2B7SA

R381k mutant of flavocytochrome c3
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVKGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fumarate reductase flavoprotein subunit
publication title A Proton Delivery Pathway in the Soluble Fumarate Reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 192
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2005-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 2b7sA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2b7sA02
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2b7sA03
2E5VA 2BYBA 4U2LA 5KWFA 1COYA 1PBEA 3AEAA 3D1CA 2YR6A 1S3EA 2B9WA 1F8SA 4GF7A 1OJTA 5BUKA 2BA9A 1VG9A 2C75A 4Q4UA 1FS8A 4RG4A 3EAOA 1JNZA 1BZLA 4AOSA 3AEFA 1BF3A 1ZKQA 4KX6A 1CC2A 2C3CA 2JB1A 2RGHA 4NEWA 3ICSA 4H4TA 5JCNA 1B37A 5U25A 1N4UA 3ATQA 2JB2A 5C2TA 2VZ2A 3OC4A 4UDQA 2ZO5A 4AT0A 3AYIA 3S7WA 2APGA 2QCUA 4YXDA 1TDNA 3UBRA 4Q1OA 1DOEA 2Y6QA 1GT8A 2XDOA 3II4A 2YLWA 1BGJA 3GSIA 3AE4A 3F8DA 4HA6A 3CIRA 3GDNA 1CC6A 1L9EA 2RDZA 1IUWA 4EQRA 2V3AA 2XVIA 3NKSA 3COXA 4E0VA 1IUVA 2BXSA 3S61A 3P4SA 2VVMA 2J7AA 2CFYA 1S2QA 4JN9A 2VRMA 5CQFA 4USRA 2YQUA 3DJJA 3UOZA 1CBOA 2C66A 2XFQA 3QSEA 3FIMB 4YTPA 2WDRA 1FECA 3DJDA 5GSNA 2EQ8A 5TR3A 2O9ZA 1TDEA 3GD4A 3H8LA 5KRQA 4AP3A 1M64A 1GRTA 3GWFA 4CY6A 2V6OA 2E81A 1Y56B 3L1TA 2WP5A 3NIXA 4EMWA 3NN6X 4U8JA 2B7SA 3IC9A 5IPYA 2E80A 3I6DA 1JRXA 4OPUA 3NT6A 4H4VA 1GTEA 1KNPA 4H4ZA 2XFPA 3BI2A 4NTDA 2CVJA 2OT4A 3P1WA 1JRZA 1LVLA 2WS3A 2XLPA 3H4KA 1GRGA 4UP3A 2YVFA 4A7AA 3OZ2A 4BK2A 1EBDA 1GOSA 4GCMA 4D03A 4J2WA 3DH9A 4U8OA 1XPQA 4BK3A 4Y4LA 1GTHA 2VQ7A 2Q7VA 1NPXA 3ZDNA 2OA1A 2EQ9A 2UZZA 1E6EA 1IUSA 3D8XA 3E1TA 2BK5A 2E4GA 2VOUA 2GH5A 3BNUA 4A5LA 3QVPA 2YG6A 2BC1A 4OPIA 1X31B 3NK2X 2ZZBA 2ZZCA 1B4VA 1QJDA 3G5SA 1CL0A 1IUTA 2R4EA 4WX1A 4C74A 1ZDLA 4C3YA 1TDOA 2V61A 4H50A 3NTAA 3F8PA 5BRTA 2WESA 4Z2RA 3LZXA 1PJ7A 2WQYA 4C77A 2XFNA 4YSXA 1E39A 1DOCA 1H86A 4OPDA 3CPIG 4N9XA 2XFOA 4DSHA 1LV0A 1LJ1A 3DK4A 3G5QA 1N4WA 2YM1A 2GQWA 1QLBA 4ZN0A 3QFAA 3GWDA 2H88A 3RP7A 2TMDA 1OJAA 2WU5A 4JY2A 1NENA 1H82A 1PBCA 4JNQA 3I3LA 4Q5CA 3QJ4A 4Y4MA 3AE3A 2YWLA 4GDPA 4TLZA 3GMBA 1KSUA 3BNHA 4LIIA 3MMOA 5J60A 5M10A 2WDQA 3NYFA 4X9MA 3VRAA 4YT0A 1YY5A 2R45A 4ECHA 3DK8A 1KFYA 2JBVA 3ATRA 2R4JA 4LA1A 3SM8A 3UP4A 3GMCA 4K7ZA 2GV8A 1K0IA 5CKUA 2NVKX 3UOYA 1H7WA 2PHHA 4A65A 5BULA 3V76A 4C5OA 1L9DA 1RP0A 2YR5A 3BHFA 2Z5XA 2C65A 3O0HA 5JCKA 1MOKA 1ONFA 3PS9A 4FK1A 4B1BA 2FJBA 4WJYA 3CGCA 1QO8A 5EB4A 1ZK7A 2TPRA 4H4UA 1OJDA 3ITJA 2R46A 4IVMB 1D7YA 4U8PA 4MJWA 3RKHA 2XLUA 4TM1A 3QSMA 1O5WA 2GR2A 3AWIA 3NTDA 4P9SA 1D4DA 3AE7A 3T37A 2YVJA 1TRBA 4U8IA 1M6IA 3IHGA 2BS4A 3VQRA 1DOBA 4C3XA 2R0PA 5FS7A 2B9XA 1FOHA 3RP6A 1REOA 1CJ3A 2BCPA 3FG2P 1CF3A 2ACZA 4USQA 5HY5A 3DGZA 3DK9A 3QVRA 2J3NA 2WDVA 3GRTA 3UKKA 3LADA 4Z43A 2X99A 3CTYA 4U8LA 4J36A 2XVEA 1Q1RA 2JKCA 2WHDA 1P2EA 4EIQA 1E1KA 3CNJA 3VRDB 1PBDA 3M12A 4CRTA 3SXQA 3GYIA 2BS3A 1GETA 4EMIA 4OPTA 2YLRA 3C96A 2XYOA 2GVCA 4DSGA 4ADWA 1Y0PA 1PXAA 3CGBA 3K7MX 4J57A 1H81A 5U63A 1F8RA 3UTGA 4OPLA 2JAEA 4K5SA 3B6DA 2BABA 5BVAA 3UKFA 1ELIA 1GRAA 3QSSA 2V3BA 3KKJA 2YLZA 3H8IA 2XCGA 5DBJA 2HQMA 4RSLA 2C7GA 4UDRA 2C73A 4J34A 5U1OA 5HYMA 4ICYA 2PYXA 3DA1A 3UOVA 2FJDA 5FMHA 3NNEA 2XLTA 3ALJA 1E1MA 1E7PA 2YG7A 1O94A 1NAAA 2AAQA 3K7QX 1K0JA 2OLNA 1D4EA 2BXRA 2GAGB 2XLRA 3AD9B 3LB8A 4IA6A 2GB0A 4XWZA 5HHFA 2YG3A 3CN8A 3R9UA 1K4QA 3SQPA 4CY8A 3CNTA 4B64A 3NG7X 2WOWA 3DJGX 1GSNA 3NK0X 3PO7A 4OCGA 1PJ5A 4U8KA 3C4NA 1LQUA 1OJ9A 1SEZA 3KLJA 3LG1A 3OWMA 2BCGG 4OVIA 4TM3A 1B5QA 1CJ4A 3KA7A 3ABVA 1TDFA 2A87A 1EL8A 4NTEA 1GALA 1BKWA 1NHSA 4H2QA 1ZMDA 1B8SA 5GRTA 4K2XA 4BV6A 3IWAA 4EIPA 3G5RA 1ZX9A 2Q0LA 2FBWA 3HZLA 1FL2A 3K30A 1F3PA 2B76A 3UCLA 2WPFA 1NHPA 3ICRA 4I58A 1VRQB 3F29A 3GYXA 3CPHG 3SCEA 4EMJA 4ZCCA 1D4CA 2C76A 1E1LA 2WOIA 4Z2UA 5KOWA 4BJYA 1VG0A 3M13A 1N1PA 1FEAA 2JK6A 4YKGA 3SFDA 2V5ZA 3AE1A 2A8XA 2C72A 3LJPA 1XHCA 3VR9A 4K22A 1GPEA 3AEBA 1CJ2A 1LTXR 1P2HA 2WOVA 4AT2A 4Z26A 3CNDA 5J7XA 2WETA 2RGOA 2XVHA 2JB3A 1YKJA 2VVLG 1S2YA 2Q0KA 2EQ6A 1DJNA 3PVCA 3DJEA 4I59A 4Q0TA 1CHUA 4GDEA 3GYJA 1RYIA 1GNDA 1M1RA 3CGDA 3NH3X 4B67A 4NTCA 1PBFA 1SP3A 1EL5A 1M1PA 4A6NA 3AE6A 1ZOYA 5L46A 1PN0A 3AE5A 2OALA 3UKHA 2GEWA 3UKPA 2RGJA 1DODA 2XFUA 4J56A 4M52A 1PXBA 4OPGA 3V3OA 4YSYA 4XWRA 2QAEA 3FMWA 2YLSA 4K5RA 1VDCA 3GRSA 2B9YA 4L38A 1JU2A 4H2NA 5KXJA 1F6MA 3LGQA 2C67A 3JSKA 4GUVA 1PXCA 5ER0A 4BURA 1OJCA 3EF6A 4YSHA 1JEHA 2GF3A 3KD9A 3S5WA 4PABA 5IQ4A 2IVDA 3AE2A 3ALLA 2F5ZA 4FDCB 4U2SA 4CNKA 3LZWA 3UTHA 2DKIA 4YTMA 2R0GA 4YKFA 3CNPA 1V59A 4U8MA 1IJHA 4OPCA 3AE9A 2GQFA 1QDBA 1GRHA 1GXFA 2ZZ0A 4FX9A 4PAAA 4Q17A 2YAUA 2VVLA 3Q6JA 4H2PA 1KDGA 2C64A 1NHRA 2Z5YA 3SGLA 4EQXA 3D1IA 2GMJA 4XXGA 3VRBA 3WE0A 5EBKA 3ICTA 1FS9A 2YR4A 4APNA 1BVBA 1EL9A 2X8CA 4EM4A 4CCRA 3AEDA 1CJCA 1O95A 2GR0A 2YM2A 4TM0A 2WPEA 2WPCA 3AXBA 2I0ZA 3REDA 4REKA 1YQ3A 3P4RA 4Y4NA 2C70A 4L3ZA 1NEKA 1K0LA 2X50A 3ALMA 3FBSA 5EB5A 4CCQA 4D04A 4LU6A 4A9WA 2X3NA 1HYUA 4JNAA 4TLXA 1XDIA 3V3NA 1VQWA 3GDPA 3Q9TA 2W0HA 2XVJA 3ISHA 1JRYA 4UDPA 2ARDA 2OLOA 2CDUA 4X9NA 4A6NB 4U2TA 3CNSA 1LPFA 5KVIA 1M1QA 2X8HA 3UU9A 2AR8A 4DGKA 1DNCA 2WP6A 1LQTA 3P4PA 4Q5BA 5FS6A 3IHMA 5JCIA 2A89A 2QA2A 5KVHA 4EM3A 4BK1A 4GRTA 2YG4A 3SFEA 3UKLA 3ADAB 4JQ9A 2C3DA 3AD7B 3BNGA 3AE8A 3L8KA 1IUUA 1GRBA 1KSSA 3UTFA 1DXLA 2RF7A 2BC0A 1NHQA 3BNMA 5EOWA 1E1NA 2EQ7A 4KPRA 4L3XA 1W4XA 1BWCA 4HB9A 3AECA 2GRTA 1FT6A 1GU6A 1OAHA 1H83A 1TYPA 2FJAA 2BK3A 2GAHB 2QA1A 1TDKA 4L3YA 2X8GA 3BNJA 1CC4A 1PJ6A 1AOGA 1H6VA 1FS7A 5C3JA 1L0VA 2E1MA 4B63A 4A79A 2WP9A 4O5UA 2ZBWA 1NG4A 4B68A 1H7XA 1FEBA 1XANA 3F8RA 4A99A 4RG3A 4B65A 2XVFA 2WEUA 4Z44A 3UP5A 4H4PA 4NZHA 2IIDA 1S3BA 3RNMA 2LFCA 3AB1A 1YQ4A 1FT5A 1Q9IA 2V60A 4Z25A 3LXDA 4J33A 2NPXA 3AYLA 3BI5A 4X4JA 1PDHA 3M0OA 2BACA 4FK1C 4H4RA 2R0CA 3DMEA 1YQZA 3VR8A 3GM6A 1DJQA 4H4YA 3UTEA 2FJEA 1JNRA 2R9ZA 3KPFA 2BK4A 4ZCDA 4BJZA 3NYCA 1D5TA 5JCLA 4Z24A 2B7RA 1IUXA 3TORA 2H89A 4H4WA 3C4AA 4H4QA 2VRLA 3URHA 3DGHA 1GERA 4B69A 2WBAA 4AOXA 2GR3A 2IVEA 3BNFA 1JNIA 3L1RA 4YWOA 3LOVA 3AEGA 1GRFA 3FO3A 3NLCA 5IQ1A 4EQSA 1GESA 4J31A 1GREA 2YLXA 2RABA 3AYJA 2Q6UA 2YG5A 1ZP0A 2VR0A 4Z2TA 4IVOB 3NRNA 3NHOX 1PBBA 3RHAA 2YLTA 2YVGA 1L9CA 1FCDA 3TTBA 4K8DA 1NG3A 1NDAA 2AQJA 3KVEA 4H4XA 4IA5A 3K7TA 1ZMCA 1N4VA 1ZOVA 1KNRA 3ZYXA 4H4SA 4O5QA 3B3RA 1MXTA 5FS9A 4B66A 4CNJA 1PS9A 4U8NA 4YSZA 2GR1A 5FS8A 4TM4A 1F8WA 2Y6RA 3BHKA 3P4QA 1EL7A 3RP8A 5LV9A 4H7UA 1BGNA 2XLSA 1RSGA 1D7LA 3QFBA 3AD8B 4NEVA 4YTNA 2DKHA 2GMHA 1GEUA 3CPJG 1KF6A 1UKVG 1PHHA 5KOXA 2K3VA 4WCTA 3NYEA 3P9UA 1MO9A 3NN0X 5JCMA 1TYTA 4IV9A 3KU9A 5HXIA 3BI4A 2VQBA 3EANA 3UOXA 1Y56A 3FPZA 3NGCX 3NK1X 4DNAA 3IF9A 1ZY8A 1H84A 3CGEA 4H2RA 4JDRA 4JY3A 3UKAA 4EQWA 2CULA 3UKQA 3EPTA 4AP1A 2WU2A 4CBQA 2OAMA 3AEEA 1Q1WA 3GD3A 4GR1A 5M0ZA 1Z6LA 1JOAA 2BS2A 1GV4A
chains in the Genus database with same CATH superfamily
2E5VA 2BYBA 4U2LA 5KWFA 1COYA 1PBEA 3AEAA 3D1CA 2YR6A 1S3EA 2B9WA 1F8SA 4GF7A 1OJTA 5BUKA 2BA9A 3CMMA 3HYWA 5KMQA 1VG9A 2C75A 4Q4UA 1FS8A 4RG4A 3EAOA 1JNZA 1BZLA 4AOSA 3AEFA 1BF3A 1ZKQA 4KX6A 1CC2A 2C3CA 2JB1A 2RGHA 3HYXA 3ICSA 4H4TA 4NEWA 5JCNA 1B37A 5U25A 3SYIA 1N4UA 3ATQA 2JB2A 5C2TA 2VZ2A 3OC4A 4UDQA 2ZO5A 4AT0A 3AYIA 3S7WA 2APGA 2QCUA 4YXDA 1TDNA 3UBRA 4Q1OA 1DOEA 4G6GA 2Y6QA 1GT8A 2XDOA 3II4A 2YLWA 1BGJA 3GSIA 3AE4A 3F8DA 4HA6A 3CIRA 3GDNA 1CC6A 1L9EA 2RDZA 1IUWA 4EQRA 2V3AA 2XVIA 3NKSA 3COXA 4II2A 4E0VA 1IUVA 2BXSA 3S61A 3P4SA 2VVMA 2J7AA 2CFYA 1S2QA 4JN9A 2VRMA 5CQFA 4USRA 2YQUA 3DJJA 3UOZA 1CBOA 2C66A 2XFQA 3QSEA 3FIMB 4YTPA 2WDRA 1FECA 3DJDA 5GSNA 2EQ8A 5TR3A 2O9ZA 1TDEA 3GD4A 3H8LA 5KRQA 4AP3A 1M64A 1GRTA 3GWFA 4CY6A 2V6OA 2E81A 1Y56B 5KMPA 3L1TA 2WP5A 3NIXA 4EMWA 3NN6X 4U8JA 2B7SA 3IC9A 5IPYA 2E80A 3I6DA 1JRXA 4OPUA 3NT6A 4H4VA 1GTEA 1KNPA 4H4ZA 3T2YA 2XFPA 3BI2A 4NTDA 4G6HA 2CVJA 4NWZA 2OT4A 3P1WA 1JRZA 1LVLA 2WS3A 2XLPA 3H4KA 1GRGA 4UP3A 2YVFA 4A7AA 3OZ2A 4BK2A 1EBDA 1GOSA 4GCMA 4D03A 4J2WA 3DH9A 4U8OA 1XPQA 4BK3A 4Y4LA 1GTHA 2VQ7A 2Q7VA 1NPXA 3ZDNA 2OA1A 2EQ9A 2UZZA 1E6EA 1IUSA 3D8XA 3E1TA 2BK5A 2E4GA 2BRAA 2GH5A 2VOUA 3BNUA 4A5LA 3QVPA 2YG6A 2BC1A 4OPIA 1X31B 3NK2X 2ZZBA 2ZZCA 1B4VA 1QJDA 3G5SA 1CL0A 1IUTA 2R4EA 4WX1A 4C74A 1ZDLA 4C3YA 1TDOA 2V61A 4H50A 3NTAA 3F8PA 5BRTA 2WESA 4Z2RA 3LZXA 1PJ7A 3SZFA 2WQYA 4C77A 2XFNA 3SY4A 4YSXA 1E39A 1DOCA 1H86A 4OPDA 3CPIG 4N9XA 2XFOA 4DSHA 1LV0A 1LJ1A 3DK4A 3G5QA 5KMSA 1N4WA 2YM1A 2GQWA 1QLBA 4ZN0A 3QFAA 3GWDA 2H88A 3RP7A 2TMDA 1OJAA 2WU5A 4JY2A 1NENA 1H82A 1PBCA 4JNQA 3I3LA 4Q5CA 3QJ4A 4Y4MA 3AE3A 2YWLA 4GDPA 4TLZA 3GMBA 1KSUA 3HYVA 3BNHA 4LIIA 3MMOA 5J60A 5M10A 3T0KA 2WDQA 3NYFA 4X9MA 3VRAA 4YT0A 1YY5A 2R45A 4ECHA 3DK8A 1KFYA 2JBVA 3ATRA 2R4JA 4LA1A 3SM8A 3UP4A 3GMCA 4K7ZA 2GV8A 1K0IA 5CKUA 2NVKX 3UOYA 1H7WA 2PHHA 3SXIA 4A65A 5BULA 3V76A 4C5OA 1L9DA 1RP0A 2YR5A 3BHFA 2Z5XA 2C65A 3O0HA 4NNJA 5JCKA 1MOKA 1ONFA 3PS9A 4FK1A 4B1BA 2FJBA 4WJYA 3CGCA 1QO8A 5EB4A 1ZK7A 2TPRA 4H4UA 1OJDA 3ITJA 2R46A 4IVMB 1D7YA 4U8PA 4MJWA 3RKHA 2XLUA 4TM1A 3QSMA 1O5WA 2GR2A 3AWIA 3NTDA 4P9SA 1D4DA 3AE7A 3T37A 2YVJA 1TRBA 4U8IA 1M6IA 3IHGA 2BS4A 3VQRA 1DOBA 4C3XA 2R0PA 5FS7A 2B9XA 1FOHA 3RP6A 1REOA 1CJ3A 2BCPA 3FG2P 3T31A 1CF3A 2ACZA 4USQA 5HY5A 3DGZA 3DK9A 3QVRA 2J3NA 2WDVA 3GRTA 3UKKA 3LADA 5KMRA 4Z43A 2X99A 3CTYA 4U8LA 4J36A 2XVEA 1Q1RA 2JKCA 2WHDA 1P2EA 4EIQA 1E1KA 3CNJA 3VRDB 1PBDA 3M12A 4CRTA 3SXQA 3GYIA 2BS3A 1GETA 4EMIA 4OPTA 2YLRA 3C96A 2XYOA 2GVCA 4DSGA 4ADWA 1Y0PA 1PXAA 3CGBA 3K7MX 4J57A 1H81A 5U63A 1F8RA 3UTGA 3SZWA 4OPLA 2JAEA 4K5SA 3B6DA 2BABA 5BVAA 3UKFA 1ELIA 1GRAA 3QSSA 2V3BA 3KKJA 2YLZA 3H8IA 2XCGA 5DBJA 2HQMA 4RSLA 4GAPA 2C7GA 4UDRA 2C73A 4J34A 5U1OA 5HYMA 4ICYA 2PYXA 3DA1A 3UOVA 2FJDA 5FMHA 3NNEA 2XLTA 3ALJA 1E1MA 1E7PA 2YG7A 1O94A 1NAAA 2AAQA 3K7QX 1K0JA 2OLNA 1D4EA 2BXRA 2GAGB 2XLRA 3AD9B 3LB8A 4IA6A 2GB0A 4XWZA 5HHFA 2YG3A 3CN8A 3R9UA 1K4QA 3SQPA 4CY8A 3CNTA 4B64A 3NG7X 2WOWA 3DJGX 1GSNA 3NK0X 3PO7A 4OCGA 3T14A 1PJ5A 4U8KA 3C4NA 1LQUA 1OJ9A 1SEZA 3KLJA 3LG1A 3OWMA 2BCGG 4OVIA 4TM3A 1B5QA 1CJ4A 3KA7A 3ABVA 1TDFA 2A87A 1EL8A 4NTEA 1GALA 1BKWA 1NHSA 4H2QA 1ZMDA 1B8SA 5GRTA 4K2XA 4BV6A 3IWAA 4EIPA 3G5RA 1ZX9A 2Q0LA 2FBWA 3HZLA 1FL2A 3K30A 1F3PA 2B76A 3UCLA 2WPFA 1NHPA 3ICRA 4I58A 1VRQB 3F29A 3GYXA 3CPHG 3SCEA 4EMJA 4ZCCA 1D4CA 2C76A 1E1LA 2WOIA 4Z2UA 5KOWA 4BJYA 1VG0A 3M13A 1N1PA 1FEAA 2JK6A 4YKGA 3SFDA 2V5ZA 3AE1A 2A8XA 2C72A 3LJPA 1XHCA 3VR9A 4K22A 1GPEA 3AEBA 1CJ2A 1LTXR 1P2HA 2WOVA 4AT2A 4Z26A 3CNDA 5J7XA 2WETA 2RGOA 2XVHA 2JB3A 1YKJA 2VVLG 1S2YA 2Q0KA 2EQ6A 1DJNA 3PVCA 3DJEA 4I59A 4Q0TA 1CHUA 4GDEA 3GYJA 1RYIA 1GNDA 1M1RA 3CGDA 3NH3X 4B67A 4NTCA 1PBFA 1SP3A 1EL5A 1M1PA 4A6NA 3AE6A 1ZOYA 5L46A 1PN0A 3AE5A 2OALA 3UKHA 2GEWA 3UKPA 2RGJA 1DODA 2XFUA 4J56A 4M52A 1PXBA 4OPGA 3V3OA 4YSYA 4XWRA 2QAEA 3FMWA 2YLSA 4K5RA 1VDCA 3GRSA 2B9YA 4L38A 1JU2A 4H2NA 5KXJA 1F6MA 3LGQA 2C67A 3JSKA 4GUVA 1PXCA 5ER0A 4BURA 1OJCA 3EF6A 4YSHA 1JEHA 2GF3A 3KD9A 3S5WA 4PABA 5IQ4A 2IVDA 3AE2A 3ALLA 2F5ZA 4FDCB 4U2SA 4CNKA 3LZWA 3UTHA 2DKIA 4YTMA 2R0GA 4YKFA 3CNPA 1V59A 4U8MA 1IJHA 4OPCA 3AE9A 2GQFA 1QDBA 1GRHA 1GXFA 2ZZ0A 4FX9A 4PAAA 4EQXA 4Q17A 2YAUA 2VVLA 3Q6JA 4H2PA 1KDGA 2C64A 1NHRA 2Z5YA 4GAVA 3SGLA 3D1IA 2CZSA 2GMJA 4XXGA 3VRBA 5EBKA 3ICTA 1FS9A 3WE0A 2YR4A 4APNA 1BVBA 1EL9A 2X8CA 4EM4A 4CCRA 3AEDA 1CJCA 1O95A 2GR0A 2YM2A 4TM0A 2WPEA 2WPCA 3AXBA 2I0ZA 3REDA 4REKA 1YQ3A 3P4RA 4Y4NA 2C70A 5KNLA 4L3ZA 1NEKA 1K0LA 4G73A 2X50A 3ALMA 3FBSA 5EB5A 4CCQA 4D04A 4LU6A 4A9WA 2X3NA 1HYUA 4JNAA 4TLXA 1XDIA 3V3NA 1VQWA 3GDPA 3Q9TA 2W0HA 2XVJA 4G74A 3ISHA 1JRYA 4UDPA 2ARDA 2OLOA 2CDUA 4X9NA 4A6NB 4U2TA 3CNSA 1LPFA 5KVIA 1M1QA 2X8HA 3UU9A 2AR8A 2BRYA 4DGKA 1DNCA 2WP6A 1LQTA 3P4PA 4Q5BA 5FS6A 3IHMA 5JCIA 2A89A 2QA2A 5KVHA 4EM3A 4BK1A 4GRTA 2YG4A 3SFEA 3UKLA 3ADAB 4JQ9A 2C3DA 3AD7B 3BNGA 3AE8A 3L8KA 1IUUA 1GRBA 1KSSA 3UTFA 1DXLA 2RF7A 2BC0A 1NHQA 3BNMA 5EOWA 1E1NA 2EQ7A 4KPRA 4L3XA 1W4XA 1BWCA 4HB9A 3AECA 2GRTA 1FT6A 1GU6A 1OAHA 1H83A 1TYPA 2FJAA 2BK3A 2GAHB 2QA1A 1TDKA 4L3YA 2X8GA 3BNJA 1CC4A 1PJ6A 1AOGA 1H6VA 1FS7A 5C3JA 1L0VA 2E1MA 4B63A 4A79A 2WP9A 4O5UA 2ZBWA 1NG4A 4B68A 1H7XA 1FEBA 1XANA 3F8RA 4A99A 4RG3A 4B65A 2XVFA 2WEUA 4Z44A 3UP5A 2C4CA 4H4PA 4NZHA 2IIDA 1S3BA 3RNMA 2LFCA 3AB1A 1YQ4A 1FT5A 1Q9IA 2V60A 4Z25A 3LXDA 4J33A 2NPXA 3AYLA 3BI5A 4X4JA 1PDHA 3M0OA 2BACA 4FK1C 4H4RA 2R0CA 3DMEA 1YQZA 3VR8A 3GM6A 1DJQA 4H4YA 3UTEA 2FJEA 1JNRA 2R9ZA 3KPFA 2BK4A 4ZCDA 4BJZA 3NYCA 1D5TA 3T2ZA 5JCLA 4Z24A 3KPKA 2B7RA 1IUXA 3TORA 2H89A 4H4WA 3C4AA 4H4QA 2VRLA 3URHA 3DGHA 1GERA 4B69A 2WBAA 4AOXA 2GR3A 2IVEA 3BNFA 1JNIA 3L1RA 4YWOA 3LOVA 3AEGA 3SZCA 1GRFA 3FO3A 3NLCA 5IQ1A 4EQSA 1GESA 4J31A 1GREA 2YLXA 2RABA 3AYJA 2Q6UA 2YG5A 1ZP0A 2VR0A 4Z2TA 4IVOB 3NRNA 3NHOX 1PBBA 3RHAA 2YLTA 2YVGA 1L9CA 1FCDA 3TTBA 4K8DA 1NG3A 2AQJA 1NDAA 3KVEA 4H4XA 3SX6A 4IA5A 3K7TA 1ZMCA 1N4VA 1ZOVA 1KNRA 3ZYXA 4H4SA 4O5QA 3B3RA 1MXTA 5FS9A 4B66A 4CNJA 1PS9A 4U8NA 4YSZA 2GR1A 4G9KA 5FS8A 4TM4A 1F8WA 2Y6RA 3BHKA 3P4QA 1EL7A 3RP8A 5LV9A 4H7UA 1BGNA 2XLSA 1RSGA 1D7LA 3QFBA 3AD8B 4NEVA 4YTNA 2DKHA 2GMHA 1GEUA 3CPJG 1KF6A 1UKVG 1PHHA 5KOXA 4II3A 2K3VA 4WCTA 3NYEA 3P9UA 1MO9A 3NN0X 5JCMA 1TYTA 4IV9A 3KU9A 3SZ0A 5HXIA 3BI4A 2VQBA 3EANA 3UOXA 1Y56A 3FPZA 3NGCX 3NK1X 4DNAA 3IF9A 1ZY8A 1H84A 3CGEA 4H2RA 4JDRA 4JY3A 3UKAA 4EQWA 2CULA 3UKQA 3EPTA 4AP1A 2WU2A 4CBQA 2OAMA 3AEEA 1Q1WA 3GD3A 4GR1A 5M0ZA 3T2KA 1Z6LA 1JOAA 2BS2A 1GV4A
chains in the Genus database with same CATH topology
2E5VA 2BYBA 4U2LA 5KWFA 1COYA 1PBEA 3AEAA 3D1CA 2YR6A 1S3EA 2B9WA 1F8SA 4GF7A 1OJTA 5BUKA 2BA9A 3CMMA 3HYWA 5KMQA 1VG9A 2C75A 4Q4UA 1FS8A 4RG4A 3EAOA 1JNZA 1BZLA 4AOSA 3AEFA 1BF3A 1ZKQA 4KX6A 1CC2A 2C3CA 2JB1A 2RGHA 3HYXA 3ICSA 4H4TA 4NEWA 5JCNA 1B37A 5U25A 3SYIA 1N4UA 3ATQA 2JB2A 5C2TA 2VZ2A 3OC4A 4UDQA 2ZO5A 4AT0A 3AYIA 3S7WA 2APGA 2QCUA 4YXDA 1TDNA 3UBRA 4Q1OA 1DOEA 4G6GA 2Y6QA 1GT8A 2XDOA 3II4A 2YLWA 1BGJA 3GSIA 3AE4A 3F8DA 4HA6A 3CIRA 3GDNA 1CC6A 1L9EA 2RDZA 1IUWA 4EQRA 2V3AA 2XVIA 3NKSA 3COXA 4II2A 4E0VA 1IUVA 2BXSA 3S61A 3P4SA 2VVMA 2J7AA 2CFYA 1S2QA 4JN9A 2VRMA 5CQFA 4USRA 2YQUA 3DJJA 3UOZA 1CBOA 2C66A 2XFQA 3QSEA 3FIMB 4YTPA 2WDRA 1FECA 3DJDA 5GSNA 2EQ8A 5TR3A 2O9ZA 1TDEA 3GD4A 3H8LA 5KRQA 4AP3A 1M64A 1GRTA 3GWFA 4CY6A 2V6OA 2E81A 1Y56B 5KMPA 3L1TA 2WP5A 3NIXA 4EMWA 3NN6X 4U8JA 2B7SA 3IC9A 5IPYA 2E80A 3I6DA 1JRXA 4OPUA 3NT6A 4H4VA 1GTEA 1KNPA 4H4ZA 3T2YA 2XFPA 3BI2A 4NTDA 4G6HA 2CVJA 4NWZA 2OT4A 3P1WA 1JRZA 1LVLA 2WS3A 2XLPA 3H4KA 1GRGA 4UP3A 2YVFA 4A7AA 3OZ2A 4BK2A 1EBDA 1GOSA 4GCMA 4D03A 4J2WA 3DH9A 4U8OA 1XPQA 4BK3A 4Y4LA 1GTHA 2VQ7A 2Q7VA 1NPXA 3ZDNA 2OA1A 2EQ9A 2UZZA 1E6EA 1IUSA 3D8XA 3E1TA 2BK5A 2E4GA 2BRAA 2GH5A 2VOUA 3BNUA 4A5LA 3QVPA 2YG6A 2BC1A 4OPIA 1X31B 3NK2X 2ZZBA 2ZZCA 1B4VA 1QJDA 3G5SA 1CL0A 1IUTA 2R4EA 4WX1A 4C74A 1ZDLA 4C3YA 1TDOA 2V61A 4H50A 3NTAA 3F8PA 5BRTA 2WESA 4Z2RA 3LZXA 1PJ7A 3SZFA 2WQYA 4C77A 2XFNA 3SY4A 4YSXA 1E39A 1DOCA 1H86A 4OPDA 3CPIG 4N9XA 2XFOA 4DSHA 1LV0A 1LJ1A 3DK4A 3G5QA 5KMSA 1N4WA 2YM1A 2GQWA 1QLBA 4ZN0A 3QFAA 3GWDA 2H88A 3RP7A 2TMDA 1OJAA 2WU5A 4JY2A 1NENA 1H82A 1PBCA 4JNQA 3I3LA 4Q5CA 3QJ4A 4Y4MA 3AE3A 2YWLA 4GDPA 4TLZA 3GMBA 1KSUA 3HYVA 3BNHA 4LIIA 3MMOA 5J60A 5M10A 3T0KA 2WDQA 3NYFA 4X9MA 3VRAA 4YT0A 1YY5A 2R45A 4ECHA 3DK8A 1KFYA 2JBVA 3ATRA 2R4JA 4LA1A 3SM8A 3UP4A 3GMCA 4K7ZA 2GV8A 1K0IA 5CKUA 2NVKX 3UOYA 1H7WA 2PHHA 3SXIA 4A65A 5BULA 3V76A 4C5OA 1L9DA 1RP0A 2YR5A 3BHFA 2Z5XA 2C65A 3O0HA 4NNJA 5JCKA 1MOKA 1ONFA 3PS9A 4FK1A 4B1BA 2FJBA 4WJYA 3CGCA 1QO8A 5EB4A 1ZK7A 2TPRA 4H4UA 1OJDA 3ITJA 2R46A 4IVMB 1D7YA 4U8PA 4MJWA 3RKHA 2XLUA 4TM1A 3QSMA 1O5WA 2GR2A 3AWIA 3NTDA 4P9SA 1D4DA 3AE7A 3T37A 2YVJA 1TRBA 4U8IA 1M6IA 3IHGA 2BS4A 3VQRA 1DOBA 4C3XA 2R0PA 5FS7A 2B9XA 1FOHA 3RP6A 1REOA 1CJ3A 2BCPA 3FG2P 3T31A 1CF3A 2ACZA 4USQA 5HY5A 3DGZA 3DK9A 3QVRA 2J3NA 2WDVA 3GRTA 3UKKA 3LADA 5KMRA 4Z43A 2X99A 3CTYA 4U8LA 4J36A 2XVEA 1Q1RA 2JKCA 2WHDA 1P2EA 4EIQA 1E1KA 3CNJA 3VRDB 1PBDA 3M12A 4CRTA 3SXQA 3GYIA 2BS3A 1GETA 4EMIA 4OPTA 2YLRA 3C96A 2XYOA 2GVCA 4DSGA 4ADWA 1Y0PA 1PXAA 3CGBA 3K7MX 4J57A 1H81A 5U63A 1F8RA 3UTGA 3SZWA 4OPLA 2JAEA 4K5SA 3B6DA 2BABA 5BVAA 3UKFA 1ELIA 1GRAA 3QSSA 2V3BA 3KKJA 2YLZA 3H8IA 2XCGA 5DBJA 2HQMA 4RSLA 4GAPA 2C7GA 4UDRA 2C73A 4J34A 5U1OA 5HYMA 4ICYA 2PYXA 3DA1A 3UOVA 2FJDA 5FMHA 3NNEA 2XLTA 3ALJA 1E1MA 1E7PA 2YG7A 1O94A 1NAAA 2AAQA 3K7QX 1K0JA 2OLNA 1D4EA 2BXRA 2GAGB 2XLRA 3AD9B 3LB8A 4IA6A 2GB0A 4XWZA 5HHFA 2YG3A 3CN8A 3R9UA 1K4QA 3SQPA 4CY8A 3CNTA 4B64A 3NG7X 2WOWA 3DJGX 1GSNA 3NK0X 3PO7A 4OCGA 3T14A 1PJ5A 4U8KA 3C4NA 1LQUA 1OJ9A 1SEZA 3KLJA 3LG1A 3OWMA 2BCGG 4OVIA 4TM3A 1B5QA 1CJ4A 3KA7A 3ABVA 1TDFA 2A87A 1EL8A 4NTEA 1GALA 1BKWA 1NHSA 4H2QA 1ZMDA 1B8SA 5GRTA 4K2XA 4BV6A 3IWAA 4EIPA 3G5RA 1ZX9A 2Q0LA 2FBWA 3HZLA 1FL2A 3K30A 1F3PA 2B76A 3UCLA 2WPFA 1NHPA 3ICRA 4I58A 1VRQB 3F29A 3GYXA 3CPHG 3SCEA 4EMJA 4ZCCA 1D4CA 2C76A 1E1LA 2WOIA 4Z2UA 5KOWA 4BJYA 1VG0A 3M13A 1N1PA 1FEAA 2JK6A 4YKGA 3SFDA 2V5ZA 3AE1A 2A8XA 2C72A 3LJPA 1XHCA 3VR9A 4K22A 1GPEA 3AEBA 1CJ2A 1LTXR 1P2HA 2WOVA 4AT2A 4Z26A 3CNDA 5J7XA 2WETA 2RGOA 2XVHA 2JB3A 1YKJA 2VVLG 1S2YA 2Q0KA 2EQ6A 1DJNA 3PVCA 3DJEA 4I59A 4Q0TA 1CHUA 4GDEA 3GYJA 1RYIA 1GNDA 1M1RA 3CGDA 3NH3X 4B67A 4NTCA 1PBFA 1SP3A 1EL5A 1M1PA 4A6NA 3AE6A 1ZOYA 5L46A 1PN0A 3AE5A 2OALA 3UKHA 2GEWA 3UKPA 2RGJA 1DODA 2XFUA 4J56A 4M52A 1PXBA 4OPGA 3V3OA 4YSYA 4XWRA 2QAEA 3FMWA 2YLSA 4K5RA 1VDCA 3GRSA 2B9YA 4L38A 1JU2A 4H2NA 5KXJA 1F6MA 3LGQA 2C67A 3JSKA 4GUVA 1PXCA 5ER0A 4BURA 1OJCA 3EF6A 4YSHA 1JEHA 2GF3A 3KD9A 3S5WA 4PABA 5IQ4A 2IVDA 3AE2A 3ALLA 2F5ZA 4FDCB 4U2SA 4CNKA 3LZWA 3UTHA 2DKIA 4YTMA 2R0GA 4YKFA 3CNPA 1V59A 4U8MA 1IJHA 4OPCA 3AE9A 2GQFA 1QDBA 1GRHA 1GXFA 2ZZ0A 4FX9A 4PAAA 4EQXA 4Q17A 2YAUA 2VVLA 3Q6JA 4H2PA 1KDGA 2C64A 1NHRA 2Z5YA 4GAVA 3SGLA 3D1IA 2GMJA 4XXGA 3VRBA 3WE0A 5EBKA 3ICTA 1FS9A 2YR4A 4APNA 1BVBA 1EL9A 2X8CA 4EM4A 4CCRA 3AEDA 1CJCA 1O95A 2GR0A 2YM2A 4TM0A 2WPEA 2WPCA 3AXBA 2I0ZA 3REDA 4REKA 1YQ3A 3P4RA 4Y4NA 2C70A 5KNLA 4L3ZA 1NEKA 1K0LA 4G73A 2X50A 3ALMA 3FBSA 5EB5A 4CCQA 4D04A 4LU6A 4A9WA 2X3NA 1HYUA 4JNAA 4TLXA 1XDIA 3V3NA 1VQWA 3GDPA 3Q9TA 2W0HA 2XVJA 4G74A 3ISHA 1JRYA 4UDPA 2ARDA 2OLOA 2CDUA 4X9NA 4A6NB 4U2TA 3CNSA 1LPFA 5KVIA 1M1QA 2X8HA 3UU9A 2AR8A 2BRYA 4DGKA 1DNCA 2WP6A 1LQTA 3P4PA 4Q5BA 5FS6A 3IHMA 5JCIA 2A89A 2QA2A 5KVHA 4EM3A 4BK1A 4GRTA 2YG4A 3SFEA 3UKLA 3ADAB 4JQ9A 2C3DA 3AD7B 3BNGA 3AE8A 3L8KA 1IUUA 1GRBA 1KSSA 3UTFA 1DXLA 2RF7A 2BC0A 1NHQA 3BNMA 5EOWA 1E1NA 2EQ7A 4KPRA 4L3XA 1W4XA 1BWCA 4HB9A 3AECA 2GRTA 1FT6A 1GU6A 1OAHA 1H83A 1TYPA 2FJAA 2BK3A 2GAHB 2QA1A 1TDKA 4L3YA 2X8GA 3BNJA 1CC4A 1PJ6A 1AOGA 1H6VA 1FS7A 5C3JA 1L0VA 2E1MA 4B63A 4A79A 2WP9A 4O5UA 2ZBWA 1NG4A 4B68A 1H7XA 1FEBA 1XANA 3F8RA 4A99A 4RG3A 4B65A 2XVFA 2WEUA 4Z44A 3UP5A 2C4CA 4H4PA 4NZHA 2IIDA 1S3BA 3RNMA 2LFCA 3AB1A 1YQ4A 1FT5A 1Q9IA 2V60A 4Z25A 3LXDA 4J33A 2NPXA 3AYLA 3BI5A 4X4JA 1PDHA 3M0OA 2BACA 4FK1C 4H4RA 2R0CA 3DMEA 1YQZA 3VR8A 3GM6A 1DJQA 4H4YA 3UTEA 2FJEA 1JNRA 2R9ZA 3KPFA 2BK4A 4ZCDA 4BJZA 3NYCA 1D5TA 3T2ZA 5JCLA 4Z24A 3KPKA 2B7RA 1IUXA 3TORA 2H89A 4H4WA 3C4AA 4H4QA 2VRLA 3URHA 3DGHA 1GERA 4B69A 2WBAA 4AOXA 2GR3A 2IVEA 3BNFA 1JNIA 3L1RA 4YWOA 3LOVA 3AEGA 3SZCA 1GRFA 3FO3A 3NLCA 5IQ1A 4EQSA 1GESA 4J31A 1GREA 2YLXA 2RABA 3AYJA 2Q6UA 2YG5A 1ZP0A 2VR0A 4Z2TA 4IVOB 3NRNA 3NHOX 1PBBA 3RHAA 2YLTA 2YVGA 1L9CA 1FCDA 3TTBA 4K8DA 1NG3A 1NDAA 2AQJA 3KVEA 4H4XA 3SX6A 4IA5A 3K7TA 1ZMCA 1N4VA 1ZOVA 1KNRA 3ZYXA 4H4SA 4O5QA 3B3RA 1MXTA 5FS9A 4B66A 4CNJA 1PS9A 4U8NA 4YSZA 2GR1A 4G9KA 5FS8A 4TM4A 1F8WA 2Y6RA 3BHKA 3P4QA 1EL7A 3RP8A 5LV9A 4H7UA 1BGNA 2XLSA 1RSGA 1D7LA 3QFBA 3AD8B 4NEVA 4YTNA 2DKHA 2GMHA 1GEUA 3CPJG 1KF6A 1UKVG 1PHHA 5KOXA 4II3A 2K3VA 4WCTA 3NYEA 3P9UA 1MO9A 3NN0X 5JCMA 1TYTA 4IV9A 3KU9A 3SZ0A 5HXIA 3BI4A 2VQBA 3EANA 3UOXA 1Y56A 3FPZA 3NGCX 3NK1X 4DNAA 3IF9A 1ZY8A 1H84A 3CGEA 4H2RA 4JDRA 4JY3A 3UKAA 4EQWA 2CULA 3UKQA 3EPTA 4AP1A 2WU2A 4CBQA 2OAMA 3AEEA 1Q1WA 3GD3A 4GR1A 5M0ZA 3T2KA 1Z6LA 1JOAA 2BS2A 1GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5V A;  2BYB A;  4U2L A;  5KWF A;  1COY A;  1PBE A;  3AEA A;  3D1C A;  2YR6 A;  1S3E A;  2B9W A;  1F8S A;  4GF7 A;  1OJT A;  5BUK A;  2BA9 A;  1VG9 A;  2C75 A;  4Q4U A;  1FS8 A;  4RG4 A;  3EAO A;  1JNZ A;  1BZL A;  4AOS A;  3AEF A;  1BF3 A;  1ZKQ A;  4KX6 A;  1CC2 A;  2C3C A;  2JB1 A;  2RGH A;  4NEW A;  3ICS A;  4H4T A;  5JCN A;  1B37 A;  5U25 A;  1N4U A;  3ATQ A;  2JB2 A;  5C2T A;  2VZ2 A;  3OC4 A;  4UDQ A;  2ZO5 A;  4AT0 A;  3AYI A;  3S7W A;  2APG A;  2QCU A;  4YXD A;  1TDN A;  3UBR A;  4Q1O A;  1DOE A;  2Y6Q A;  1GT8 A;  2XDO A;  3II4 A;  2YLW A;  1BGJ A;  3GSI A;  3AE4 A;  3F8D A;  4HA6 A;  3CIR A;  3GDN A;  1CC6 A;  1L9E A;  2RDZ A;  1IUW A;  4EQR A;  2V3A A;  2XVI A;  3NKS A;  3COX A;  4E0V A;  1IUV A;  2BXS A;  3S61 A;  3P4S A;  2VVM A;  2J7A A;  2CFY A;  1S2Q A;  4JN9 A;  2VRM A;  5CQF A;  4USR A;  2YQU A;  3DJJ A;  3UOZ A;  1CBO A;  2C66 A;  2XFQ A;  3QSE A;  3FIM B;  4YTP A;  2WDR A;  1FEC A;  3DJD A;  5GSN A;  2EQ8 A;  5TR3 A;  2O9Z A;  1TDE A;  3GD4 A;  3H8L A;  5KRQ A;  4AP3 A;  1M64 A;  1GRT A;  3GWF A;  4CY6 A;  2V6O A;  2E81 A;  1Y56 B;  3L1T A;  2WP5 A;  3NIX A;  4EMW A;  3NN6 X;  4U8J A;  2B7S A;  3IC9 A;  5IPY A;  2E80 A;  3I6D A;  1JRX A;  4OPU A;  3NT6 A;  4H4V A;  1GTE A;  1KNP A;  4H4Z A;  2XFP A;  3BI2 A;  4NTD A;  2CVJ A;  2OT4 A;  3P1W A;  1JRZ A;  1LVL A;  2WS3 A;  2XLP A;  3H4K A;  1GRG A;  4UP3 A;  2YVF A;  4A7A A;  3OZ2 A;  4BK2 A;  1EBD A;  1GOS A;  4GCM A;  4D03 A;  4J2W A;  3DH9 A;  4U8O A;  1XPQ A;  4BK3 A;  4Y4L A;  1GTH A;  2VQ7 A;  2Q7V A;  1NPX A;  3ZDN A;  2OA1 A;  2EQ9 A;  2UZZ A;  1E6E A;  1IUS A;  3D8X A;  3E1T A;  2BK5 A;  2E4G A;  2VOU A;  2GH5 A;  3BNU A;  4A5L A;  3QVP A;  2YG6 A;  2BC1 A;  4OPI A;  1X31 B;  3NK2 X;  2ZZB A;  2ZZC A;  1B4V A;  1QJD A;  3G5S A;  1CL0 A;  1IUT A;  2R4E A;  4WX1 A;  4C74 A;  1ZDL A;  4C3Y A;  1TDO A;  2V61 A;  4H50 A;  3NTA A;  3F8P A;  5BRT A;  2WES A;  4Z2R A;  3LZX A;  1PJ7 A;  2WQY A;  4C77 A;  2XFN A;  4YSX A;  1E39 A;  1DOC A;  1H86 A;  4OPD A;  3CPI G;  4N9X A;  2XFO A;  4DSH A;  1LV0 A;  1LJ1 A;  3DK4 A;  3G5Q A;  1N4W A;  2YM1 A;  2GQW A;  1QLB A;  4ZN0 A;  3QFA A;  3GWD A;  2H88 A;  3RP7 A;  2TMD A;  1OJA A;  2WU5 A;  4JY2 A;  1NEN A;  1H82 A;  1PBC A;  4JNQ A;  3I3L A;  4Q5C A;  3QJ4 A;  4Y4M A;  3AE3 A;  2YWL A;  4GDP A;  4TLZ A;  3GMB A;  1KSU A;  3BNH A;  4LII A;  3MMO A;  5J60 A;  5M10 A;  2WDQ A;  3NYF A;  4X9M A;  3VRA A;  4YT0 A;  1YY5 A;  2R45 A;  4ECH A;  3DK8 A;  1KFY A;  2JBV A;  3ATR A;  2R4J A;  4LA1 A;  3SM8 A;  3UP4 A;  3GMC A;  4K7Z A;  2GV8 A;  1K0I A;  5CKU A;  2NVK X;  3UOY A;  1H7W A;  2PHH A;  4A65 A;  5BUL A;  3V76 A;  4C5O A;  1L9D A;  1RP0 A;  2YR5 A;  3BHF A;  2Z5X A;  2C65 A;  3O0H A;  5JCK A;  1MOK A;  1ONF A;  3PS9 A;  4FK1 A;  4B1B A;  2FJB A;  4WJY A;  3CGC A;  1QO8 A;  5EB4 A;  1ZK7 A;  2TPR A;  4H4U A;  1OJD A;  3ITJ A;  2R46 A;  4IVM B;  1D7Y A;  4U8P A;  4MJW A;  3RKH A;  2XLU A;  4TM1 A;  3QSM A;  1O5W A;  2GR2 A;  3AWI A;  3NTD A;  4P9S A;  1D4D A;  3AE7 A;  3T37 A;  2YVJ A;  1TRB A;  4U8I A;  1M6I A;  3IHG A;  2BS4 A;  3VQR A;  1DOB A;  4C3X A;  2R0P A;  5FS7 A;  2B9X A;  1FOH A;  3RP6 A;  1REO A;  1CJ3 A;  2BCP A;  3FG2 P;  1CF3 A;  2ACZ A;  4USQ A;  5HY5 A;  3DGZ A;  3DK9 A;  3QVR A;  2J3N A;  2WDV A;  3GRT A;  3UKK A;  3LAD A;  4Z43 A;  2X99 A;  3CTY A;  4U8L A;  4J36 A;  2XVE A;  1Q1R A;  2JKC A;  2WHD A;  1P2E A;  4EIQ A;  1E1K A;  3CNJ A;  3VRD B;  1PBD A;  3M12 A;  4CRT A;  3SXQ A;  3GYI A;  2BS3 A;  1GET A;  4EMI A;  4OPT A;  2YLR A;  3C96 A;  2XYO A;  2GVC A;  4DSG A;  4ADW A;  1Y0P A;  1PXA A;  3CGB A;  3K7M X;  4J57 A;  1H81 A;  5U63 A;  1F8R A;  3UTG A;  4OPL A;  2JAE A;  4K5S A;  3B6D A;  2BAB A;  5BVA A;  3UKF A;  1ELI A;  1GRA A;  3QSS A;  2V3B A;  3KKJ A;  2YLZ A;  3H8I A;  2XCG A;  5DBJ A;  2HQM A;  4RSL A;  2C7G A;  4UDR A;  2C73 A;  4J34 A;  5U1O A;  5HYM A;  4ICY A;  2PYX A;  3DA1 A;  3UOV A;  2FJD A;  5FMH A;  3NNE A;  2XLT A;  3ALJ A;  1E1M A;  1E7P A;  2YG7 A;  1O94 A;  1NAA A;  2AAQ A;  3K7Q X;  1K0J A;  2OLN A;  1D4E A;  2BXR A;  2GAG B;  2XLR A;  3AD9 B;  3LB8 A;  4IA6 A;  2GB0 A;  4XWZ A;  5HHF A;  2YG3 A;  3CN8 A;  3R9U A;  1K4Q A;  3SQP A;  4CY8 A;  3CNT A;  4B64 A;  3NG7 X;  2WOW A;  3DJG X;  1GSN A;  3NK0 X;  3PO7 A;  4OCG A;  1PJ5 A;  4U8K A;  3C4N A;  1LQU A;  1OJ9 A;  1SEZ A;  3KLJ A;  3LG1 A;  3OWM A;  2BCG G;  4OVI A;  4TM3 A;  1B5Q A;  1CJ4 A;  3KA7 A;  3ABV A;  1TDF A;  2A87 A;  1EL8 A;  4NTE A;  1GAL A;  1BKW A;  1NHS A;  4H2Q A;  1ZMD A;  1B8S A;  5GRT A;  4K2X A;  4BV6 A;  3IWA A;  4EIP A;  3G5R A;  1ZX9 A;  2Q0L A;  2FBW A;  3HZL A;  1FL2 A;  3K30 A;  1F3P A;  2B76 A;  3UCL A;  2WPF A;  1NHP A;  3ICR A;  4I58 A;  1VRQ B;  3F29 A;  3GYX A;  3CPH G;  3SCE A;  4EMJ A;  4ZCC A;  1D4C A;  2C76 A;  1E1L A;  2WOI A;  4Z2U A;  5KOW A;  4BJY A;  1VG0 A;  3M13 A;  1N1P A;  1FEA A;  2JK6 A;  4YKG A;  3SFD A;  2V5Z A;  3AE1 A;  2A8X A;  2C72 A;  3LJP A;  1XHC A;  3VR9 A;  4K22 A;  1GPE A;  3AEB A;  1CJ2 A;  1LTX R;  1P2H A;  2WOV A;  4AT2 A;  4Z26 A;  3CND A;  5J7X A;  2WET A;  2RGO A;  2XVH A;  2JB3 A;  1YKJ A;  2VVL G;  1S2Y A;  2Q0K A;  2EQ6 A;  1DJN A;  3PVC A;  3DJE A;  4I59 A;  4Q0T A;  1CHU A;  4GDE A;  3GYJ A;  1RYI A;  1GND A;  1M1R A;  3CGD A;  3NH3 X;  4B67 A;  4NTC A;  1PBF A;  1SP3 A;  1EL5 A;  1M1P A;  4A6N A;  3AE6 A;  1ZOY A;  5L46 A;  1PN0 A;  3AE5 A;  2OAL A;  3UKH A;  2GEW A;  3UKP A;  2RGJ A;  1DOD A;  2XFU A;  4J56 A;  4M52 A;  1PXB A;  4OPG A;  3V3O A;  4YSY A;  4XWR A;  2QAE A;  3FMW A;  2YLS A;  4K5R A;  1VDC A;  3GRS A;  2B9Y A;  4L38 A;  1JU2 A;  4H2N A;  5KXJ A;  1F6M A;  3LGQ A;  2C67 A;  3JSK A;  4GUV A;  1PXC A;  5ER0 A;  4BUR A;  1OJC A;  3EF6 A;  4YSH A;  1JEH A;  2GF3 A;  3KD9 A;  3S5W A;  4PAB A;  5IQ4 A;  2IVD A;  3AE2 A;  3ALL A;  2F5Z A;  4FDC B;  4U2S A;  4CNK A;  3LZW A;  3UTH A;  2DKI A;  4YTM A;  2R0G A;  4YKF A;  3CNP A;  1V59 A;  4U8M A;  1IJH A;  4OPC A;  3AE9 A;  2GQF A;  1QDB A;  1GRH A;  1GXF A;  2ZZ0 A;  4FX9 A;  4PAA A;  4Q17 A;  2YAU A;  2VVL A;  3Q6J A;  4H2P A;  1KDG A;  2C64 A;  1NHR A;  2Z5Y A;  3SGL A;  4EQX A;  3D1I A;  2GMJ A;  4XXG A;  3VRB A;  3WE0 A;  5EBK A;  3ICT A;  1FS9 A;  2YR4 A;  4APN A;  1BVB A;  1EL9 A;  2X8C A;  4EM4 A;  4CCR A;  3AED A;  1CJC A;  1O95 A;  2GR0 A;  2YM2 A;  4TM0 A;  2WPE A;  2WPC A;  3AXB A;  2I0Z A;  3RED A;  4REK A;  1YQ3 A;  3P4R A;  4Y4N A;  2C70 A;  4L3Z A;  1NEK A;  1K0L A;  2X50 A;  3ALM A;  3FBS A;  5EB5 A;  4CCQ A;  4D04 A;  4LU6 A;  4A9W A;  2X3N A;  1HYU A;  4JNA A;  4TLX A;  1XDI A;  3V3N A;  1VQW A;  3GDP A;  3Q9T A;  2W0H A;  2XVJ A;  3ISH A;  1JRY A;  4UDP A;  2ARD A;  2OLO A;  2CDU A;  4X9N A;  4A6N B;  4U2T A;  3CNS A;  1LPF A;  5KVI A;  1M1Q A;  2X8H A;  3UU9 A;  2AR8 A;  4DGK A;  1DNC A;  2WP6 A;  1LQT A;  3P4P A;  4Q5B A;  5FS6 A;  3IHM A;  5JCI A;  2A89 A;  2QA2 A;  5KVH A;  4EM3 A;  4BK1 A;  4GRT A;  2YG4 A;  3SFE A;  3UKL A;  3ADA B;  4JQ9 A;  2C3D A;  3AD7 B;  3BNG A;  3AE8 A;  3L8K A;  1IUU A;  1GRB A;  1KSS A;  3UTF A;  1DXL A;  2RF7 A;  2BC0 A;  1NHQ A;  3BNM A;  5EOW A;  1E1N A;  2EQ7 A;  4KPR A;  4L3X A;  1W4X A;  1BWC A;  4HB9 A;  3AEC A;  2GRT A;  1FT6 A;  1GU6 A;  1OAH A;  1H83 A;  1TYP A;  2FJA A;  2BK3 A;  2GAH B;  2QA1 A;  1TDK A;  4L3Y A;  2X8G A;  3BNJ A;  1CC4 A;  1PJ6 A;  1AOG A;  1H6V A;  1FS7 A;  5C3J A;  1L0V A;  2E1M A;  4B63 A;  4A79 A;  2WP9 A;  4O5U A;  2ZBW A;  1NG4 A;  4B68 A;  1H7X A;  1FEB A;  1XAN A;  3F8R A;  4A99 A;  4RG3 A;  4B65 A;  2XVF A;  2WEU A;  4Z44 A;  3UP5 A;  4H4P A;  4NZH A;  2IID A;  1S3B A;  3RNM A;  2LFC A;  3AB1 A;  1YQ4 A;  1FT5 A;  1Q9I A;  2V60 A;  4Z25 A;  3LXD A;  4J33 A;  2NPX A;  3AYL A;  3BI5 A;  4X4J A;  1PDH A;  3M0O A;  2BAC A;  4FK1 C;  4H4R A;  2R0C A;  3DME A;  1YQZ A;  3VR8 A;  3GM6 A;  1DJQ A;  4H4Y A;  3UTE A;  2FJE A;  1JNR A;  2R9Z A;  3KPF A;  2BK4 A;  4ZCD A;  4BJZ A;  3NYC A;  1D5T A;  5JCL A;  4Z24 A;  2B7R A;  1IUX A;  3TOR A;  2H89 A;  4H4W A;  3C4A A;  4H4Q A;  2VRL A;  3URH A;  3DGH A;  1GER A;  4B69 A;  2WBA A;  4AOX A;  2GR3 A;  2IVE A;  3BNF A;  1JNI A;  3L1R A;  4YWO A;  3LOV A;  3AEG A;  1GRF A;  3FO3 A;  3NLC A;  5IQ1 A;  4EQS A;  1GES A;  4J31 A;  1GRE A;  2YLX A;  2RAB A;  3AYJ A;  2Q6U A;  2YG5 A;  1ZP0 A;  2VR0 A;  4Z2T A;  4IVO B;  3NRN A;  3NHO X;  1PBB A;  3RHA A;  2YLT A;  2YVG A;  1L9C A;  1FCD A;  3TTB A;  4K8D A;  1NG3 A;  1NDA A;  2AQJ A;  3KVE A;  4H4X A;  4IA5 A;  3K7T A;  1ZMC A;  1N4V A;  1ZOV A;  1KNR A;  3ZYX A;  4H4S A;  4O5Q A;  3B3R A;  1MXT A;  5FS9 A;  4B66 A;  4CNJ A;  1PS9 A;  4U8N A;  4YSZ A;  2GR1 A;  5FS8 A;  4TM4 A;  1F8W A;  2Y6R A;  3BHK A;  3P4Q A;  1EL7 A;  3RP8 A;  5LV9 A;  4H7U A;  1BGN A;  2XLS A;  1RSG A;  1D7L A;  3QFB A;  3AD8 B;  4NEV A;  4YTN A;  2DKH A;  2GMH A;  1GEU A;  3CPJ G;  1KF6 A;  1UKV G;  1PHH A;  5KOX A;  2K3V A;  4WCT A;  3NYE A;  3P9U A;  1MO9 A;  3NN0 X;  5JCM A;  1TYT A;  4IV9 A;  3KU9 A;  5HXI A;  3BI4 A;  2VQB A;  3EAN A;  3UOX A;  1Y56 A;  3FPZ A;  3NGC X;  3NK1 X;  4DNA A;  3IF9 A;  1ZY8 A;  1H84 A;  3CGE A;  4H2R A;  4JDR A;  4JY3 A;  3UKA A;  4EQW A;  2CUL A;  3UKQ A;  3EPT A;  4AP1 A;  2WU2 A;  4CBQ A;  2OAM A;  3AEE A;  1Q1W A;  3GD3 A;  4GR1 A;  5M0Z A;  1Z6L A;  1JOA A;  2BS2 A;  1GV4 A; 
#chains in the Genus database with same CATH topology
 2E5V A;  2BYB A;  4U2L A;  5KWF A;  1COY A;  1PBE A;  3AEA A;  3D1C A;  2YR6 A;  1S3E A;  2B9W A;  1F8S A;  4GF7 A;  1OJT A;  5BUK A;  2BA9 A;  3CMM A;  3HYW A;  5KMQ A;  1VG9 A;  2C75 A;  4Q4U A;  1FS8 A;  4RG4 A;  3EAO A;  1JNZ A;  1BZL A;  4AOS A;  3AEF A;  1BF3 A;  1ZKQ A;  4KX6 A;  1CC2 A;  2C3C A;  2JB1 A;  2RGH A;  3HYX A;  3ICS A;  4H4T A;  4NEW A;  5JCN A;  1B37 A;  5U25 A;  3SYI A;  1N4U A;  3ATQ A;  2JB2 A;  5C2T A;  2VZ2 A;  3OC4 A;  4UDQ A;  2ZO5 A;  4AT0 A;  3AYI A;  3S7W A;  2APG A;  2QCU A;  4YXD A;  1TDN A;  3UBR A;  4Q1O A;  1DOE A;  4G6G A;  2Y6Q A;  1GT8 A;  2XDO A;  3II4 A;  2YLW A;  1BGJ A;  3GSI A;  3AE4 A;  3F8D A;  4HA6 A;  3CIR A;  3GDN A;  1CC6 A;  1L9E A;  2RDZ A;  1IUW A;  4EQR A;  2V3A A;  2XVI A;  3NKS A;  3COX A;  4II2 A;  4E0V A;  1IUV A;  2BXS A;  3S61 A;  3P4S A;  2VVM A;  2J7A A;  2CFY A;  1S2Q A;  4JN9 A;  2VRM A;  5CQF A;  4USR A;  2YQU A;  3DJJ A;  3UOZ A;  1CBO A;  2C66 A;  2XFQ A;  3QSE A;  3FIM B;  4YTP A;  2WDR A;  1FEC A;  3DJD A;  5GSN A;  2EQ8 A;  5TR3 A;  2O9Z A;  1TDE A;  3GD4 A;  3H8L A;  5KRQ A;  4AP3 A;  1M64 A;  1GRT A;  3GWF A;  4CY6 A;  2V6O A;  2E81 A;  1Y56 B;  5KMP A;  3L1T A;  2WP5 A;  3NIX A;  4EMW A;  3NN6 X;  4U8J A;  2B7S A;  3IC9 A;  5IPY A;  2E80 A;  3I6D A;  1JRX A;  4OPU A;  3NT6 A;  4H4V A;  1GTE A;  1KNP A;  4H4Z A;  3T2Y A;  2XFP A;  3BI2 A;  4NTD A;  4G6H A;  2CVJ A;  4NWZ A;  2OT4 A;  3P1W A;  1JRZ A;  1LVL A;  2WS3 A;  2XLP A;  3H4K A;  1GRG A;  4UP3 A;  2YVF A;  4A7A A;  3OZ2 A;  4BK2 A;  1EBD A;  1GOS A;  4GCM A;  4D03 A;  4J2W A;  3DH9 A;  4U8O A;  1XPQ A;  4BK3 A;  4Y4L A;  1GTH A;  2VQ7 A;  2Q7V A;  1NPX A;  3ZDN A;  2OA1 A;  2EQ9 A;  2UZZ A;  1E6E A;  1IUS A;  3D8X A;  3E1T A;  2BK5 A;  2E4G A;  2BRA A;  2GH5 A;  2VOU A;  3BNU A;  4A5L A;  3QVP A;  2YG6 A;  2BC1 A;  4OPI A;  1X31 B;  3NK2 X;  2ZZB A;  2ZZC A;  1B4V A;  1QJD A;  3G5S A;  1CL0 A;  1IUT A;  2R4E A;  4WX1 A;  4C74 A;  1ZDL A;  4C3Y A;  1TDO A;  2V61 A;  4H50 A;  3NTA A;  3F8P A;  5BRT A;  2WES A;  4Z2R A;  3LZX A;  1PJ7 A;  3SZF A;  2WQY A;  4C77 A;  2XFN A;  3SY4 A;  4YSX A;  1E39 A;  1DOC A;  1H86 A;  4OPD A;  3CPI G;  4N9X A;  2XFO A;  4DSH A;  1LV0 A;  1LJ1 A;  3DK4 A;  3G5Q A;  5KMS A;  1N4W A;  2YM1 A;  2GQW A;  1QLB A;  4ZN0 A;  3QFA A;  3GWD A;  2H88 A;  3RP7 A;  2TMD A;  1OJA A;  2WU5 A;  4JY2 A;  1NEN A;  1H82 A;  1PBC A;  4JNQ A;  3I3L A;  4Q5C A;  3QJ4 A;  4Y4M A;  3AE3 A;  2YWL A;  4GDP A;  4TLZ A;  3GMB A;  1KSU A;  3HYV A;  3BNH A;  4LII A;  3MMO A;  5J60 A;  5M10 A;  3T0K A;  2WDQ A;  3NYF A;  4X9M A;  3VRA A;  4YT0 A;  1YY5 A;  2R45 A;  4ECH A;  3DK8 A;  1KFY A;  2JBV A;  3ATR A;  2R4J A;  4LA1 A;  3SM8 A;  3UP4 A;  3GMC A;  4K7Z A;  2GV8 A;  1K0I A;  5CKU A;  2NVK X;  3UOY A;  1H7W A;  2PHH A;  3SXI A;  4A65 A;  5BUL A;  3V76 A;  4C5O A;  1L9D A;  1RP0 A;  2YR5 A;  3BHF A;  2Z5X A;  2C65 A;  3O0H A;  4NNJ A;  5JCK A;  1MOK A;  1ONF A;  3PS9 A;  4FK1 A;  4B1B A;  2FJB A;  4WJY A;  3CGC A;  1QO8 A;  5EB4 A;  1ZK7 A;  2TPR A;  4H4U A;  1OJD A;  3ITJ A;  2R46 A;  4IVM B;  1D7Y A;  4U8P A;  4MJW A;  3RKH A;  2XLU A;  4TM1 A;  3QSM A;  1O5W A;  2GR2 A;  3AWI A;  3NTD A;  4P9S A;  1D4D A;  3AE7 A;  3T37 A;  2YVJ A;  1TRB A;  4U8I A;  1M6I A;  3IHG A;  2BS4 A;  3VQR A;  1DOB A;  4C3X A;  2R0P A;  5FS7 A;  2B9X A;  1FOH A;  3RP6 A;  1REO A;  1CJ3 A;  2BCP A;  3FG2 P;  3T31 A;  1CF3 A;  2ACZ A;  4USQ A;  5HY5 A;  3DGZ A;  3DK9 A;  3QVR A;  2J3N A;  2WDV A;  3GRT A;  3UKK A;  3LAD A;  5KMR A;  4Z43 A;  2X99 A;  3CTY A;  4U8L A;  4J36 A;  2XVE A;  1Q1R A;  2JKC A;  2WHD A;  1P2E A;  4EIQ A;  1E1K A;  3CNJ A;  3VRD B;  1PBD A;  3M12 A;  4CRT A;  3SXQ A;  3GYI A;  2BS3 A;  1GET A;  4EMI A;  4OPT A;  2YLR A;  3C96 A;  2XYO A;  2GVC A;  4DSG A;  4ADW A;  1Y0P A;  1PXA A;  3CGB A;  3K7M X;  4J57 A;  1H81 A;  5U63 A;  1F8R A;  3UTG A;  3SZW A;  4OPL A;  2JAE A;  4K5S A;  3B6D A;  2BAB A;  5BVA A;  3UKF A;  1ELI A;  1GRA A;  3QSS A;  2V3B A;  3KKJ A;  2YLZ A;  3H8I A;  2XCG A;  5DBJ A;  2HQM A;  4RSL A;  4GAP A;  2C7G A;  4UDR A;  2C73 A;  4J34 A;  5U1O A;  5HYM A;  4ICY A;  2PYX A;  3DA1 A;  3UOV A;  2FJD A;  5FMH A;  3NNE A;  2XLT A;  3ALJ A;  1E1M A;  1E7P A;  2YG7 A;  1O94 A;  1NAA A;  2AAQ A;  3K7Q X;  1K0J A;  2OLN A;  1D4E A;  2BXR A;  2GAG B;  2XLR A;  3AD9 B;  3LB8 A;  4IA6 A;  2GB0 A;  4XWZ A;  5HHF A;  2YG3 A;  3CN8 A;  3R9U A;  1K4Q A;  3SQP A;  4CY8 A;  3CNT A;  4B64 A;  3NG7 X;  2WOW A;  3DJG X;  1GSN A;  3NK0 X;  3PO7 A;  4OCG A;  3T14 A;  1PJ5 A;  4U8K A;  3C4N A;  1LQU A;  1OJ9 A;  1SEZ A;  3KLJ A;  3LG1 A;  3OWM A;  2BCG G;  4OVI A;  4TM3 A;  1B5Q A;  1CJ4 A;  3KA7 A;  3ABV A;  1TDF A;  2A87 A;  1EL8 A;  4NTE A;  1GAL A;  1BKW A;  1NHS A;  4H2Q A;  1ZMD A;  1B8S A;  5GRT A;  4K2X A;  4BV6 A;  3IWA A;  4EIP A;  3G5R A;  1ZX9 A;  2Q0L A;  2FBW A;  3HZL A;  1FL2 A;  3K30 A;  1F3P A;  2B76 A;  3UCL A;  2WPF A;  1NHP A;  3ICR A;  4I58 A;  1VRQ B;  3F29 A;  3GYX A;  3CPH G;  3SCE A;  4EMJ A;  4ZCC A;  1D4C A;  2C76 A;  1E1L A;  2WOI A;  4Z2U A;  5KOW A;  4BJY A;  1VG0 A;  3M13 A;  1N1P A;  1FEA A;  2JK6 A;  4YKG A;  3SFD A;  2V5Z A;  3AE1 A;  2A8X A;  2C72 A;  3LJP A;  1XHC A;  3VR9 A;  4K22 A;  1GPE A;  3AEB A;  1CJ2 A;  1LTX R;  1P2H A;  2WOV A;  4AT2 A;  4Z26 A;  3CND A;  5J7X A;  2WET A;  2RGO A;  2XVH A;  2JB3 A;  1YKJ A;  2VVL G;  1S2Y A;  2Q0K A;  2EQ6 A;  1DJN A;  3PVC A;  3DJE A;  4I59 A;  4Q0T A;  1CHU A;  4GDE A;  3GYJ A;  1RYI A;  1GND A;  1M1R A;  3CGD A;  3NH3 X;  4B67 A;  4NTC A;  1PBF A;  1SP3 A;  1EL5 A;  1M1P A;  4A6N A;  3AE6 A;  1ZOY A;  5L46 A;  1PN0 A;  3AE5 A;  2OAL A;  3UKH A;  2GEW A;  3UKP A;  2RGJ A;  1DOD A;  2XFU A;  4J56 A;  4M52 A;  1PXB A;  4OPG A;  3V3O A;  4YSY A;  4XWR A;  2QAE A;  3FMW A;  2YLS A;  4K5R A;  1VDC A;  3GRS A;  2B9Y A;  4L38 A;  1JU2 A;  4H2N A;  5KXJ A;  1F6M A;  3LGQ A;  2C67 A;  3JSK A;  4GUV A;  1PXC A;  5ER0 A;  4BUR A;  1OJC A;  3EF6 A;  4YSH A;  1JEH A;  2GF3 A;  3KD9 A;  3S5W A;  4PAB A;  5IQ4 A;  2IVD A;  3AE2 A;  3ALL A;  2F5Z A;  4FDC B;  4U2S A;  4CNK A;  3LZW A;  3UTH A;  2DKI A;  4YTM A;  2R0G A;  4YKF A;  3CNP A;  1V59 A;  4U8M A;  1IJH A;  4OPC A;  3AE9 A;  2GQF A;  1QDB A;  1GRH A;  1GXF A;  2ZZ0 A;  4FX9 A;  4PAA A;  4EQX A;  4Q17 A;  2YAU A;  2VVL A;  3Q6J A;  4H2P A;  1KDG A;  2C64 A;  1NHR A;  2Z5Y A;  4GAV A;  3SGL A;  3D1I A;  2CZS A;  2GMJ A;  4XXG A;  3VRB A;  5EBK A;  3ICT A;  1FS9 A;  3WE0 A;  2YR4 A;  4APN A;  1BVB A;  1EL9 A;  2X8C A;  4EM4 A;  4CCR A;  3AED A;  1CJC A;  1O95 A;  2GR0 A;  2YM2 A;  4TM0 A;  2WPE A;  2WPC A;  3AXB A;  2I0Z A;  3RED A;  4REK A;  1YQ3 A;  3P4R A;  4Y4N A;  2C70 A;  5KNL A;  4L3Z A;  1NEK A;  1K0L A;  4G73 A;  2X50 A;  3ALM A;  3FBS A;  5EB5 A;  4CCQ A;  4D04 A;  4LU6 A;  4A9W A;  2X3N A;  1HYU A;  4JNA A;  4TLX A;  1XDI A;  3V3N A;  1VQW A;  3GDP A;  3Q9T A;  2W0H A;  2XVJ A;  4G74 A;  3ISH A;  1JRY A;  4UDP A;  2ARD A;  2OLO A;  2CDU A;  4X9N A;  4A6N B;  4U2T A;  3CNS A;  1LPF A;  5KVI A;  1M1Q A;  2X8H A;  3UU9 A;  2AR8 A;  2BRY A;  4DGK A;  1DNC A;  2WP6 A;  1LQT A;  3P4P A;  4Q5B A;  5FS6 A;  3IHM A;  5JCI A;  2A89 A;  2QA2 A;  5KVH A;  4EM3 A;  4BK1 A;  4GRT A;  2YG4 A;  3SFE A;  3UKL A;  3ADA B;  4JQ9 A;  2C3D A;  3AD7 B;  3BNG A;  3AE8 A;  3L8K A;  1IUU A;  1GRB A;  1KSS A;  3UTF A;  1DXL A;  2RF7 A;  2BC0 A;  1NHQ A;  3BNM A;  5EOW A;  1E1N A;  2EQ7 A;  4KPR A;  4L3X A;  1W4X A;  1BWC A;  4HB9 A;  3AEC A;  2GRT A;  1FT6 A;  1GU6 A;  1OAH A;  1H83 A;  1TYP A;  2FJA A;  2BK3 A;  2GAH B;  2QA1 A;  1TDK A;  4L3Y A;  2X8G A;  3BNJ A;  1CC4 A;  1PJ6 A;  1AOG A;  1H6V A;  1FS7 A;  5C3J A;  1L0V A;  2E1M A;  4B63 A;  4A79 A;  2WP9 A;  4O5U A;  2ZBW A;  1NG4 A;  4B68 A;  1H7X A;  1FEB A;  1XAN A;  3F8R A;  4A99 A;  4RG3 A;  4B65 A;  2XVF A;  2WEU A;  4Z44 A;  3UP5 A;  2C4C A;  4H4P A;  4NZH A;  2IID A;  1S3B A;  3RNM A;  2LFC A;  3AB1 A;  1YQ4 A;  1FT5 A;  1Q9I A;  2V60 A;  4Z25 A;  3LXD A;  4J33 A;  2NPX A;  3AYL A;  3BI5 A;  4X4J A;  1PDH A;  3M0O A;  2BAC A;  4FK1 C;  4H4R A;  2R0C A;  3DME A;  1YQZ A;  3VR8 A;  3GM6 A;  1DJQ A;  4H4Y A;  3UTE A;  2FJE A;  1JNR A;  2R9Z A;  3KPF A;  2BK4 A;  4ZCD A;  4BJZ A;  3NYC A;  1D5T A;  3T2Z A;  5JCL A;  4Z24 A;  3KPK A;  2B7R A;  1IUX A;  3TOR A;  2H89 A;  4H4W A;  3C4A A;  4H4Q A;  2VRL A;  3URH A;  3DGH A;  1GER A;  4B69 A;  2WBA A;  4AOX A;  2GR3 A;  2IVE A;  3BNF A;  1JNI A;  3L1R A;  4YWO A;  3LOV A;  3AEG A;  3SZC A;  1GRF A;  3FO3 A;  3NLC A;  5IQ1 A;  4EQS A;  1GES A;  4J31 A;  1GRE A;  2YLX A;  2RAB A;  3AYJ A;  2Q6U A;  2YG5 A;  1ZP0 A;  2VR0 A;  4Z2T A;  4IVO B;  3NRN A;  3NHO X;  1PBB A;  3RHA A;  2YLT A;  2YVG A;  1L9C A;  1FCD A;  3TTB A;  4K8D A;  1NG3 A;  2AQJ A;  1NDA A;  3KVE A;  4H4X A;  3SX6 A;  4IA5 A;  3K7T A;  1ZMC A;  1N4V A;  1ZOV A;  1KNR A;  3ZYX A;  4H4S A;  4O5Q A;  3B3R A;  1MXT A;  5FS9 A;  4B66 A;  4CNJ A;  1PS9 A;  4U8N A;  4YSZ A;  2GR1 A;  4G9K A;  5FS8 A;  4TM4 A;  1F8W A;  2Y6R A;  3BHK A;  3P4Q A;  1EL7 A;  3RP8 A;  5LV9 A;  4H7U A;  1BGN A;  2XLS A;  1RSG A;  1D7L A;  3QFB A;  3AD8 B;  4NEV A;  4YTN A;  2DKH A;  2GMH A;  1GEU A;  3CPJ G;  1KF6 A;  1UKV G;  1PHH A;  5KOX A;  4II3 A;  2K3V A;  4WCT A;  3NYE A;  3P9U A;  1MO9 A;  3NN0 X;  5JCM A;  1TYT A;  4IV9 A;  3KU9 A;  3SZ0 A;  5HXI A;  3BI4 A;  2VQB A;  3EAN A;  3UOX A;  1Y56 A;  3FPZ A;  3NGC X;  3NK1 X;  4DNA A;  3IF9 A;  1ZY8 A;  1H84 A;  3CGE A;  4H2R A;  4JDR A;  4JY3 A;  3UKA A;  4EQW A;  2CUL A;  3UKQ A;  3EPT A;  4AP1 A;  2WU2 A;  4CBQ A;  2OAM A;  3AEE A;  1Q1W A;  3GD3 A;  4GR1 A;  5M0Z A;  3T2K A;  1Z6L A;  1JOA A;  2BS2 A;  1GV4 A; 
#chains in the Genus database with same CATH homology
 2E5V A;  2BYB A;  4U2L A;  5KWF A;  1COY A;  1PBE A;  3AEA A;  3D1C A;  2YR6 A;  1S3E A;  2B9W A;  1F8S A;  4GF7 A;  1OJT A;  5BUK A;  2BA9 A;  3CMM A;  3HYW A;  5KMQ A;  1VG9 A;  2C75 A;  4Q4U A;  1FS8 A;  4RG4 A;  3EAO A;  1JNZ A;  1BZL A;  4AOS A;  3AEF A;  1BF3 A;  1ZKQ A;  4KX6 A;  1CC2 A;  2C3C A;  2JB1 A;  2RGH A;  3HYX A;  3ICS A;  4H4T A;  4NEW A;  5JCN A;  1B37 A;  5U25 A;  3SYI A;  1N4U A;  3ATQ A;  2JB2 A;  5C2T A;  2VZ2 A;  3OC4 A;  4UDQ A;  2ZO5 A;  4AT0 A;  3AYI A;  3S7W A;  2APG A;  2QCU A;  4YXD A;  1TDN A;  3UBR A;  4Q1O A;  1DOE A;  4G6G A;  2Y6Q A;  1GT8 A;  2XDO A;  3II4 A;  2YLW A;  1BGJ A;  3GSI A;  3AE4 A;  3F8D A;  4HA6 A;  3CIR A;  3GDN A;  1CC6 A;  1L9E A;  2RDZ A;  1IUW A;  4EQR A;  2V3A A;  2XVI A;  3NKS A;  3COX A;  4II2 A;  4E0V A;  1IUV A;  2BXS A;  3S61 A;  3P4S A;  2VVM A;  2J7A A;  2CFY A;  1S2Q A;  4JN9 A;  2VRM A;  5CQF A;  4USR A;  2YQU A;  3DJJ A;  3UOZ A;  1CBO A;  2C66 A;  2XFQ A;  3QSE A;  3FIM B;  4YTP A;  2WDR A;  1FEC A;  3DJD A;  5GSN A;  2EQ8 A;  5TR3 A;  2O9Z A;  1TDE A;  3GD4 A;  3H8L A;  5KRQ A;  4AP3 A;  1M64 A;  1GRT A;  3GWF A;  4CY6 A;  2V6O A;  2E81 A;  1Y56 B;  5KMP A;  3L1T A;  2WP5 A;  3NIX A;  4EMW A;  3NN6 X;  4U8J A;  2B7S A;  3IC9 A;  5IPY A;  2E80 A;  3I6D A;  1JRX A;  4OPU A;  3NT6 A;  4H4V A;  1GTE A;  1KNP A;  4H4Z A;  3T2Y A;  2XFP A;  3BI2 A;  4NTD A;  4G6H A;  2CVJ A;  4NWZ A;  2OT4 A;  3P1W A;  1JRZ A;  1LVL A;  2WS3 A;  2XLP A;  3H4K A;  1GRG A;  4UP3 A;  2YVF A;  4A7A A;  3OZ2 A;  4BK2 A;  1EBD A;  1GOS A;  4GCM A;  4D03 A;  4J2W A;  3DH9 A;  4U8O A;  1XPQ A;  4BK3 A;  4Y4L A;  1GTH A;  2VQ7 A;  2Q7V A;  1NPX A;  3ZDN A;  2OA1 A;  2EQ9 A;  2UZZ A;  1E6E A;  1IUS A;  3D8X A;  3E1T A;  2BK5 A;  2E4G A;  2BRA A;  2GH5 A;  2VOU A;  3BNU A;  4A5L A;  3QVP A;  2YG6 A;  2BC1 A;  4OPI A;  1X31 B;  3NK2 X;  2ZZB A;  2ZZC A;  1B4V A;  1QJD A;  3G5S A;  1CL0 A;  1IUT A;  2R4E A;  4WX1 A;  4C74 A;  1ZDL A;  4C3Y A;  1TDO A;  2V61 A;  4H50 A;  3NTA A;  3F8P A;  5BRT A;  2WES A;  4Z2R A;  3LZX A;  1PJ7 A;  3SZF A;  2WQY A;  4C77 A;  2XFN A;  3SY4 A;  4YSX A;  1E39 A;  1DOC A;  1H86 A;  4OPD A;  3CPI G;  4N9X A;  2XFO A;  4DSH A;  1LV0 A;  1LJ1 A;  3DK4 A;  3G5Q A;  5KMS A;  1N4W A;  2YM1 A;  2GQW A;  1QLB A;  4ZN0 A;  3QFA A;  3GWD A;  2H88 A;  3RP7 A;  2TMD A;  1OJA A;  2WU5 A;  4JY2 A;  1NEN A;  1H82 A;  1PBC A;  4JNQ A;  3I3L A;  4Q5C A;  3QJ4 A;  4Y4M A;  3AE3 A;  2YWL A;  4GDP A;  4TLZ A;  3GMB A;  1KSU A;  3HYV A;  3BNH A;  4LII A;  3MMO A;  5J60 A;  5M10 A;  3T0K A;  2WDQ A;  3NYF A;  4X9M A;  3VRA A;  4YT0 A;  1YY5 A;  2R45 A;  4ECH A;  3DK8 A;  1KFY A;  2JBV A;  3ATR A;  2R4J A;  4LA1 A;  3SM8 A;  3UP4 A;  3GMC A;  4K7Z A;  2GV8 A;  1K0I A;  5CKU A;  2NVK X;  3UOY A;  1H7W A;  2PHH A;  3SXI A;  4A65 A;  5BUL A;  3V76 A;  4C5O A;  1L9D A;  1RP0 A;  2YR5 A;  3BHF A;  2Z5X A;  2C65 A;  3O0H A;  4NNJ A;  5JCK A;  1MOK A;  1ONF A;  3PS9 A;  4FK1 A;  4B1B A;  2FJB A;  4WJY A;  3CGC A;  1QO8 A;  5EB4 A;  1ZK7 A;  2TPR A;  4H4U A;  1OJD A;  3ITJ A;  2R46 A;  4IVM B;  1D7Y A;  4U8P A;  4MJW A;  3RKH A;  2XLU A;  4TM1 A;  3QSM A;  1O5W A;  2GR2 A;  3AWI A;  3NTD A;  4P9S A;  1D4D A;  3AE7 A;  3T37 A;  2YVJ A;  1TRB A;  4U8I A;  1M6I A;  3IHG A;  2BS4 A;  3VQR A;  1DOB A;  4C3X A;  2R0P A;  5FS7 A;  2B9X A;  1FOH A;  3RP6 A;  1REO A;  1CJ3 A;  2BCP A;  3FG2 P;  3T31 A;  1CF3 A;  2ACZ A;  4USQ A;  5HY5 A;  3DGZ A;  3DK9 A;  3QVR A;  2J3N A;  2WDV A;  3GRT A;  3UKK A;  3LAD A;  5KMR A;  4Z43 A;  2X99 A;  3CTY A;  4U8L A;  4J36 A;  2XVE A;  1Q1R A;  2JKC A;  2WHD A;  1P2E A;  4EIQ A;  1E1K A;  3CNJ A;  3VRD B;  1PBD A;  3M12 A;  4CRT A;  3SXQ A;  3GYI A;  2BS3 A;  1GET A;  4EMI A;  4OPT A;  2YLR A;  3C96 A;  2XYO A;  2GVC A;  4DSG A;  4ADW A;  1Y0P A;  1PXA A;  3CGB A;  3K7M X;  4J57 A;  1H81 A;  5U63 A;  1F8R A;  3UTG A;  3SZW A;  4OPL A;  2JAE A;  4K5S A;  3B6D A;  2BAB A;  5BVA A;  3UKF A;  1ELI A;  1GRA A;  3QSS A;  2V3B A;  3KKJ A;  2YLZ A;  3H8I A;  2XCG A;  5DBJ A;  2HQM A;  4RSL A;  4GAP A;  2C7G A;  4UDR A;  2C73 A;  4J34 A;  5U1O A;  5HYM A;  4ICY A;  2PYX A;  3DA1 A;  3UOV A;  2FJD A;  5FMH A;  3NNE A;  2XLT A;  3ALJ A;  1E1M A;  1E7P A;  2YG7 A;  1O94 A;  1NAA A;  2AAQ A;  3K7Q X;  1K0J A;  2OLN A;  1D4E A;  2BXR A;  2GAG B;  2XLR A;  3AD9 B;  3LB8 A;  4IA6 A;  2GB0 A;  4XWZ A;  5HHF A;  2YG3 A;  3CN8 A;  3R9U A;  1K4Q A;  3SQP A;  4CY8 A;  3CNT A;  4B64 A;  3NG7 X;  2WOW A;  3DJG X;  1GSN A;  3NK0 X;  3PO7 A;  4OCG A;  3T14 A;  1PJ5 A;  4U8K A;  3C4N A;  1LQU A;  1OJ9 A;  1SEZ A;  3KLJ A;  3LG1 A;  3OWM A;  2BCG G;  4OVI A;  4TM3 A;  1B5Q A;  1CJ4 A;  3KA7 A;  3ABV A;  1TDF A;  2A87 A;  1EL8 A;  4NTE A;  1GAL A;  1BKW A;  1NHS A;  4H2Q A;  1ZMD A;  1B8S A;  5GRT A;  4K2X A;  4BV6 A;  3IWA A;  4EIP A;  3G5R A;  1ZX9 A;  2Q0L A;  2FBW A;  3HZL A;  1FL2 A;  3K30 A;  1F3P A;  2B76 A;  3UCL A;  2WPF A;  1NHP A;  3ICR A;  4I58 A;  1VRQ B;  3F29 A;  3GYX A;  3CPH G;  3SCE A;  4EMJ A;  4ZCC A;  1D4C A;  2C76 A;  1E1L A;  2WOI A;  4Z2U A;  5KOW A;  4BJY A;  1VG0 A;  3M13 A;  1N1P A;  1FEA A;  2JK6 A;  4YKG A;  3SFD A;  2V5Z A;  3AE1 A;  2A8X A;  2C72 A;  3LJP A;  1XHC A;  3VR9 A;  4K22 A;  1GPE A;  3AEB A;  1CJ2 A;  1LTX R;  1P2H A;  2WOV A;  4AT2 A;  4Z26 A;  3CND A;  5J7X A;  2WET A;  2RGO A;  2XVH A;  2JB3 A;  1YKJ A;  2VVL G;  1S2Y A;  2Q0K A;  2EQ6 A;  1DJN A;  3PVC A;  3DJE A;  4I59 A;  4Q0T A;  1CHU A;  4GDE A;  3GYJ A;  1RYI A;  1GND A;  1M1R A;  3CGD A;  3NH3 X;  4B67 A;  4NTC A;  1PBF A;  1SP3 A;  1EL5 A;  1M1P A;  4A6N A;  3AE6 A;  1ZOY A;  5L46 A;  1PN0 A;  3AE5 A;  2OAL A;  3UKH A;  2GEW A;  3UKP A;  2RGJ A;  1DOD A;  2XFU A;  4J56 A;  4M52 A;  1PXB A;  4OPG A;  3V3O A;  4YSY A;  4XWR A;  2QAE A;  3FMW A;  2YLS A;  4K5R A;  1VDC A;  3GRS A;  2B9Y A;  4L38 A;  1JU2 A;  4H2N A;  5KXJ A;  1F6M A;  3LGQ A;  2C67 A;  3JSK A;  4GUV A;  1PXC A;  5ER0 A;  4BUR A;  1OJC A;  3EF6 A;  4YSH A;  1JEH A;  2GF3 A;  3KD9 A;  3S5W A;  4PAB A;  5IQ4 A;  2IVD A;  3AE2 A;  3ALL A;  2F5Z A;  4FDC B;  4U2S A;  4CNK A;  3LZW A;  3UTH A;  2DKI A;  4YTM A;  2R0G A;  4YKF A;  3CNP A;  1V59 A;  4U8M A;  1IJH A;  4OPC A;  3AE9 A;  2GQF A;  1QDB A;  1GRH A;  1GXF A;  2ZZ0 A;  4FX9 A;  4PAA A;  4EQX A;  4Q17 A;  2YAU A;  2VVL A;  3Q6J A;  4H2P A;  1KDG A;  2C64 A;  1NHR A;  2Z5Y A;  4GAV A;  3SGL A;  3D1I A;  2GMJ A;  4XXG A;  3VRB A;  3WE0 A;  5EBK A;  3ICT A;  1FS9 A;  2YR4 A;  4APN A;  1BVB A;  1EL9 A;  2X8C A;  4EM4 A;  4CCR A;  3AED A;  1CJC A;  1O95 A;  2GR0 A;  2YM2 A;  4TM0 A;  2WPE A;  2WPC A;  3AXB A;  2I0Z A;  3RED A;  4REK A;  1YQ3 A;  3P4R A;  4Y4N A;  2C70 A;  5KNL A;  4L3Z A;  1NEK A;  1K0L A;  4G73 A;  2X50 A;  3ALM A;  3FBS A;  5EB5 A;  4CCQ A;  4D04 A;  4LU6 A;  4A9W A;  2X3N A;  1HYU A;  4JNA A;  4TLX A;  1XDI A;  3V3N A;  1VQW A;  3GDP A;  3Q9T A;  2W0H A;  2XVJ A;  4G74 A;  3ISH A;  1JRY A;  4UDP A;  2ARD A;  2OLO A;  2CDU A;  4X9N A;  4A6N B;  4U2T A;  3CNS A;  1LPF A;  5KVI A;  1M1Q A;  2X8H A;  3UU9 A;  2AR8 A;  2BRY A;  4DGK A;  1DNC A;  2WP6 A;  1LQT A;  3P4P A;  4Q5B A;  5FS6 A;  3IHM A;  5JCI A;  2A89 A;  2QA2 A;  5KVH A;  4EM3 A;  4BK1 A;  4GRT A;  2YG4 A;  3SFE A;  3UKL A;  3ADA B;  4JQ9 A;  2C3D A;  3AD7 B;  3BNG A;  3AE8 A;  3L8K A;  1IUU A;  1GRB A;  1KSS A;  3UTF A;  1DXL A;  2RF7 A;  2BC0 A;  1NHQ A;  3BNM A;  5EOW A;  1E1N A;  2EQ7 A;  4KPR A;  4L3X A;  1W4X A;  1BWC A;  4HB9 A;  3AEC A;  2GRT A;  1FT6 A;  1GU6 A;  1OAH A;  1H83 A;  1TYP A;  2FJA A;  2BK3 A;  2GAH B;  2QA1 A;  1TDK A;  4L3Y A;  2X8G A;  3BNJ A;  1CC4 A;  1PJ6 A;  1AOG A;  1H6V A;  1FS7 A;  5C3J A;  1L0V A;  2E1M A;  4B63 A;  4A79 A;  2WP9 A;  4O5U A;  2ZBW A;  1NG4 A;  4B68 A;  1H7X A;  1FEB A;  1XAN A;  3F8R A;  4A99 A;  4RG3 A;  4B65 A;  2XVF A;  2WEU A;  4Z44 A;  3UP5 A;  2C4C A;  4H4P A;  4NZH A;  2IID A;  1S3B A;  3RNM A;  2LFC A;  3AB1 A;  1YQ4 A;  1FT5 A;  1Q9I A;  2V60 A;  4Z25 A;  3LXD A;  4J33 A;  2NPX A;  3AYL A;  3BI5 A;  4X4J A;  1PDH A;  3M0O A;  2BAC A;  4FK1 C;  4H4R A;  2R0C A;  3DME A;  1YQZ A;  3VR8 A;  3GM6 A;  1DJQ A;  4H4Y A;  3UTE A;  2FJE A;  1JNR A;  2R9Z A;  3KPF A;  2BK4 A;  4ZCD A;  4BJZ A;  3NYC A;  1D5T A;  3T2Z A;  5JCL A;  4Z24 A;  3KPK A;  2B7R A;  1IUX A;  3TOR A;  2H89 A;  4H4W A;  3C4A A;  4H4Q A;  2VRL A;  3URH A;  3DGH A;  1GER A;  4B69 A;  2WBA A;  4AOX A;  2GR3 A;  2IVE A;  3BNF A;  1JNI A;  3L1R A;  4YWO A;  3LOV A;  3AEG A;  3SZC A;  1GRF A;  3FO3 A;  3NLC A;  5IQ1 A;  4EQS A;  1GES A;  4J31 A;  1GRE A;  2YLX A;  2RAB A;  3AYJ A;  2Q6U A;  2YG5 A;  1ZP0 A;  2VR0 A;  4Z2T A;  4IVO B;  3NRN A;  3NHO X;  1PBB A;  3RHA A;  2YLT A;  2YVG A;  1L9C A;  1FCD A;  3TTB A;  4K8D A;  1NG3 A;  1NDA A;  2AQJ A;  3KVE A;  4H4X A;  3SX6 A;  4IA5 A;  3K7T A;  1ZMC A;  1N4V A;  1ZOV A;  1KNR A;  3ZYX A;  4H4S A;  4O5Q A;  3B3R A;  1MXT A;  5FS9 A;  4B66 A;  4CNJ A;  1PS9 A;  4U8N A;  4YSZ A;  2GR1 A;  4G9K A;  5FS8 A;  4TM4 A;  1F8W A;  2Y6R A;  3BHK A;  3P4Q A;  1EL7 A;  3RP8 A;  5LV9 A;  4H7U A;  1BGN A;  2XLS A;  1RSG A;  1D7L A;  3QFB A;  3AD8 B;  4NEV A;  4YTN A;  2DKH A;  2GMH A;  1GEU A;  3CPJ G;  1KF6 A;  1UKV G;  1PHH A;  5KOX A;  4II3 A;  2K3V A;  4WCT A;  3NYE A;  3P9U A;  1MO9 A;  3NN0 X;  5JCM A;  1TYT A;  4IV9 A;  3KU9 A;  3SZ0 A;  5HXI A;  3BI4 A;  2VQB A;  3EAN A;  3UOX A;  1Y56 A;  3FPZ A;  3NGC X;  3NK1 X;  4DNA A;  3IF9 A;  1ZY8 A;  1H84 A;  3CGE A;  4H2R A;  4JDR A;  4JY3 A;  3UKA A;  4EQW A;  2CUL A;  3UKQ A;  3EPT A;  4AP1 A;  2WU2 A;  4CBQ A;  2OAM A;  3AEE A;  1Q1W A;  3GD3 A;  4GR1 A;  5M0Z A;  3T2K A;  1Z6L A;  1JOA A;  2BS2 A;  1GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...