNU A;  4JY3 A;  1PHH A;  3IF9 A;  2WEU A;  4U8L A;  1PBE A;  1LQU A;  3AXB A;  3ZDN A;  5LV9 A;  1IUS A;  3VR9 A;  5JCL A;  3CGE A;  3QSS A;  2ZZC A;  4H4Q A;  2B9X A;  2A8X A;  4EIQ A;  3AWI A;  2YG4 A;  4C3Y A;  3CNT A;  4U2L A;  3RP6 A;  2BAC A;  3SFD A;  4A99 A;  4BJZ A;  1SP3 A;  1TDE A;  3NK2 X;  2GR0 A;  3UTH A;  3UOV A;  1ZK7 A;  4Z24 A;  1N4U A;  4JNQ A;  2VQB A;  4XWZ A;  3NN6 X;  4AOX A;  5ER0 A;  1PXB A;  2GQF A;  2YLW A;  3QVR A;  5KOX A;  1TYT A;  1ZMD A;  3CGC A;  1CF3 A;  4OVI A;  5JCK A;  5CKU A;  5KWF A;  5KRQ A;  2Y6Q A;  2WS3 A;  3NTA A;  1XDI A;  1B8S A;  3P4Q A;  3NH3 X;  3KA7 A;  5BUL A;  2XCG A;  1QDB A;  1NG3 A;  1FT6 A;  1CC2 A;  1GET A;  2BA9 A;  3KD9 A;  1CC6 A;  3NGC X;  4A65 A;  4UP3 A;  3AE4 A;  1H86 A;  1CHU A;  1XPQ A;  2NPX A;  2C73 A;  1JEH A; 
#chains in the Genus database with same CATH topology
 4YKF A;  1EL8 A;  2IVD A;  2XLR A;  3M12 A;  4YSY A;  2XLP A;  4TLX A;  1D7L A;  1CL0 A;  1D5T A;  1S3B A;  4CRT A;  4U8K A;  1CBO A;  2R45 A;  2R9Z A;  4A79 A;  3AD7 B;  1RYI A;  5BUK A;  5JCN A;  2TPR A;  5JCM A;  2YM2 A;  2C70 A;  4G6H A;  3II4 A;  3QSM A;  3CPI G;  4Y4L A;  4XXG A;  3SX6 A;  4L38 A;  2J3N A;  2VVM A;  4Z44 A;  2GMJ A;  4A5L A;  1S2Y A;  4NEV A;  2ARD A;  4BJY A;  2E4G A;  4DSH A;  2C4C A;  4J31 A;  1OJT A;  3DGZ A;  4NEW A;  1UKV G;  1IUX A;  4PAB A;  3SFE A;  1BZL A;  4L3Z A;  4O5U A;  5C3J A;  2YG6 A;  4J33 A;  4OPC A;  3DK4 A;  4EQX A;  3ABV A;  1FEC A;  1F8W A;  3BI5 A;  2JB2 A;  3T14 A;  2CVJ A;  3DME A;  3G5R A;  4U8N A;  2JK6 A;  2V3A A;  3FPZ A;  3VRB A;  1BWC A;  3QJ4 A;  1NHR A;  1Y0P A;  1XHC A;  3EAO A;  2C75 A;  2UZZ A;  1EL5 A;  1W4X A;  1L0V A;  4CY6 A;  3NTD A;  4IV9 A;  1MOK A;  4GAP A;  4U8I A;  5HHF A;  3SQP A;  5JCI A;  1TDF A;  2E80 A;  3AE9 A;  2OAM A;  2BC0 A;  2YLS A;  3K7Q X;  4H4V A;  3AYI A;  2E1M A;  2WU2 A;  1N4W A;  3UOZ A;  3L1R A;  4ECH A;  2BXR A;  4C5O A;  2X99 A;  1NEK A;  3HYV A;  3LG1 A;  1GES A;  1L9E A;  4FX9 A;  4DSG A;  4B66 A;  4OPU A;  1L9D A;  4H2Q A;  4H4P A;  1ZY8 A;  3KU9 A;  3GMC A;  4K5R A;  3PO7 A;  2C66 A;  2XVI A;  2ACZ A;  2YLZ A;  3ALL A;  3UCL A;  3URH A;  2WPC A;  2APG A;  5CQF A;  2Q6U A;  3DJG X;  3BI2 A;  2YVF A;  4JNA A;  4YTN A;  4YTM A;  1LV0 A;  2EQ9 A;  4WX1 A;  3T2Y A;  2WHD A;  2JAE A;  2VZ2 A;  3P9U A;  4H2N A;  3L1T A;  5KNL A;  3T37 A;  5IQ4 A;  3AEB A;  3AEF A;  4A6N A;  2WET A;  1E6E A;  1H81 A;  3T2Z A;  3P4P A;  3F8R A;  4JQ9 A;  2GQW A;  2YM1 A;  3SM8 A;  3CPJ G;  3QFA A;  4J2W A;  3DJJ A;  2GVC A;  1JRZ A;  3D8X A;  2X3N A;  4A9W A;  1PBC A;  2FJA A;  4YKG A;  3BI4 A;  1BGJ A;  4TM3 A;  3ADA B;  2E5V A;  3GMB A;  4K8D A;  2C72 A;  4YT0 A;  3AB1 A;  3SGL A;  1ZKQ A;  1FEB A;  3UP5 A;  1XAN A;  2C76 A;  4H2R A;  5KXJ A;  2E81 A;  3G5Q A;  2BK4 A;  4Y4N A;  1FEA A;  3LZW A;  1PDH A;  4I59 A;  2X8H A;  4JDR A;  4CNJ A;  4UDQ A;  2I0Z A;  4C74 A;  1O95 A;  1TDO A;  3SZC A;  2Q0K A;  1GXF A;  5EB5 A;  5DBJ A;  2GR1 A;  2VVL A;  1GRA A;  2B7S A;  2B9W A;  5FS9 A;  2BRY A;  5KMR A;  3GDP A;  3LJP A;  4PAA A;  4OPD A;  4B65 A;  2CDU A;  4BK3 A;  2BRA A;  4WJY A;  4NNJ A;  1H7X A;  2GMH A;  4REK A;  5J7X A;  4B1B A;  3CGD A;  5L46 A;  2WP5 A;  2B7R A;  1BGN A;  5FS6 A;  1K0L A;  2BAB A;  1H7W A;  1COY A;  3Q9T A;  3R9U A;  4DGK A;  2Y6R A;  1N4V A;  5GSN A;  4Z2T A;  1AOG A;  3IHM A;  3LZX A;  3NIX A;  4CCQ A;  1GRH A;  5C2T A;  1LQT A;  4K7Z A;  2XVJ A;  4B67 A;  4KX6 A;  1QJD A;  2V61 A;  1ZX9 A;  3SZ0 A;  3M13 A;  3ICT A;  4D03 A;  2YWL A;  1ZMC A;  4B69 A;  2XDO A;  3UP4 A;  4ADW A;  3BNF A;  4IA6 A;  3GWD A;  1CJ3 A;  2BK3 A;  2BCP A;  4OPI A;  2YVG A;  3O0H A;  4ZN0 A;  1KFY A;  2DKH A;  2WDR A;  1FCD A;  1PXC A;  1GSN A;  3P1W A;  1E39 A;  1M6I A;  3F8P A;  2NVK X;  3H4K A;  4AT0 A;  3V3O A;  3VR8 A;  4JY2 A;  2ZZB A;  3F8D A;  3K7M X;  1NHP A;  3H8L A;  1Q1R A;  2WU5 A;  2XVH A;  2YG3 A;  3L8K A;  4Z26 A;  2CUL A;  1BKW A;  3CMM A;  1M1R A;  3ATR A;  3GRS A;  4GR1 A;  3UKQ A;  1IUU A;  4YXD A;  1E1K A;  2YAU A;  5BVA A;  3AE5 A;  3BNM A;  4H4U A;  4BK1 A;  3DA1 A;  2LFC A;  2XFN A;  2R46 A;  1B4V A;  1B37 A;  1PBB A;  3AYL A;  3AE1 A;  3ICS A;  1IUV A;  2Q7V A;  3UTF A;  3VRD B;  4E0V A;  3UKH A;  2VQ7 A;  3BHF A;  2RDZ A;  1E1L A;  4CNK A;  1GRT A;  3LXD A;  2YG7 A;  3UKA A;  2A89 A;  1M64 A;  4P9S A;  1OJC A;  3ATQ A;  2WOI A;  4Z2R A;  3OC4 A;  1HYU A;  3SZF A;  1QO8 A;  3FBS A;  2V5Z A;  2PYX A;  3BNH A;  4C3X A;  3AE6 A;  4CY8 A;  3P4S A;  2GF3 A;  4X4J A;  1JRY A;  1GT8 A;  1O94 A;  3COX A;  3NT6 A;  4AP1 A;  3SZW A;  1PN0 A;  1Q9I A;  2GH5 A;  2GV8 A;  3C96 A;  4EMJ A;  3NYF A;  4NZH A;  1YQ3 A;  3RKH A;  4K2X A;  4X9N A;  4A7A A;  3S5W A;  5HY5 A;  3ISH A;  3AED A;  1ZP0 A;  2BS4 A;  1ZDL A;  2JKC A;  2O9Z A;  2OAL A;  2R4E A;  1LTX R;  1CC4 A;  1E1N A;  1PJ6 A;  1LJ1 A;  4L3X A;  4USQ A;  3H8I A;  4U8P A;  4DNA A;  3CND A;  3I6D A;  3GD4 A;  1PBF A;  1DOC A;  1JU2 A;  3FMW A;  3DJD A;  4BV6 A;  1KNP A;  1TRB A;  2QCU A;  3UU9 A;  2ZBW A;  2RF7 A;  3SXQ A;  2RAB A;  2XVE A;  2TMD A;  5TR3 A;  3AEG A;  2XYO A;  3OZ2 A;  4FK1 A;  4RSL A;  2CZS A;  3WE0 A;  1ELI A;  3LAD A;  1YKJ A;  2WES A;  2YR5 A;  3CGB A;  3JSK A;  3NKS A;  1OAH A;  3EF6 A;  4NWZ A;  4LII A;  4GUV A;  4RG4 A;  5FS7 A;  3QFB A;  4OPG A;  1GRG A;  4YSH A;  1VQW A;  3SY4 A;  3HYX A;  1L9C A;  2CFY A;  2VRL A;  3NN0 X;  2B76 A;  2JBV A;  4NTC A;  1NHS A;  1ONF A;  4GCM A;  1V59 A;  4IA5 A;  2Q0L A;  4H4Y A;  2RGO A;  5EOW A;  1S3E A;  4FK1 C;  1BVB A;  4II3 A;  3DH9 A;  2R0G A;  4AP3 A;  3K30 A;  4J57 A;  5IQ1 A;  4Z25 A;  1OJA A;  2XLS A;  1VG0 A;  3GYI A;  3KLJ A;  2A87 A;  4U8M A;  4Q17 A;  2R4J A;  4CCR A;  1GND A;  4Z2U A;  3TOR A;  1DNC A;  1X31 B;  2IVE A;  3KVE A;  3C4A A;  1M1Q A;  4HA6 A;  5KMS A;  3CNP A;  5KMP A;  4APN A;  1E7P A;  1GPE A;  4G9K A;  2J7A A;  4MJW A;  2GR3 A;  3GSI A;  4GAV A;  5KVH A;  2AR8 A;  1MO9 A;  4ICY A;  4EIP A;  1PJ5 A;  4YTP A;  1D4D A;  4IVM B;  3B6D A;  4GF7 A;  2RGH A;  4LA1 A;  1IUT A;  1OJD A;  3ZYX A;  2VOU A;  4USR A;  1ZOY A;  3E1T A;  1NPX A;  1DOD A;  3M0O A;  4YSZ A;  1DOE A;  4ZCD A;  3PS9 A;  2WP6 A;  4O5Q A;  2ZO5 A;  3SYI A;  1LPF A;  2GAH B;  3UOX A;  2OLO A;  1P2E A;  2BC1 A;  4NTE A;  1RP0 A;  4BK2 A;  2X8G A;  3B3R A;  2WDQ A;  3C4N A;  2ZZ0 A;  3RP8 A;  1IJH A;  4G74 A;  3AE2 A;  3UTG A;  2Z5X A;  1S2Q A;  2JB1 A;  1CJ2 A;  3HYW A;  2C64 A;  4LU6 A;  3V3N A;  3GDN A;  1KSU A;  3AD9 B;  3T0K A;  3KPF A;  4D04 A;  2F5Z A;  1KNR A;  2GAG B;  2QA2 A;  4U8O A;  4N9X A;  1H82 A;  3ITJ A;  4IVO B;  1NDA A;  1YY5 A;  2FJE A;  3AYJ A;  1FT5 A;  2YR6 A;  4H4S A;  2OA1 A;  2DKI A;  2X50 A;  4Q0T A;  1REO A;  4TLZ A;  5BRT A;  2XFO A;  4B68 A;  3FIM B;  1Z6L A;  4H4Z A;  4C77 A;  3QSE A;  3IWA A;  3IC9 A;  4NTD A;  2OT4 A;  1PXA A;  2WBA A;  2EQ7 A;  3UOY A;  2YQU A;  3AE3 A;  5U1O A;  4H4R A;  2XFU A;  3RHA A;  3DK8 A;  2XFQ A;  3HZL A;  4J34 A;  1MXT A;  4B63 A;  3CN8 A;  4U8J A;  1KDG A;  1PJ7 A;  1K0I A;  3UTE A;  4EMI A;  3NHO X;  2GB0 A;  3FG2 P;  1H6V A;  1GRF A;  4RG3 A;  1GEU A;  1TYP A;  2YLR A;  2BXS A;  4AOS A;  5IPY A;  5HXI A;  3UKF A;  3DK9 A;  4FDC B;  4OPT A;  1IUW A;  1LVL A;  3RED A;  4EM4 A;  1JOA A;  1E1M A;  4TM1 A;  4ZCC A;  4AT2 A;  2C65 A;  4H7U A;  4UDP A;  1PS9 A;  1BF3 A;  3UKP A;  2C3D A;  4I58 A;  2YLX A;  3D1I A;  1GRE A;  1NEN A;  4H4W A;  3S61 A;  4EQR A;  2EQ8 A;  4H4T A;  2QA1 A;  4A6N B;  3DGH A;  3UBR A;  1CJC A;  1EBD A;  1GU6 A;  1Y56 A;  2WDV A;  1H84 A;  2WOW A;  2YLT A;  3CNS A;  3CTY A;  3K7T A;  2BCG G;  2QAE A;  4Q5C A;  2V3B A;  1K0J A;  1VG9 A;  2YVJ A;  2WPE A;  1FS8 A;  2XLT A;  3BHK A;  4H4X A;  3OWM A;  3NG7 X;  1GTH A;  2PHH A;  3UKK A;  4GRT A;  2YR4 A;  3NYC A;  3G5S A;  3VQR A;  2XFP A;  5KMQ A;  3LOV A;  4GDE A;  5KVI A;  4TM0 A;  3GM6 A;  5KOW A;  2BK5 A;  4YWO A;  3RNM A;  1EL7 A;  4K22 A;  1Q1W A;  4XWR A;  1QLB A;  2R0P A;  1GRB A;  4YSX A;  4Q1O A;  2C67 A;  2WPF A;  2JB3 A;  2BYB A;  2C7G A;  4JN9 A;  4HB9 A;  2X8C A;  3CIR A;  3GRT A;  3SCE A;  3LB8 A;  3PVC A;  1KSS A;  4M52 A;  2WP9 A;  2BS3 A;  2C3C A;  3NNE A;  4Y4M A;  4TM4 A;  1B5Q A;  1VRQ B;  4H50 A;  1GTE A;  3EPT A;  3NRN A;  1VDC A;  2W0H A;  3AEC A;  5FS8 A;  4OCG A;  3I3L A;  2B9Y A;  1NG4 A;  2FBW A;  4EQW A;  5FMH A;  2FJB A;  3DJE A;  3NYE A;  1TDN A;  4Z43 A;  2Z5Y A;  1YQ4 A;  1JNZ A;  4EQS A;  4X9M A;  2YG5 A;  5HYM A;  4KPR A;  2BS2 A;  2GEW A;  3Q6J A;  1GAL A;  1H83 A;  1DJN A;  3GWF A;  3MMO A;  3AD8 B;  4Q4U A;  1FS7 A;  3CNJ A;  3D1C A;  3FO3 A;  4K5S A;  1N1P A;  3RP7 A;  3VRA A;  3GYX A;  2EQ6 A;  3UKL A;  1JNI A;  5EBK A;  1GER A;  3AEA A;  3GYJ A;  3F29 A;  2R0C A;  3NLC A;  2RGJ A;  2AAQ A;  4B64 A;  1JNR A;  2FJD A;  3NK1 X;  3TTB A;  1EL9 A;  5J60 A;  1KF6 A;  4U2S A;  3GD3 A;  2V6O A;  4U2T A;  2WOV A;  3V76 A;  2VRM A;  4Q5B A;  1NAA A;  1F8R A;  1D4C A;  1GOS A;  2OLN A;  2XLU A;  3KKJ A;  5U63 A;  5M0Z A;  1CJ4 A;  4II2 A;  3AE8 A;  5EB4 A;  1RSG A;  1O5W A;  2WQY A;  5U25 A;  3LGQ A;  1PBD A;  4OPL A;  3SXI A;  1NHQ A;  2VR0 A;  1DXL A;  4WCT A;  1K4Q A;  4EM3 A;  4H2P A;  1FS9 A;  1DJQ A;  1F8S A;  1SEZ A;  2GRT A;  4GDP A;  3KPK A;  2GR2 A;  4J56 A;  1M1P A;  1F3P A;  1FOH A;  3EAN A;  2K3V A;  2H89 A;  2AQJ A;  3ALM A;  1FL2 A;  3BNJ A;  3AE7 A;  1TDK A;  1Y56 B;  1JRX A;  3BNG A;  3ICR A;  2VVL G;  4J36 A;  2IID A;  1DOB A;  4CBQ A;  4L3Y A;  4BUR A;  3QVP A;  3IHG A;  1F6M A;  3CPH G;  3AEE A;  1D4E A;  2H88 A;  5GRT A;  3S7W A;  1YQZ A;  2V60 A;  4EMW A;  1GV4 A;  1D7Y A;  3NK0 X;  1OJ9 A;  2HQM A;  4UDR A;  3ALJ A;  3P4R A;  1ZOV A;  2XVF A;  5M10 A;  1P2H A;  3BNU A;  4JY3 A;  1PHH A;  3IF9 A;  2WEU A;  4U8L A;  1PBE A;  1LQU A;  3AXB A;  3ZDN A;  5LV9 A;  1IUS A;  3VR9 A;  5JCL A;  3CGE A;  3QSS A;  2ZZC A;  4H4Q A;  2B9X A;  2A8X A;  4EIQ A;  3AWI A;  2YG4 A;  4C3Y A;  3CNT A;  4G73 A;  4U2L A;  3RP6 A;  2BAC A;  3SFD A;  3T2K A;  4A99 A;  1SP3 A;  4BJZ A;  1TDE A;  3NK2 X;  2GR0 A;  3UTH A;  3UOV A;  1ZK7 A;  4Z24 A;  1N4U A;  4JNQ A;  2VQB A;  4XWZ A;  3NN6 X;  4AOX A;  5ER0 A;  1PXB A;  2GQF A;  2YLW A;  3QVR A;  5KOX A;  1TYT A;  1ZMD A;  3T31 A;  3CGC A;  1CF3 A;  4OVI A;  5JCK A;  5CKU A;  5KWF A;  5KRQ A;  2Y6Q A;  2WS3 A;  3NTA A;  1XDI A;  1B8S A;  3P4Q A;  4G6G A;  3NH3 X;  3KA7 A;  5BUL A;  2XCG A;  1QDB A;  1NG3 A;  1FT6 A;  1CC2 A;  1GET A;  2BA9 A;  3KD9 A;  1CC6 A;  3NGC X;  4A65 A;  4UP3 A;  3AE4 A;  1H86 A;  1CHU A;  1XPQ A;  2NPX A;  2C73 A;  1JEH A; 
#chains in the Genus database with same CATH homology
 4YKF A;  1EL8 A;  2IVD A;  2XLR A;  3M12 A;  4YSY A;  2XLP A;  4TLX A;  1D7L A;  1CL0 A;  1D5T A;  1S3B A;  4CRT A;  4U8K A;  1CBO A;  2R45 A;  2R9Z A;  4A79 A;  3AD7 B;  1RYI A;  5BUK A;  5JCN A;  2TPR A;  5JCM A;  2YM2 A;  2C70 A;  4G6H A;  3II4 A;  3QSM A;  3CPI G;  4Y4L A;  4XXG A;  3SX6 A;  4L38 A;  2J3N A;  2VVM A;  4Z44 A;  2GMJ A;  4A5L A;  1S2Y A;  4NEV A;  2ARD A;  4BJY A;  2E4G A;  4DSH A;  2C4C A;  4J31 A;  1OJT A;  3DGZ A;  4NEW A;  1UKV G;  1IUX A;  4PAB A;  3SFE A;  1BZL A;  4L3Z A;  4O5U A;  5C3J A;  2YG6 A;  4J33 A;  4OPC A;  3DK4 A;  4EQX A;  3ABV A;  1FEC A;  1F8W A;  3BI5 A;  2JB2 A;  3T14 A;  2CVJ A;  3DME A;  3G5R A;  4U8N A;  2JK6 A;  2V3A A;  3FPZ A;  3VRB A;  1BWC A;  3QJ4 A;  1NHR A;  1Y0P A;  1XHC A;  3EAO A;  2C75 A;  2UZZ A;  1EL5 A;  1W4X A;  1L0V A;  4CY6 A;  3NTD A;  4IV9 A;  1MOK A;  4GAP A;  4U8I A;  5HHF A;  3SQP A;  5JCI A;  1TDF A;  2E80 A;  3AE9 A;  2OAM A;  2BC0 A;  2YLS A;  3K7Q X;  4H4V A;  3AYI A;  2E1M A;  2WU2 A;  1N4W A;  3UOZ A;  3L1R A;  4ECH A;  2BXR A;  4C5O A;  2X99 A;  1NEK A;  3HYV A;  3LG1 A;  1GES A;  1L9E A;  4FX9 A;  4DSG A;  4B66 A;  4OPU A;  1L9D A;  4H2Q A;  4H4P A;  1ZY8 A;  3KU9 A;  3GMC A;  4K5R A;  3PO7 A;  2C66 A;  2XVI A;  2ACZ A;  2YLZ A;  3ALL A;  3UCL A;  3URH A;  2WPC A;  2APG A;  5CQF A;  2Q6U A;  3DJG X;  3BI2 A;  2YVF A;  4JNA A;  4YTN A;  4YTM A;  1LV0 A;  2EQ9 A;  4WX1 A;  3T2Y A;  2WHD A;  2JAE A;  2VZ2 A;  3P9U A;  4H2N A;  3L1T A;  5KNL A;  3T37 A;  5IQ4 A;  3AEB A;  3AEF A;  4A6N A;  2WET A;  1E6E A;  1H81 A;  3T2Z A;  3P4P A;  3F8R A;  4JQ9 A;  2GQW A;  2YM1 A;  3SM8 A;  3CPJ G;  3QFA A;  4J2W A;  3DJJ A;  2GVC A;  1JRZ A;  3D8X A;  2X3N A;  4A9W A;  1PBC A;  2FJA A;  4YKG A;  3BI4 A;  1BGJ A;  4TM3 A;  3ADA B;  2E5V A;  3GMB A;  4K8D A;  2C72 A;  4YT0 A;  3AB1 A;  3SGL A;  1ZKQ A;  1FEB A;  3UP5 A;  1XAN A;  2C76 A;  4H2R A;  5KXJ A;  2E81 A;  3G5Q A;  2BK4 A;  4Y4N A;  1FEA A;  3LZW A;  1PDH A;  4I59 A;  2X8H A;  4JDR A;  4CNJ A;  4UDQ A;  2I0Z A;  4C74 A;  1O95 A;  1TDO A;  3SZC A;  2Q0K A;  1GXF A;  5EB5 A;  5DBJ A;  2GR1 A;  2VVL A;  1GRA A;  2B7S A;  2B9W A;  5FS9 A;  2BRY A;  5KMR A;  3GDP A;  3LJP A;  4PAA A;  4OPD A;  4B65 A;  2CDU A;  4BK3 A;  2BRA A;  4WJY A;  4NNJ A;  1H7X A;  2GMH A;  4REK A;  5J7X A;  4B1B A;  3CGD A;  5L46 A;  2WP5 A;  2B7R A;  1BGN A;  5FS6 A;  1K0L A;  2BAB A;  1H7W A;  1COY A;  3Q9T A;  3R9U A;  4DGK A;  2Y6R A;  1N4V A;  5GSN A;  4Z2T A;  1AOG A;  3IHM A;  3LZX A;  3NIX A;  4CCQ A;  1GRH A;  5C2T A;  1LQT A;  4K7Z A;  2XVJ A;  4B67 A;  4KX6 A;  1QJD A;  2V61 A;  1ZX9 A;  3SZ0 A;  3M13 A;  3ICT A;  4D03 A;  2YWL A;  1ZMC A;  4B69 A;  2XDO A;  3UP4 A;  4ADW A;  3BNF A;  4IA6 A;  3GWD A;  1CJ3 A;  2BK3 A;  2BCP A;  4OPI A;  2YVG A;  3O0H A;  4ZN0 A;  1KFY A;  2DKH A;  2WDR A;  1FCD A;  1PXC A;  1GSN A;  3P1W A;  1E39 A;  1M6I A;  3F8P A;  2NVK X;  3H4K A;  4AT0 A;  3V3O A;  3VR8 A;  4JY2 A;  2ZZB A;  3F8D A;  3K7M X;  1NHP A;  3H8L A;  1Q1R A;  2WU5 A;  2XVH A;  2YG3 A;  3L8K A;  4Z26 A;  2CUL A;  1BKW A;  3CMM A;  1M1R A;  3ATR A;  3GRS A;  4GR1 A;  3UKQ A;  1IUU A;  4YXD A;  1E1K A;  2YAU A;  5BVA A;  3AE5 A;  3BNM A;  4H4U A;  4BK1 A;  3DA1 A;  2LFC A;  2XFN A;  2R46 A;  1B4V A;  1B37 A;  1PBB A;  3AYL A;  3AE1 A;  3ICS A;  1IUV A;  2Q7V A;  3UTF A;  3VRD B;  4E0V A;  3UKH A;  2VQ7 A;  3BHF A;  2RDZ A;  1E1L A;  4CNK A;  1GRT A;  3LXD A;  2YG7 A;  3UKA A;  2A89 A;  1M64 A;  4P9S A;  1OJC A;  3ATQ A;  2WOI A;  4Z2R A;  3OC4 A;  1HYU A;  3SZF A;  1QO8 A;  3FBS A;  2V5Z A;  2PYX A;  3BNH A;  4C3X A;  3AE6 A;  4CY8 A;  3P4S A;  2GF3 A;  4X4J A;  1JRY A;  1GT8 A;  1O94 A;  3COX A;  3NT6 A;  4AP1 A;  3SZW A;  1PN0 A;  1Q9I A;  2GH5 A;  2GV8 A;  3C96 A;  4EMJ A;  3NYF A;  4NZH A;  1YQ3 A;  3RKH A;  4K2X A;  4X9N A;  4A7A A;  3S5W A;  5HY5 A;  3ISH A;  3AED A;  1ZP0 A;  2BS4 A;  1ZDL A;  2JKC A;  2O9Z A;  2OAL A;  2R4E A;  1LTX R;  1CC4 A;  1E1N A;  1PJ6 A;  1LJ1 A;  4L3X A;  4USQ A;  3H8I A;  4U8P A;  4DNA A;  3CND A;  3I6D A;  3GD4 A;  1PBF A;  1DOC A;  1JU2 A;  3FMW A;  3DJD A;  4BV6 A;  1KNP A;  1TRB A;  2QCU A;  3UU9 A;  2ZBW A;  2RF7 A;  3SXQ A;  2RAB A;  2XVE A;  2TMD A;  5TR3 A;  3AEG A;  2XYO A;  3OZ2 A;  4FK1 A;  4RSL A;  3WE0 A;  1ELI A;  3LAD A;  1YKJ A;  2WES A;  2YR5 A;  3CGB A;  3JSK A;  3NKS A;  1OAH A;  3EF6 A;  4NWZ A;  4LII A;  4GUV A;  4RG4 A;  5FS7 A;  3QFB A;  4OPG A;  1GRG A;  4YSH A;  1VQW A;  3SY4 A;  3HYX A;  1L9C A;  2CFY A;  2VRL A;  3NN0 X;  2B76 A;  2JBV A;  4NTC A;  1NHS A;  1ONF A;  4GCM A;  1V59 A;  4IA5 A;  2Q0L A;  4H4Y A;  2RGO A;  5EOW A;  1S3E A;  4FK1 C;  1BVB A;  4II3 A;  3DH9 A;  2R0G A;  4AP3 A;  3K30 A;  4J57 A;  5IQ1 A;  4Z25 A;  1OJA A;  2XLS A;  1VG0 A;  3GYI A;  3KLJ A;  2A87 A;  4U8M A;  4Q17 A;  2R4J A;  4CCR A;  1GND A;  4Z2U A;  3TOR A;  1DNC A;  1X31 B;  2IVE A;  3KVE A;  3C4A A;  1M1Q A;  4HA6 A;  5KMS A;  3CNP A;  5KMP A;  4APN A;  1E7P A;  1GPE A;  4G9K A;  2J7A A;  4MJW A;  2GR3 A;  3GSI A;  4GAV A;  5KVH A;  2AR8 A;  1MO9 A;  4ICY A;  4EIP A;  1PJ5 A;  4YTP A;  1D4D A;  4IVM B;  3B6D A;  4GF7 A;  2RGH A;  4LA1 A;  1IUT A;  1OJD A;  3ZYX A;  2VOU A;  4USR A;  1ZOY A;  3E1T A;  1NPX A;  1DOD A;  3M0O A;  4YSZ A;  1DOE A;  4ZCD A;  3PS9 A;  2WP6 A;  4O5Q A;  2ZO5 A;  3SYI A;  1LPF A;  2GAH B;  3UOX A;  2OLO A;  1P2E A;  2BC1 A;  4NTE A;  1RP0 A;  4BK2 A;  2X8G A;  3B3R A;  2WDQ A;  3C4N A;  2ZZ0 A;  3RP8 A;  1IJH A;  4G74 A;  3AE2 A;  3UTG A;  2Z5X A;  1S2Q A;  2JB1 A;  1CJ2 A;  3HYW A;  2C64 A;  4LU6 A;  3V3N A;  3GDN A;  1KSU A;  3AD9 B;  3T0K A;  3KPF A;  4D04 A;  2F5Z A;  1KNR A;  2GAG B;  2QA2 A;  4U8O A;  4N9X A;  1H82 A;  3ITJ A;  4IVO B;  1NDA A;  1YY5 A;  2FJE A;  3AYJ A;  1FT5 A;  2YR6 A;  4H4S A;  2OA1 A;  2DKI A;  2X50 A;  4Q0T A;  1REO A;  4TLZ A;  5BRT A;  2XFO A;  4B68 A;  3FIM B;  1Z6L A;  4H4Z A;  4C77 A;  3QSE A;  3IWA A;  3IC9 A;  4NTD A;  2OT4 A;  1PXA A;  2WBA A;  2EQ7 A;  3UOY A;  2YQU A;  3AE3 A;  5U1O A;  4H4R A;  2XFU A;  3RHA A;  3DK8 A;  2XFQ A;  3HZL A;  4J34 A;  1MXT A;  4B63 A;  3CN8 A;  4U8J A;  1KDG A;  1PJ7 A;  1K0I A;  3UTE A;  4EMI A;  3NHO X;  2GB0 A;  3FG2 P;  1H6V A;  1GRF A;  4RG3 A;  1GEU A;  1TYP A;  2YLR A;  2BXS A;  4AOS A;  5IPY A;  5HXI A;  3UKF A;  3DK9 A;  4FDC B;  4OPT A;  1IUW A;  1LVL A;  3RED A;  4EM4 A;  1JOA A;  1E1M A;  4TM1 A;  4ZCC A;  4AT2 A;  2C65 A;  4H7U A;  4UDP A;  1PS9 A;  1BF3 A;  3UKP A;  2C3D A;  4I58 A;  2YLX A;  3D1I A;  1GRE A;  1NEN A;  4H4W A;  3S61 A;  4EQR A;  2EQ8 A;  4H4T A;  2QA1 A;  4A6N B;  3DGH A;  3UBR A;  1CJC A;  1EBD A;  1GU6 A;  1Y56 A;  2WDV A;  1H84 A;  2WOW A;  2YLT A;  3CNS A;  3CTY A;  3K7T A;  2BCG G;  2QAE A;  4Q5C A;  2V3B A;  1K0J A;  1VG9 A;  2YVJ A;  2WPE A;  1FS8 A;  2XLT A;  3BHK A;  4H4X A;  3OWM A;  3NG7 X;  1GTH A;  2PHH A;  3UKK A;  4GRT A;  2YR4 A;  3NYC A;  3G5S A;  3VQR A;  2XFP A;  5KMQ A;  3LOV A;  4GDE A;  5KVI A;  4TM0 A;  3GM6 A;  5KOW A;  2BK5 A;  4YWO A;  3RNM A;  1EL7 A;  4K22 A;  1Q1W A;  4XWR A;  1QLB A;  2R0P A;  1GRB A;  4YSX A;  4Q1O A;  2C67 A;  2WPF A;  2JB3 A;  2BYB A;  2C7G A;  4JN9 A;  4HB9 A;  2X8C A;  3CIR A;  3GRT A;  3SCE A;  3LB8 A;  3PVC A;  1KSS A;  4M52 A;  2WP9 A;  2BS3 A;  2C3C A;  3NNE A;  4Y4M A;  4TM4 A;  1B5Q A;  1VRQ B;  4H50 A;  1GTE A;  3EPT A;  3NRN A;  1VDC A;  2W0H A;  3AEC A;  5FS8 A;  4OCG A;  3I3L A;  2B9Y A;  1NG4 A;  2FBW A;  4EQW A;  5FMH A;  2FJB A;  3DJE A;  3NYE A;  1TDN A;  4Z43 A;  2Z5Y A;  1YQ4 A;  1JNZ A;  4EQS A;  4X9M A;  2YG5 A;  5HYM A;  4KPR A;  2BS2 A;  2GEW A;  3Q6J A;  1GAL A;  1H83 A;  1DJN A;  3GWF A;  3MMO A;  3AD8 B;  4Q4U A;  1FS7 A;  3CNJ A;  3D1C A;  3FO3 A;  4K5S A;  1N1P A;  3RP7 A;  3VRA A;  3GYX A;  2EQ6 A;  3UKL A;  1JNI A;  5EBK A;  1GER A;  3AEA A;  3GYJ A;  3F29 A;  2R0C A;  3NLC A;  2RGJ A;  2AAQ A;  4B64 A;  1JNR A;  2FJD A;  3NK1 X;  3TTB A;  1EL9 A;  5J60 A;  1KF6 A;  4U2S A;  3GD3 A;  2V6O A;  4U2T A;  2WOV A;  3V76 A;  2VRM A;  4Q5B A;  1NAA A;  1F8R A;  1D4C A;  1GOS A;  2OLN A;  2XLU A;  3KKJ A;  5U63 A;  5M0Z A;  1CJ4 A;  4II2 A;  3AE8 A;  5EB4 A;  1RSG A;  1O5W A;  2WQY A;  5U25 A;  3LGQ A;  1PBD A;  4OPL A;  3SXI A;  1NHQ A;  2VR0 A;  1DXL A;  4WCT A;  1K4Q A;  4EM3 A;  4H2P A;  1FS9 A;  1DJQ A;  1F8S A;  1SEZ A;  2GRT A;  4GDP A;  3KPK A;  2GR2 A;  4J56 A;  1M1P A;  1F3P A;  1FOH A;  3EAN A;  2K3V A;  2H89 A;  2AQJ A;  3ALM A;  1FL2 A;  3BNJ A;  3AE7 A;  1TDK A;  1Y56 B;  1JRX A;  3BNG A;  3ICR A;  2VVL G;  4J36 A;  2IID A;  1DOB A;  4CBQ A;  4L3Y A;  4BUR A;  3QVP A;  3IHG A;  1F6M A;  3CPH G;  3AEE A;  1D4E A;  2H88 A;  5GRT A;  3S7W A;  1YQZ A;  2V60 A;  4EMW A;  1GV4 A;  1D7Y A;  3NK0 X;  1OJ9 A;  2HQM A;  4UDR A;  3ALJ A;  3P4R A;  1ZOV A;  2XVF A;  5M10 A;  1P2H A;  3BNU A;  4JY3 A;  1PHH A;  3IF9 A;  2WEU A;  4U8L A;  1PBE A;  1LQU A;  3AXB A;  3ZDN A;  5LV9 A;  1IUS A;  3VR9 A;  5JCL A;  3CGE A;  3QSS A;  2ZZC A;  4H4Q A;  2B9X A;  2A8X A;  4EIQ A;  3AWI A;  2YG4 A;  4C3Y A;  3CNT A;  4G73 A;  4U2L A;  3RP6 A;  2BAC A;  3SFD A;  3T2K A;  4A99 A;  1SP3 A;  4BJZ A;  1TDE A;  3NK2 X;  2GR0 A;  3UTH A;  3UOV A;  1ZK7 A;  4Z24 A;  1N4U A;  4JNQ A;  2VQB A;  4XWZ A;  3NN6 X;  4AOX A;  5ER0 A;  1PXB A;  2GQF A;  2YLW A;  3QVR A;  5KOX A;  1TYT A;  1ZMD A;  3T31 A;  3CGC A;  1CF3 A;  4OVI A;  5JCK A;  5CKU A;  5KWF A;  5KRQ A;  2Y6Q A;  2WS3 A;  3NTA A;  1XDI A;  1B8S A;  3P4Q A;  4G6G A;  3NH3 X;  3KA7 A;  5BUL A;  2XCG A;  1QDB A;  1NG3 A;  1FT6 A;  1CC2 A;  1GET A;  2BA9 A;  3KD9 A;  1CC6 A;  3NGC X;  4A65 A;  4UP3 A;  3AE4 A;  1H86 A;  1CHU A;  1XPQ A;  2NPX A;  2C73 A;  1JEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...