1LJ1A

Crystal structure of q363f/r402a mutant flavocytochrome c3
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIFAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c3
publication title Engineering Water to act as the active site acid catalyst in a soluble fumarate reductase
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 193
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1lj1A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lj1A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1lj1A01
3G5RA 4JNAA 1S2QA 3FG2P 3IHMA 4M52A 2A89A 1NAAA 1RSGA 1KNRA 1TDNA 2V60A 2Q7VA 1E1MA 5JCMA 3UKPA 5HYMA 3NNEA 2R0CA 3AEEA 5FS6A 2LFCA 4PABA 1NPXA 3URHA 4H50A 3AB1A 4EQWA 5GRTA 4X9NA 5HY5A 3NTAA 1VG9A 4BK3A 2RGHA 2RDZA 2XVEA 3CTYA 3NTDA 1PHHA 1L9EA 2V3BA 4WX1A 2WOIA 3IC9A 1O94A 4J34A 2WPFA 2XFUA 4AT0A 3RHAA 3V76A 3K7QX 4GDPA 2FJBA 4UDPA 4YSHA 1DXLA 3AE3A 3T37A 2EQ7A 1IJHA 1JOAA 2C3CA 5EB4A 2WOWA 2XLPA 3DK4A 1GPEA 2WDQA 1BKWA 1PXAA 2Y6QA 2QAEA 4ZN0A 3UKKA 4RSLA 4Q4UA 2C75A 1IUXA 1H84A 3QSEA 1PXBA 2B9YA 1H86A 2GF3A 1TDEA 2WS3A 1M1PA 3KLJA 3NYCA 2YM2A 4KPRA 5FS8A 3CGDA 1LPFA 2VVLG 3LJPA 4NZHA 2B7SA 3UOYA 1E7PA 3BHKA 1HYUA 1JNZA 1NDAA 2R45A 1GRAA 3Q9TA 3AE7A 1TYPA 4U2SA 2JK6A 1MXTA 3LG1A 3UTHA 2IVDA 3UKHA 2BYBA 2QA1A 5GSNA 1Y0PA 1BF3A 2Q0KA 2VOUA 4AP3A 4H2RA 3AE8A 2VVLA 1GRBA 2K3VA 2XVHA 3GRSA 3GDNA 2XYOA 1TYTA 1OAHA 2X99A 3IHGA 1JRXA 3GWFA 3ZYXA 3ATQA 5DBJA 1FOHA 1GSNA 4GF7A 4IVMB 4Z24A 4ECHA 2RGOA 2AAQA 3CPJG 3CN8A 3SGLA 1SEZA 4XWRA 3MMOA 4P9SA 3CNSA 3LGQA 1NG3A 4K2XA 1IUUA 2EQ8A 3OWMA 2OA1A 3DJJA 2XLSA 1YQZA 4OVIA 4U8JA 2WEUA 1EL7A 4EMWA 1H81A 2IVEA 1GOSA 4A9WA 3F29A 2H89A 1H82A 2FBWA 4Q5CA 3AYIA 4OPTA 3NLCA 2O9ZA 1SP3A 2E1MA 3KA7A 3NN6X 4H4SA 2XFOA 1CL0A 1CJ2A 3NH3X 3P1WA 2FJAA 1CHUA 2ZZCA 5U1OA 4Z43A 1F8SA 1YQ4A 2DKHA 2BC0A 2OT4A 4BJYA 2XVIA 4GDEA 4B64A 4C3YA 3DH9A 5U63A 2V5ZA 1GTEA 3EPTA 4YTMA 3R9UA 2C7GA 2YQUA 5FS9A 4ZCCA 1KSSA 2HQMA 3GMCA 5KVIA 4BK2A 4H4TA 5C2TA 4B63A 4OPIA 2GR0A 4EQXA 4Y4LA 1OJCA 3NK1X 1GRFA 4EQRA 1CC4A 5EB5A 3DK8A 5FMHA 3UTFA 1GXFA 1H6VA 2WOVA 2XLUA 3NN0X 1GRGA 3PVCA 4J36A 4FK1A 4JQ9A 3CNDA 2DKIA 1M1QA 3C4AA 2GR2A 2BXSA 4TLZA 1KDGA 1X31B 3SXQA 2R0PA 2WPEA 3AEBA 2B7RA 1YY5A 2YR4A 3AEDA 4H2PA 2GQWA 2JKCA 3M13A 3LOVA 1BGNA 3REDA 4HA6A 4U8LA 3AEFA 2VQBA 1OJAA 2X8GA 3VRAA 2E81A 4X9MA 4A65A 1EL9A 3L1TA 2WQYA 2JB3A 4UDQA 2RGJA 2WP5A 3GDPA 2ARDA 1GRTA 1EL5A 1Q1RA 2ZBWA 4IV9A 4OPUA 1PJ6A 1FECA 2CFYA 2VRLA 3VRDB 3VR9A 3L1RA 4XXGA 3NT6A 2YLWA 2JB1A 3JSKA 4JY2A 1K0JA 2GQFA 4OPGA 4USRA 1QJDA 2WU5A 4YTNA 2V3AA 2E5VA 5FS7A 4OPLA 4H2QA 4A6NA 1CF3A 1KNPA 1VG0A 1VRQB 4H4UA 1LQUA 1IUSA 4BJZA 5IQ4A 1ZMDA 2Z5YA 1PXCA 3G5SA 4A6NB 4YXDA 2OLNA 3B3RA 1ELIA 4LA1A 4OPDA 3AE4A 2X8HA 4U8IA 1E1KA 3NYEA 1GRHA 1TRBA 3AYJA 1FT5A 1Y56A 3D1CA 1ZK7A 1OJTA 3DJEA 4Z26A 2BK4A 1LQTA 1FCDA 1DNCA 3AD7B 4EIQA 2JB2A 1Y56B 5KOXA 3QVPA 4UP3A 4JN9A 2BXRA 4GCMA 4C74A 4DGKA 2GMJA 1FS8A 1GU6A 3D8XA 1E6EA 3VQRA 4H4XA 1BGJA 1QLBA 3SFEA 2C70A 3BHFA 3QFAA 1L0VA 3M0OA 3SFDA 2OLOA 3K7TA 2F5ZA 1V59A 4CCRA 4L3ZA 4D03A 1P2EA 2XLTA 4YTPA 2YLSA 1NG4A 4Z44A 1BVBA 3DA1A 1NHRA 2VVMA 1D7YA 3F8PA 3AE9A 3CGEA 2WDVA 3FBSA 2ZZ0A 2C72A 3AYLA 1GTHA 4Q17A 3FIMB 4L3XA 3KKJA 1CJ3A 3AWIA 4H7UA 4AOXA 5M10A 3PO7A 4AOSA 1ZP0A 4A79A 4C77A 3LADA 2RABA 2VQ7A 4ZCDA 4Z2RA 3RKHA 3QVRA 2GRTA 4EMJA 2C66A 4HB9A 3AD9B 3FPZA 2YM1A 5KOWA 2YR5A 4L3YA 3F8RA 1B8SA 1IUTA 3DK9A 4WJYA 3AE6A 3GD4A 4KX6A 3VR8A 4D04A 3AECA 5LV9A 1JRYA 3AD8B 2C65A 2IIDA 4H4ZA 1P2HA 2BA9A 1COYA 2V6OA 4YKGA 1KSUA 4J2WA 2OALA 3WE0A 4ICYA 4USQA 4Q1OA 1D7LA 3GRTA 1L9DA 4EM3A 5BULA 3GWDA 3ADAB 3GSIA 3V3NA 3UU9A 1XHCA 4LU6A 3RNMA 4EQSA 4DSHA 4NEWA 5BRTA 1NEKA 1D4CA 5U25A 2GR1A 1E39A 2APGA 2BABA 2C67A 1DOEA 4B68A 4C5OA 4CY6A 4U8MA 1FS9A 3BI2A 1B37A 2PHHA 3AE1A 4JNQA 2C64A 3OC4A 1FEAA 2TPRA 4J31A 4JY3A 4XWZA 1PJ7A 3HZLA 3ITJA 2C3DA 2XCGA 2GVCA 1CBOA 2ZZBA 3ATRA 1F3PA 1B4VA 4NTEA 3UOXA 4EMIA 1LVLA 3EAOA 3EANA 4RG4A 2PYXA 4REKA 3AXBA 1CC2A 3K30A 3UCLA 3K7MX 1QO8A 3O0HA 4B66A 3BNUA 2YG3A 3CGCA 3KD9A 3GM6A 1AOGA 2OAMA 3CNJA 1E1NA 1TDOA 3ICSA 4H4PA 1M6IA 3VRBA 1O5WA 1IUWA 1L9CA 1ZOVA 3ISHA 1YQ3A 1PBDA 3AE5A 1TDKA 4U8NA 3CPHG 4H4WA 1F8RA 1M1RA 4TM0A 2FJDA 4Q0TA 2A87A 5J7XA 4N9XA 4K5SA 2CDUA 3V3OA 2YVFA 2WU2A 3BI5A 3FMWA 3BNJA 4H4VA 5EOWA 4K5RA 2Q6UA 3NK2X 3Q6JA 5KVHA 1ZY8A 4CY8A 4TM4A 1ZMCA 3UKFA 1KF6A 4ADWA 4Z2UA 1LJ1A 2Y6RA 1DOBA 2TMDA 2X3NA 3IF9A 3P4RA 3SCEA 3IWAA 4A99A 3H8IA 4K22A 4MJWA 5JCKA 3AEGA 3ICRA 3TORA 3OZ2A 3ALMA 1K0LA 4H4RA 5HHFA 4DNAA 1ZKQA 1GV4A 1FEBA 1GETA 1UKVG 5CKUA 3DMEA 4IA5A 4UDRA 4YSXA 3EF6A 1H83A 5KWFA 2X50A 3S61A 4B69A 3RP8A 1YKJA 4U8OA 4EIPA 3I6DA 4H4QA 4PAAA 2J3NA 3CIRA 1JEHA 2C76A 4Q5BA 2XDOA 2YG4A 2WDRA 4FK1C 2GB0A 4J56A 3COXA 1PJ5A 4AT2A 4B1BA 1LV0A 3ABVA 1PBEA 2VZ2A 3LZXA 4Y4MA 1O95A 4GRTA 4YKFA 1EBDA 3QFBA 4FX9A 1PBFA 2XVJA 3LXDA 1QDBA 3H8LA 2Z5XA 5JCLA 2GH5A 3F8DA 4IVOB 3TTBA 4NEVA 4U2TA 5BUKA 1FT6A 3DGHA 3UBRA 2CVJA 2JAEA 2R0GA 1PBCA 4GR1A 2BS4A 1XANA 3AEAA 3NG7X 1REOA 2E80A 1JNIA 3BNGA 3UOVA 2XFNA 3LZWA 3P4QA 1H7XA 2XFPA 5JCIA 2GR3A 3BNMA 1NHSA 2YG7A 1D4DA 2FJEA 4RG3A 5L46A 1GESA 4J57A 2YG5A 1E1LA 3II4A 4YWOA 4CCQA 5IPYA 3KVEA 2E4GA 3UP4A 4Z2TA 2YVJA 1FL2A 3KU9A 4OCGA 3S5WA 3QSSA 1RP0A 2B76A 1PN0A 3BI4A 1B5QA 1RYIA 3H4KA 1ZOYA 4CNJA 2YLTA 3AE2A 3QSMA 4FDCB 2AQJA 2VRMA 2VR0A 2BCPA 4DSGA 3CNPA 4U2LA 2BS2A 2R4EA 2B9XA 3ICTA 1PS9A 4U8KA 4WCTA 1GEUA 1GREA 2H88A 2R9ZA 2X8CA 1PDHA 3C4NA 2UZZA 2V61A 4U8PA 3BNHA 1F6MA 2YG6A 4Y4NA 4IA6A 1PBBA 3CGBA 1OJ9A 2JBVA 4J33A 4E0VA 4O5UA 4L38A 2W0HA 1CJ4A 2R46A 2GAGB 3I3LA 3KPFA 3UOZA 2NVKX 3QJ4A 1DJQA 3GD3A 1DODA 1FS7A 5KRQA 1ZDLA 3PS9A 4EM4A 2C73A 2GAHB 2J7AA 4A7AA 2I0ZA 1GNDA 5KXJA 1KFYA 1JNRA 4O5QA 2ACZA 1K4QA 4BURA 5EBKA 3DJGX 1D4EA 4Z25A 1DJNA 2YVGA 3NHOX 3NYFA 1JRZA 1NHQA 1F8WA 1MOKA 1D5TA 2GEWA 2WP6A 3B6DA 1GERA 4NTCA 4A5LA 1BWCA 3ZDNA 2WETA 2WP9A 1DOCA 1VDCA 2YLXA 3UTEA 4K8DA 1N1PA 1CC6A 1N4WA 3C96A 4APNA 1W4XA 4BK1A 5J60A 2BS3A 2ZO5A 5M0ZA 2YLZA 4I59A 1GALA 1NENA 3S7WA 4H4YA 4OPCA 5IQ1A 2QCUA 1VQWA 1ONFA 4H2NA 4TM3A 3D1IA 3DJDA 2EQ6A 5TR3A 4K7ZA 2Q0LA 4JDRA 1Q9IA 3P4SA 2XFQA 3CNTA 3SM8A 3UKQA 3BNFA 1N4UA 2AR8A 2NPXA 2WBAA 3NKSA 1N4VA 2WESA 1TDFA 3P4PA 3UTGA 2CULA 1CJCA 2BK5A 2BK3A 1XDIA 1S3EA 3NK0X 2WPCA 3NRNA 5BVAA 1IUVA 2YWLA 1XPQA 3UP5A 2BCGG 4B65A 5C3JA 4NTDA 2BACA 3FO3A 1LTXR 5CQFA 1H7WA 2RF7A 3GYJA 1MO9A 4BV6A 2YAUA 1S2YA 3E1TA 3UKAA 3GYIA 1Z6LA 4LIIA 2QA2A 5JCNA 3P9UA 2R4JA 1S3BA 3RP6A 3GYXA 1OJDA 4CRTA 1NHPA 3ALJA 1GT8A 4AP1A 2B9WA 4YSZA 2EQ9A 1ZX9A 2YLRA 2XLRA 1M64A 1JU2A 2WHDA 3L8KA 5HXIA 5ER0A 2YR6A 3CPIG 3NIXA 3RP7A 2BC1A 4YT0A 2GV8A 3DGZA 4CBQA 2GMHA 4X4JA 4TM1A 3UKLA 3SQPA 4I58A 1EL8A 1K0IA 4TLXA 4B67A 1Q1WA 2XVFA 4GUVA 3NGCX 4CNKA 3G5QA 4YSYA 3ALLA 3LB8A 1BZLA 3GMBA 3M12A 2A8XA 4C3XA
chains in the Genus database with same CATH superfamily
3G5RA 4JNAA 1S2QA 3FG2P 3IHMA 4M52A 2A89A 1NAAA 1RSGA 1KNRA 1TDNA 2V60A 2Q7VA 1E1MA 5JCMA 3UKPA 5HYMA 3NNEA 2R0CA 3AEEA 5FS6A 2LFCA 4PABA 1NPXA 3URHA 4H50A 3AB1A 4EQWA 5GRTA 4X9NA 5HY5A 3NTAA 1VG9A 4BK3A 2RGHA 2RDZA 2XVEA 3CTYA 3NTDA 1PHHA 1L9EA 2V3BA 4WX1A 2WOIA 3IC9A 1O94A 4J34A 2WPFA 2XFUA 4AT0A 3RHAA 3V76A 3K7QX 4GDPA 2FJBA 4UDPA 4YSHA 1DXLA 3AE3A 3T37A 2EQ7A 1IJHA 1JOAA 2C3CA 5EB4A 2WOWA 2XLPA 3DK4A 1GPEA 2WDQA 1BKWA 1PXAA 2Y6QA 2QAEA 4ZN0A 3UKKA 4RSLA 4Q4UA 2C75A 1IUXA 1H84A 3QSEA 1PXBA 2B9YA 1H86A 2GF3A 1TDEA 2WS3A 1M1PA 3KLJA 3NYCA 2YM2A 4KPRA 5FS8A 3CGDA 1LPFA 2VVLG 3LJPA 4NZHA 2B7SA 3UOYA 1E7PA 3BHKA 1HYUA 1JNZA 1NDAA 2R45A 1GRAA 3Q9TA 3AE7A 5KMSA 1TYPA 4U2SA 2JK6A 1MXTA 3LG1A 3UTHA 2IVDA 3UKHA 2BYBA 2QA1A 5GSNA 1Y0PA 1BF3A 2Q0KA 2VOUA 3SXIA 4AP3A 4H2RA 3AE8A 2VVLA 1GRBA 2K3VA 2XVHA 3GRSA 3GDNA 2XYOA 1TYTA 1OAHA 2X99A 3IHGA 1JRXA 3GWFA 3ZYXA 3ATQA 5DBJA 1FOHA 1GSNA 4GF7A 4IVMB 4Z24A 4ECHA 2RGOA 2AAQA 3CPJG 3CN8A 3SGLA 1SEZA 4XWRA 3MMOA 4P9SA 3CNSA 3LGQA 1NG3A 4K2XA 1IUUA 2EQ8A 3OWMA 2OA1A 3DJJA 2XLSA 1YQZA 4OVIA 4U8JA 2WEUA 1EL7A 4EMWA 1H81A 2IVEA 1GOSA 4A9WA 3F29A 2H89A 1H82A 2FBWA 4Q5CA 3AYIA 4OPTA 3NLCA 2O9ZA 1SP3A 4II3A 2E1MA 3KA7A 3NN6X 4H4SA 3SY4A 2XFOA 1CL0A 1CJ2A 3NH3X 3P1WA 2FJAA 1CHUA 2ZZCA 5U1OA 4Z43A 1F8SA 1YQ4A 5KMPA 2DKHA 2C4CA 2BC0A 2OT4A 4BJYA 2XVIA 4GDEA 4G9KA 4B64A 4C3YA 3DH9A 5U63A 2V5ZA 1GTEA 3EPTA 4YTMA 3R9UA 2C7GA 2YQUA 5FS9A 4ZCCA 1KSSA 2HQMA 3GMCA 5KVIA 4BK2A 4H4TA 5C2TA 4B63A 4OPIA 2GR0A 4EQXA 4Y4LA 1OJCA 3NK1X 1GRFA 4EQRA 1CC4A 5EB5A 3DK8A 5FMHA 3UTFA 1GXFA 1H6VA 2WOVA 2XLUA 3NN0X 1GRGA 3PVCA 4J36A 4FK1A 4JQ9A 3CNDA 2DKIA 1M1QA 3C4AA 2GR2A 5KNLA 2BXSA 4TLZA 1KDGA 1X31B 3SXQA 2R0PA 2WPEA 3AEBA 2B7RA 1YY5A 2YR4A 3AEDA 4H2PA 2GQWA 2JKCA 3T2ZA 3M13A 3LOVA 1BGNA 3REDA 4HA6A 4U8LA 3AEFA 3CMMA 4G6HA 2VQBA 1OJAA 2X8GA 3VRAA 2E81A 4X9MA 4A65A 1EL9A 5KMRA 3L1TA 2WQYA 2JB3A 4UDQA 2RGJA 2WP5A 3GDPA 2ARDA 1GRTA 1EL5A 1Q1RA 2ZBWA 4IV9A 4OPUA 1PJ6A 1FECA 2CFYA 2VRLA 3VRDB 3VR9A 3L1RA 4XXGA 3NT6A 2YLWA 2JB1A 3JSKA 4JY2A 1K0JA 2GQFA 4OPGA 4USRA 1QJDA 2WU5A 4YTNA 2V3AA 2E5VA 5FS7A 4OPLA 4H2QA 4A6NA 1CF3A 1KNPA 1VG0A 1VRQB 4H4UA 1LQUA 1IUSA 4BJZA 5IQ4A 1ZMDA 2Z5YA 1PXCA 3G5SA 4A6NB 4YXDA 2OLNA 3B3RA 1ELIA 4LA1A 4OPDA 3AE4A 2X8HA 4U8IA 1E1KA 3SZWA 3NYEA 1GRHA 1TRBA 3AYJA 1FT5A 1Y56A 3D1CA 3SX6A 1ZK7A 1OJTA 3DJEA 4G73A 4Z26A 2BK4A 1LQTA 1FCDA 1DNCA 3AD7B 4EIQA 2JB2A 1Y56B 5KOXA 3QVPA 4UP3A 4JN9A 2BXRA 4GCMA 4C74A 4DGKA 2GMJA 1FS8A 1GU6A 3D8XA 1E6EA 3VQRA 4H4XA 1BGJA 4G6GA 1QLBA 3SFEA 2C70A 3BHFA 3QFAA 1L0VA 5KMQA 3M0OA 3SFDA 2OLOA 3K7TA 2F5ZA 1V59A 4CCRA 4L3ZA 4D03A 1P2EA 2XLTA 4YTPA 2YLSA 1NG4A 4Z44A 1BVBA 3DA1A 1NHRA 2VVMA 1D7YA 3F8PA 3AE9A 3CGEA 2WDVA 3FBSA 2ZZ0A 2C72A 3AYLA 1GTHA 4Q17A 3FIMB 4L3XA 3KKJA 1CJ3A 3AWIA 4H7UA 4AOXA 5M10A 3PO7A 4AOSA 3SYIA 1ZP0A 4A79A 4C77A 3LADA 2RABA 2VQ7A 4ZCDA 4Z2RA 3RKHA 3QVRA 2GRTA 4EMJA 2C66A 4HB9A 3AD9B 3FPZA 2YM1A 5KOWA 2YR5A 4L3YA 3F8RA 1B8SA 1IUTA 3DK9A 4WJYA 3AE6A 3GD4A 4KX6A 3VR8A 4D04A 3AECA 5LV9A 1JRYA 3AD8B 2C65A 2IIDA 4H4ZA 1P2HA 2BA9A 1COYA 2V6OA 3T2YA 4YKGA 1KSUA 4J2WA 2OALA 3WE0A 2CZSA 4ICYA 4Q1OA 1D7LA 3GRTA 1L9DA 4USQA 4EM3A 3GWDA 5BULA 3ADAB 3GSIA 2BRAA 3UU9A 3V3NA 1XHCA 4LU6A 3RNMA 4EQSA 4DSHA 4NEWA 5BRTA 1NEKA 1D4CA 5U25A 2GR1A 1E39A 2APGA 2BABA 2C67A 1DOEA 4II2A 3SZFA 4B68A 4C5OA 4CY6A 4U8MA 1FS9A 3BI2A 1B37A 2PHHA 3AE1A 4JNQA 2C64A 3OC4A 1FEAA 2TPRA 4J31A 4JY3A 4XWZA 1PJ7A 3HZLA 3ITJA 2C3DA 2XCGA 2GVCA 1CBOA 2ZZBA 3ATRA 1F3PA 1B4VA 4NTEA 3UOXA 4EMIA 1LVLA 3EAOA 3EANA 4RG4A 2PYXA 4REKA 3AXBA 1CC2A 3K30A 3T14A 3UCLA 3K7MX 1QO8A 3O0HA 4B66A 3BNUA 2YG3A 3CGCA 3KD9A 3GM6A 1AOGA 2OAMA 3CNJA 1E1NA 1TDOA 3ICSA 4H4PA 1M6IA 3VRBA 1O5WA 1IUWA 1L9CA 1ZOVA 4G74A 3ISHA 1YQ3A 1PBDA 3HYVA 3AE5A 1TDKA 4U8NA 3CPHG 4H4WA 1F8RA 1M1RA 4TM0A 2FJDA 4Q0TA 2A87A 5J7XA 4N9XA 4K5SA 2CDUA 3V3OA 2YVFA 2WU2A 3BI5A 3FMWA 3BNJA 4H4VA 5EOWA 4K5RA 2Q6UA 3NK2X 3Q6JA 5KVHA 1ZY8A 4CY8A 4TM4A 1ZMCA 3UKFA 1KF6A 4ADWA 4Z2UA 1LJ1A 2Y6RA 1DOBA 2TMDA 2X3NA 3IF9A 3P4RA 3SCEA 3IWAA 4A99A 3H8IA 4K22A 4MJWA 5JCKA 3AEGA 3ICRA 3TORA 3OZ2A 3ALMA 1K0LA 4H4RA 5HHFA 4DNAA 1ZKQA 1GV4A 1FEBA 1GETA 1UKVG 5CKUA 3DMEA 4IA5A 4UDRA 4YSXA 3EF6A 1H83A 5KWFA 2X50A 3S61A 4B69A 3RP8A 1YKJA 4U8OA 4EIPA 3I6DA 4H4QA 4PAAA 2J3NA 3CIRA 1JEHA 2C76A 4Q5BA 2XDOA 2YG4A 2WDRA 4FK1C 2GB0A 4J56A 3COXA 1PJ5A 4AT2A 4B1BA 1LV0A 3ABVA 1PBEA 2VZ2A 3LZXA 4Y4MA 1O95A 4GRTA 4YKFA 1EBDA 3QFBA 4FX9A 1PBFA 4GAPA 2XVJA 3LXDA 1QDBA 3H8LA 2Z5XA 5JCLA 2GH5A 3F8DA 4IVOB 3TTBA 4NEVA 4U2TA 5BUKA 1FT6A 3DGHA 3UBRA 2CVJA 2JAEA 2R0GA 1PBCA 4GR1A 2BS4A 1XANA 3AEAA 3NG7X 1REOA 2E80A 3T0KA 1JNIA 3BNGA 3SZCA 2XFNA 3LZWA 3P4QA 3UOVA 1H7XA 2XFPA 5JCIA 2GR3A 3BNMA 1NHSA 2YG7A 1D4DA 2FJEA 4RG3A 5L46A 1GESA 4J57A 2YG5A 1E1LA 3II4A 4GAVA 4YWOA 4CCQA 3SZ0A 3KVEA 5IPYA 2E4GA 3UP4A 4Z2TA 2YVJA 1FL2A 3KU9A 4OCGA 3S5WA 3QSSA 1RP0A 2B76A 1PN0A 3BI4A 1B5QA 1RYIA 3H4KA 1ZOYA 4CNJA 2YLTA 3AE2A 3QSMA 4FDCB 2AQJA 2VRMA 2VR0A 2BCPA 4DSGA 3CNPA 4U2LA 2BS2A 2R4EA 2B9XA 3ICTA 1PS9A 4U8KA 4WCTA 1GEUA 1GREA 2H88A 2R9ZA 2X8CA 1PDHA 3C4NA 2UZZA 2V61A 4U8PA 3BNHA 1F6MA 2YG6A 4Y4NA 4IA6A 1PBBA 3CGBA 1OJ9A 2JBVA 4J33A 4E0VA 4O5UA 4L38A 2W0HA 1CJ4A 2R46A 2GAGB 3I3LA 3KPFA 3UOZA 2NVKX 3QJ4A 1DJQA 3GD3A 1DODA 1FS7A 5KRQA 1ZDLA 3PS9A 4EM4A 2C73A 2GAHB 2J7AA 4A7AA 2I0ZA 1GNDA 5KXJA 1KFYA 1JNRA 4O5QA 2ACZA 1K4QA 4BURA 5EBKA 2BRYA 1D4EA 3DJGX 1DJNA 2YVGA 3NHOX 3NYFA 1JRZA 1NHQA 1F8WA 1MOKA 1D5TA 2GEWA 2WP6A 3B6DA 1GERA 4NTCA 4A5LA 1BWCA 3ZDNA 2WETA 2WP9A 1DOCA 1VDCA 2YLXA 3UTEA 4K8DA 1N1PA 1CC6A 1N4WA 3C96A 4APNA 1W4XA 4BK1A 5J60A 2BS3A 2ZO5A 5M0ZA 2YLZA 4I59A 1GALA 1NENA 3S7WA 4H4YA 4NWZA 4OPCA 5IQ1A 2QCUA 1VQWA 1ONFA 4H2NA 4TM3A 3D1IA 3DJDA 2EQ6A 5TR3A 4K7ZA 2Q0LA 3KPKA 4JDRA 1Q9IA 3P4SA 2XFQA 3CNTA 3SM8A 3UKQA 3BNFA 4NNJA 1N4UA 2AR8A 2NPXA 2WBAA 3NKSA 1N4VA 2WESA 1TDFA 3P4PA 3UTGA 2CULA 1CJCA 2BK5A 2BK3A 1XDIA 1S3EA 3NK0X 2WPCA 3NRNA 5BVAA 1IUVA 2YWLA 1XPQA 3UP5A 2BCGG 4B65A 5C3JA 4NTDA 2BACA 3FO3A 1LTXR 5CQFA 1H7WA 2RF7A 3GYJA 1MO9A 4BV6A 2YAUA 1S2YA 3E1TA 3UKAA 4Z25A 3GYIA 3T31A 1Z6LA 4LIIA 2QA2A 5JCNA 3P9UA 2R4JA 1S3BA 3RP6A 3GYXA 1OJDA 4CRTA 1NHPA 3ALJA 1GT8A 4AP1A 2B9WA 4YSZA 2EQ9A 1ZX9A 2YLRA 2XLRA 1M64A 1JU2A 2WHDA 3L8KA 5HXIA 3T2KA 3HYXA 5ER0A 2YR6A 3CPIG 3NIXA 3RP7A 2BC1A 4YT0A 2GV8A 3DGZA 4CBQA 2GMHA 4X4JA 4TM1A 3UKLA 3HYWA 3SQPA 4I58A 1EL8A 1K0IA 4TLXA 4B67A 1Q1WA 2XVFA 4GUVA 3NGCX 4CNKA 3G5QA 4YSYA 3ALLA 3LB8A 1BZLA 3GMBA 3M12A 2A8XA 4C3XA
chains in the Genus database with same CATH topology
3G5RA 4JNAA 1S2QA 3FG2P 3IHMA 4M52A 2A89A 1NAAA 1RSGA 1KNRA 1TDNA 2V60A 2Q7VA 1E1MA 5JCMA 3UKPA 5HYMA 3NNEA 2R0CA 3AEEA 5FS6A 2LFCA 4PABA 1NPXA 3URHA 4H50A 3AB1A 4EQWA 5GRTA 4X9NA 5HY5A 3NTAA 1VG9A 4BK3A 2RGHA 2RDZA 2XVEA 3CTYA 3NTDA 1PHHA 1L9EA 2V3BA 4WX1A 2WOIA 3IC9A 1O94A 4J34A 2WPFA 2XFUA 4AT0A 3RHAA 3V76A 3K7QX 4GDPA 2FJBA 4UDPA 4YSHA 1DXLA 3AE3A 3T37A 2EQ7A 1IJHA 1JOAA 2C3CA 5EB4A 2WOWA 2XLPA 3DK4A 1GPEA 2WDQA 1BKWA 1PXAA 2Y6QA 2QAEA 4ZN0A 3UKKA 4RSLA 4Q4UA 2C75A 1IUXA 1H84A 3QSEA 1PXBA 2B9YA 1H86A 2GF3A 1TDEA 2WS3A 1M1PA 3KLJA 3NYCA 2YM2A 4KPRA 5FS8A 3CGDA 1LPFA 2VVLG 3LJPA 4NZHA 2B7SA 3UOYA 1E7PA 3BHKA 1HYUA 1JNZA 1NDAA 2R45A 1GRAA 3Q9TA 3AE7A 5KMSA 1TYPA 4U2SA 2JK6A 1MXTA 3LG1A 3UTHA 2IVDA 3UKHA 2BYBA 2QA1A 5GSNA 1Y0PA 1BF3A 2Q0KA 2VOUA 3SXIA 4AP3A 4H2RA 3AE8A 2VVLA 1GRBA 2K3VA 2XVHA 3GRSA 3GDNA 2XYOA 1TYTA 1OAHA 2X99A 3IHGA 1JRXA 3GWFA 3ZYXA 3ATQA 5DBJA 1FOHA 1GSNA 4GF7A 4IVMB 4Z24A 4ECHA 2RGOA 2AAQA 3CPJG 3CN8A 3SGLA 1SEZA 4XWRA 3MMOA 4P9SA 3CNSA 3LGQA 1NG3A 4K2XA 1IUUA 2EQ8A 3OWMA 2OA1A 3DJJA 2XLSA 1YQZA 4OVIA 4U8JA 2WEUA 1EL7A 4EMWA 1H81A 2IVEA 1GOSA 4A9WA 3F29A 2H89A 1H82A 2FBWA 4Q5CA 3AYIA 4OPTA 3NLCA 2O9ZA 1SP3A 4II3A 2E1MA 3KA7A 3NN6X 4H4SA 3SY4A 2XFOA 1CL0A 1CJ2A 3NH3X 3P1WA 2FJAA 1CHUA 2ZZCA 5U1OA 4Z43A 1F8SA 1YQ4A 5KMPA 2DKHA 2C4CA 2BC0A 2OT4A 4BJYA 2XVIA 4GDEA 4G9KA 4B64A 4C3YA 3DH9A 5U63A 2V5ZA 1GTEA 3EPTA 4YTMA 3R9UA 2C7GA 2YQUA 5FS9A 4ZCCA 1KSSA 2HQMA 3GMCA 5KVIA 4BK2A 4H4TA 5C2TA 4B63A 4OPIA 2GR0A 4EQXA 4Y4LA 1OJCA 3NK1X 1GRFA 4EQRA 1CC4A 5EB5A 3DK8A 5FMHA 3UTFA 1GXFA 1H6VA 2WOVA 2XLUA 3NN0X 1GRGA 3PVCA 4J36A 4FK1A 4JQ9A 3CNDA 2DKIA 1M1QA 3C4AA 2GR2A 5KNLA 2BXSA 4TLZA 1KDGA 1X31B 3SXQA 2R0PA 2WPEA 3AEBA 2B7RA 1YY5A 2YR4A 3AEDA 4H2PA 2GQWA 2JKCA 3T2ZA 3M13A 3LOVA 1BGNA 3REDA 4HA6A 4U8LA 3AEFA 3CMMA 4G6HA 2VQBA 1OJAA 2X8GA 3VRAA 2E81A 4X9MA 4A65A 1EL9A 5KMRA 3L1TA 2WQYA 2JB3A 4UDQA 2RGJA 2WP5A 3GDPA 2ARDA 1GRTA 1EL5A 1Q1RA 2ZBWA 4IV9A 4OPUA 1PJ6A 1FECA 2CFYA 2VRLA 3VRDB 3VR9A 3L1RA 4XXGA 3NT6A 2YLWA 2JB1A 3JSKA 4JY2A 1K0JA 2GQFA 4OPGA 4USRA 1QJDA 2WU5A 4YTNA 2V3AA 2E5VA 5FS7A 4OPLA 4H2QA 4A6NA 1CF3A 1KNPA 1VG0A 1VRQB 4H4UA 1LQUA 1IUSA 4BJZA 5IQ4A 1ZMDA 2Z5YA 1PXCA 3G5SA 4A6NB 4YXDA 2OLNA 3B3RA 1ELIA 4LA1A 4OPDA 3AE4A 2X8HA 4U8IA 1E1KA 3SZWA 3NYEA 1GRHA 1TRBA 3AYJA 1FT5A 1Y56A 3D1CA 3SX6A 1ZK7A 1OJTA 3DJEA 4G73A 4Z26A 2BK4A 1LQTA 1FCDA 1DNCA 3AD7B 4EIQA 2JB2A 1Y56B 5KOXA 3QVPA 4UP3A 4JN9A 2BXRA 4GCMA 4C74A 4DGKA 2GMJA 1FS8A 1GU6A 3D8XA 1E6EA 3VQRA 4H4XA 1BGJA 4G6GA 1QLBA 3SFEA 2C70A 3BHFA 3QFAA 1L0VA 5KMQA 3M0OA 3SFDA 2OLOA 3K7TA 2F5ZA 1V59A 4CCRA 4L3ZA 4D03A 1P2EA 2XLTA 4YTPA 2YLSA 1NG4A 4Z44A 1BVBA 3DA1A 1NHRA 2VVMA 1D7YA 3F8PA 3AE9A 3CGEA 2WDVA 3FBSA 2ZZ0A 2C72A 3AYLA 1GTHA 4Q17A 3FIMB 4L3XA 3KKJA 1CJ3A 3AWIA 4H7UA 4AOXA 5M10A 3PO7A 4AOSA 3SYIA 1ZP0A 4A79A 4C77A 3LADA 2RABA 2VQ7A 4ZCDA 4Z2RA 3RKHA 3QVRA 2GRTA 4EMJA 2C66A 4HB9A 3AD9B 3FPZA 2YM1A 5KOWA 2YR5A 4L3YA 3F8RA 1B8SA 1IUTA 3DK9A 4WJYA 3AE6A 3GD4A 4KX6A 3VR8A 4D04A 3AECA 5LV9A 1JRYA 3AD8B 2C65A 2IIDA 4H4ZA 1P2HA 2BA9A 1COYA 2V6OA 3T2YA 4YKGA 1KSUA 4J2WA 2OALA 3WE0A 4ICYA 4USQA 4Q1OA 1D7LA 3GRTA 1L9DA 4EM3A 5BULA 3GWDA 3ADAB 3GSIA 2BRAA 3UU9A 3V3NA 1XHCA 4LU6A 3RNMA 4EQSA 4DSHA 4NEWA 5BRTA 1NEKA 1D4CA 5U25A 2GR1A 1E39A 2APGA 2BABA 2C67A 1DOEA 4II2A 3SZFA 4B68A 4C5OA 4CY6A 4U8MA 1FS9A 3BI2A 1B37A 2PHHA 3AE1A 4JNQA 2C64A 3OC4A 1FEAA 2TPRA 4J31A 4JY3A 4XWZA 1PJ7A 3HZLA 3ITJA 2C3DA 2XCGA 2GVCA 1CBOA 2ZZBA 3ATRA 1F3PA 1B4VA 4NTEA 3UOXA 4EMIA 1LVLA 3EAOA 3EANA 4RG4A 2PYXA 4REKA 3AXBA 1CC2A 3K30A 3T14A 3UCLA 3K7MX 1QO8A 3O0HA 4B66A 3BNUA 2YG3A 3CGCA 3KD9A 3GM6A 1AOGA 2OAMA 3CNJA 1E1NA 1TDOA 3ICSA 4H4PA 1M6IA 3VRBA 1O5WA 1IUWA 1L9CA 1ZOVA 4G74A 3ISHA 1YQ3A 1PBDA 3HYVA 3AE5A 1TDKA 4U8NA 3CPHG 4H4WA 1F8RA 1M1RA 4TM0A 2FJDA 4Q0TA 2A87A 5J7XA 4N9XA 4K5SA 2CDUA 3V3OA 2YVFA 2WU2A 3BI5A 3FMWA 3BNJA 4H4VA 5EOWA 4K5RA 2Q6UA 3NK2X 3Q6JA 5KVHA 1ZY8A 4CY8A 4TM4A 1ZMCA 3UKFA 1KF6A 4ADWA 4Z2UA 1LJ1A 2Y6RA 1DOBA 2TMDA 2X3NA 3IF9A 3P4RA 3SCEA 3IWAA 4A99A 3H8IA 4K22A 4MJWA 5JCKA 3AEGA 3ICRA 3TORA 3OZ2A 3ALMA 1K0LA 4H4RA 5HHFA 4DNAA 1ZKQA 1GV4A 1FEBA 1GETA 1UKVG 5CKUA 3DMEA 4IA5A 4UDRA 4YSXA 3EF6A 1H83A 5KWFA 2X50A 3S61A 4B69A 3RP8A 1YKJA 4U8OA 4EIPA 3I6DA 4H4QA 4PAAA 2J3NA 3CIRA 1JEHA 2C76A 4Q5BA 2XDOA 2YG4A 2WDRA 4FK1C 2GB0A 4J56A 3COXA 1PJ5A 4AT2A 4B1BA 1LV0A 3ABVA 1PBEA 2VZ2A 3LZXA 4Y4MA 1O95A 4GRTA 4YKFA 1EBDA 3QFBA 4FX9A 1PBFA 4GAPA 2XVJA 3LXDA 1QDBA 3H8LA 2Z5XA 5JCLA 2GH5A 3F8DA 4IVOB 3TTBA 4NEVA 4U2TA 5BUKA 1FT6A 3DGHA 3UBRA 2CVJA 2JAEA 2R0GA 1PBCA 4GR1A 2BS4A 1XANA 3AEAA 3NG7X 1REOA 2E80A 3T0KA 1JNIA 3BNGA 3SZCA 2XFNA 3LZWA 3P4QA 3UOVA 1H7XA 2XFPA 5JCIA 2GR3A 3BNMA 1NHSA 2YG7A 1D4DA 2FJEA 4RG3A 5L46A 1GESA 4J57A 2YG5A 1E1LA 3II4A 4GAVA 4YWOA 4CCQA 3SZ0A 3KVEA 5IPYA 2E4GA 3UP4A 4Z2TA 2YVJA 1FL2A 3KU9A 4OCGA 3S5WA 3QSSA 1RP0A 2B76A 1PN0A 3BI4A 1B5QA 1RYIA 3H4KA 1ZOYA 4CNJA 2YLTA 3AE2A 3QSMA 4FDCB 2AQJA 2VRMA 2VR0A 2BCPA 4DSGA 3CNPA 4U2LA 2BS2A 2R4EA 2B9XA 3ICTA 1PS9A 4U8KA 4WCTA 1GEUA 1GREA 2H88A 2R9ZA 2X8CA 1PDHA 3C4NA 2UZZA 2V61A 4U8PA 3BNHA 1F6MA 2YG6A 4Y4NA 4IA6A 1PBBA 3CGBA 1OJ9A 2JBVA 4J33A 4E0VA 4O5UA 4L38A 2W0HA 1CJ4A 2R46A 2GAGB 3I3LA 3KPFA 3UOZA 2NVKX 3QJ4A 1DJQA 3GD3A 1DODA 1FS7A 5KRQA 1ZDLA 3PS9A 4EM4A 2C73A 2GAHB 2J7AA 4A7AA 2I0ZA 1GNDA 5KXJA 1KFYA 1JNRA 4O5QA 2ACZA 1K4QA 4BURA 5EBKA 2BRYA 1D4EA 3DJGX 1DJNA 2YVGA 3NHOX 3NYFA 1JRZA 1NHQA 1F8WA 1MOKA 1D5TA 2GEWA 2WP6A 3B6DA 1GERA 4NTCA 4A5LA 1BWCA 3ZDNA 2WETA 2WP9A 1DOCA 1VDCA 2YLXA 3UTEA 4K8DA 1N1PA 1CC6A 1N4WA 3C96A 4APNA 1W4XA 4BK1A 5J60A 2BS3A 2ZO5A 5M0ZA 2YLZA 4I59A 1GALA 1NENA 3S7WA 4H4YA 4NWZA 4OPCA 5IQ1A 2QCUA 1VQWA 1ONFA 4H2NA 4TM3A 3D1IA 3DJDA 2EQ6A 5TR3A 4K7ZA 2Q0LA 3KPKA 4JDRA 1Q9IA 3P4SA 2XFQA 3CNTA 3SM8A 3UKQA 3BNFA 4NNJA 1N4UA 2AR8A 2NPXA 2WBAA 3NKSA 1N4VA 2WESA 1TDFA 3P4PA 3UTGA 2CULA 1CJCA 2BK5A 2BK3A 1XDIA 1S3EA 3NK0X 2WPCA 3NRNA 5BVAA 1IUVA 2YWLA 1XPQA 3UP5A 2BCGG 4B65A 5C3JA 4NTDA 2BACA 3FO3A 1LTXR 5CQFA 1H7WA 2RF7A 3GYJA 1MO9A 4BV6A 2YAUA 1S2YA 3E1TA 3UKAA 4Z25A 3GYIA 3T31A 1Z6LA 4LIIA 2QA2A 5JCNA 3P9UA 2R4JA 1S3BA 3RP6A 3GYXA 1OJDA 4CRTA 1NHPA 3ALJA 1GT8A 4AP1A 2B9WA 4YSZA 2EQ9A 1ZX9A 2YLRA 2XLRA 1M64A 1JU2A 2WHDA 3L8KA 5HXIA 3T2KA 3HYXA 5ER0A 2YR6A 3CPIG 3NIXA 3RP7A 2BC1A 4YT0A 2GV8A 3DGZA 4CBQA 2GMHA 4X4JA 4TM1A 3UKLA 3HYWA 3SQPA 4I58A 1EL8A 1K0IA 4TLXA 4B67A 1Q1WA 2XVFA 4GUVA 3NGCX 4CNKA 3G5QA 4YSYA 3ALLA 3LB8A 1BZLA 3GMBA 3M12A 2A8XA 4C3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G5R A;  4JNA A;  1S2Q A;  3FG2 P;  3IHM A;  4M52 A;  2A89 A;  1NAA A;  1RSG A;  1KNR A;  1TDN A;  2V60 A;  2Q7V A;  1E1M A;  5JCM A;  3UKP A;  5HYM A;  3NNE A;  2R0C A;  3AEE A;  5FS6 A;  2LFC A;  4PAB A;  1NPX A;  3URH A;  4H50 A;  3AB1 A;  4EQW A;  5GRT A;  4X9N A;  5HY5 A;  3NTA A;  1VG9 A;  4BK3 A;  2RGH A;  2RDZ A;  2XVE A;  3CTY A;  3NTD A;  1PHH A;  1L9E A;  2V3B A;  4WX1 A;  2WOI A;  3IC9 A;  1O94 A;  4J34 A;  2WPF A;  2XFU A;  4AT0 A;  3RHA A;  3V76 A;  3K7Q X;  4GDP A;  2FJB A;  4UDP A;  4YSH A;  1DXL A;  3AE3 A;  3T37 A;  2EQ7 A;  1IJH A;  1JOA A;  2C3C A;  5EB4 A;  2WOW A;  2XLP A;  3DK4 A;  1GPE A;  2WDQ A;  1BKW A;  1PXA A;  2Y6Q A;  2QAE A;  4ZN0 A;  3UKK A;  4RSL A;  4Q4U A;  2C75 A;  1IUX A;  1H84 A;  3QSE A;  1PXB A;  2B9Y A;  1H86 A;  2GF3 A;  1TDE A;  2WS3 A;  1M1P A;  3KLJ A;  3NYC A;  2YM2 A;  4KPR A;  5FS8 A;  3CGD A;  1LPF A;  2VVL G;  3LJP A;  4NZH A;  2B7S A;  3UOY A;  1E7P A;  3BHK A;  1HYU A;  1JNZ A;  1NDA A;  2R45 A;  1GRA A;  3Q9T A;  3AE7 A;  1TYP A;  4U2S A;  2JK6 A;  1MXT A;  3LG1 A;  3UTH A;  2IVD A;  3UKH A;  2BYB A;  2QA1 A;  5GSN A;  1Y0P A;  1BF3 A;  2Q0K A;  2VOU A;  4AP3 A;  4H2R A;  3AE8 A;  2VVL A;  1GRB A;  2K3V A;  2XVH A;  3GRS A;  3GDN A;  2XYO A;  1TYT A;  1OAH A;  2X99 A;  3IHG A;  1JRX A;  3GWF A;  3ZYX A;  3ATQ A;  5DBJ A;  1FOH A;  1GSN A;  4GF7 A;  4IVM B;  4Z24 A;  4ECH A;  2RGO A;  2AAQ A;  3CPJ G;  3CN8 A;  3SGL A;  1SEZ A;  4XWR A;  3MMO A;  4P9S A;  3CNS A;  3LGQ A;  1NG3 A;  4K2X A;  1IUU A;  2EQ8 A;  3OWM A;  2OA1 A;  3DJJ A;  2XLS A;  1YQZ A;  4OVI A;  4U8J A;  2WEU A;  1EL7 A;  4EMW A;  1H81 A;  2IVE A;  1GOS A;  4A9W A;  3F29 A;  2H89 A;  1H82 A;  2FBW A;  4Q5C A;  3AYI A;  4OPT A;  3NLC A;  2O9Z A;  1SP3 A;  2E1M A;  3KA7 A;  3NN6 X;  4H4S A;  2XFO A;  1CL0 A;  1CJ2 A;  3NH3 X;  3P1W A;  2FJA A;  1CHU A;  2ZZC A;  5U1O A;  4Z43 A;  1F8S A;  1YQ4 A;  2DKH A;  2BC0 A;  2OT4 A;  4BJY A;  2XVI A;  4GDE A;  4B64 A;  4C3Y A;  3DH9 A;  5U63 A;  2V5Z A;  1GTE A;  3EPT A;  4YTM A;  3R9U A;  2C7G A;  2YQU A;  5FS9 A;  4ZCC A;  1KSS A;  2HQM A;  3GMC A;  5KVI A;  4BK2 A;  4H4T A;  5C2T A;  4B63 A;  4OPI A;  2GR0 A;  4EQX A;  4Y4L A;  1OJC A;  3NK1 X;  1GRF A;  4EQR A;  1CC4 A;  5EB5 A;  3DK8 A;  5FMH A;  3UTF A;  1GXF A;  1H6V A;  2WOV A;  2XLU A;  3NN0 X;  1GRG A;  3PVC A;  4J36 A;  4FK1 A;  4JQ9 A;  3CND A;  2DKI A;  1M1Q A;  3C4A A;  2GR2 A;  2BXS A;  4TLZ A;  1KDG A;  1X31 B;  3SXQ A;  2R0P A;  2WPE A;  3AEB A;  2B7R A;  1YY5 A;  2YR4 A;  3AED A;  4H2P A;  2GQW A;  2JKC A;  3M13 A;  3LOV A;  1BGN A;  3RED A;  4HA6 A;  4U8L A;  3AEF A;  2VQB A;  1OJA A;  2X8G A;  3VRA A;  2E81 A;  4X9M A;  4A65 A;  1EL9 A;  3L1T A;  2WQY A;  2JB3 A;  4UDQ A;  2RGJ A;  2WP5 A;  3GDP A;  2ARD A;  1GRT A;  1EL5 A;  1Q1R A;  2ZBW A;  4IV9 A;  4OPU A;  1PJ6 A;  1FEC A;  2CFY A;  2VRL A;  3VRD B;  3VR9 A;  3L1R A;  4XXG A;  3NT6 A;  2YLW A;  2JB1 A;  3JSK A;  4JY2 A;  1K0J A;  2GQF A;  4OPG A;  4USR A;  1QJD A;  2WU5 A;  4YTN A;  2V3A A;  2E5V A;  5FS7 A;  4OPL A;  4H2Q A;  4A6N A;  1CF3 A;  1KNP A;  1VG0 A;  1VRQ B;  4H4U A;  1LQU A;  1IUS A;  4BJZ A;  5IQ4 A;  1ZMD A;  2Z5Y A;  1PXC A;  3G5S A;  4A6N B;  4YXD A;  2OLN A;  3B3R A;  1ELI A;  4LA1 A;  4OPD A;  3AE4 A;  2X8H A;  4U8I A;  1E1K A;  3NYE A;  1GRH A;  1TRB A;  3AYJ A;  1FT5 A;  1Y56 A;  3D1C A;  1ZK7 A;  1OJT A;  3DJE A;  4Z26 A;  2BK4 A;  1LQT A;  1FCD A;  1DNC A;  3AD7 B;  4EIQ A;  2JB2 A;  1Y56 B;  5KOX A;  3QVP A;  4UP3 A;  4JN9 A;  2BXR A;  4GCM A;  4C74 A;  4DGK A;  2GMJ A;  1FS8 A;  1GU6 A;  3D8X A;  1E6E A;  3VQR A;  4H4X A;  1BGJ A;  1QLB A;  3SFE A;  2C70 A;  3BHF A;  3QFA A;  1L0V A;  3M0O A;  3SFD A;  2OLO A;  3K7T A;  2F5Z A;  1V59 A;  4CCR A;  4L3Z A;  4D03 A;  1P2E A;  2XLT A;  4YTP A;  2YLS A;  1NG4 A;  4Z44 A;  1BVB A;  3DA1 A;  1NHR A;  2VVM A;  1D7Y A;  3F8P A;  3AE9 A;  3CGE A;  2WDV A;  3FBS A;  2ZZ0 A;  2C72 A;  3AYL A;  1GTH A;  4Q17 A;  3FIM B;  4L3X A;  3KKJ A;  1CJ3 A;  3AWI A;  4H7U A;  4AOX A;  5M10 A;  3PO7 A;  4AOS A;  1ZP0 A;  4A79 A;  4C77 A;  3LAD A;  2RAB A;  2VQ7 A;  4ZCD A;  4Z2R A;  3RKH A;  3QVR A;  2GRT A;  4EMJ A;  2C66 A;  4HB9 A;  3AD9 B;  3FPZ A;  2YM1 A;  5KOW A;  2YR5 A;  4L3Y A;  3F8R A;  1B8S A;  1IUT A;  3DK9 A;  4WJY A;  3AE6 A;  3GD4 A;  4KX6 A;  3VR8 A;  4D04 A;  3AEC A;  5LV9 A;  1JRY A;  3AD8 B;  2C65 A;  2IID A;  4H4Z A;  1P2H A;  2BA9 A;  1COY A;  2V6O A;  4YKG A;  1KSU A;  4J2W A;  2OAL A;  3WE0 A;  4ICY A;  4USQ A;  4Q1O A;  1D7L A;  3GRT A;  1L9D A;  4EM3 A;  5BUL A;  3GWD A;  3ADA B;  3GSI A;  3V3N A;  3UU9 A;  1XHC A;  4LU6 A;  3RNM A;  4EQS A;  4DSH A;  4NEW A;  5BRT A;  1NEK A;  1D4C A;  5U25 A;  2GR1 A;  1E39 A;  2APG A;  2BAB A;  2C67 A;  1DOE A;  4B68 A;  4C5O A;  4CY6 A;  4U8M A;  1FS9 A;  3BI2 A;  1B37 A;  2PHH A;  3AE1 A;  4JNQ A;  2C64 A;  3OC4 A;  1FEA A;  2TPR A;  4J31 A;  4JY3 A;  4XWZ A;  1PJ7 A;  3HZL A;  3ITJ A;  2C3D A;  2XCG A;  2GVC A;  1CBO A;  2ZZB A;  3ATR A;  1F3P A;  1B4V A;  4NTE A;  3UOX A;  4EMI A;  1LVL A;  3EAO A;  3EAN A;  4RG4 A;  2PYX A;  4REK A;  3AXB A;  1CC2 A;  3K30 A;  3UCL A;  3K7M X;  1QO8 A;  3O0H A;  4B66 A;  3BNU A;  2YG3 A;  3CGC A;  3KD9 A;  3GM6 A;  1AOG A;  2OAM A;  3CNJ A;  1E1N A;  1TDO A;  3ICS A;  4H4P A;  1M6I A;  3VRB A;  1O5W A;  1IUW A;  1L9C A;  1ZOV A;  3ISH A;  1YQ3 A;  1PBD A;  3AE5 A;  1TDK A;  4U8N A;  3CPH G;  4H4W A;  1F8R A;  1M1R A;  4TM0 A;  2FJD A;  4Q0T A;  2A87 A;  5J7X A;  4N9X A;  4K5S A;  2CDU A;  3V3O A;  2YVF A;  2WU2 A;  3BI5 A;  3FMW A;  3BNJ A;  4H4V A;  5EOW A;  4K5R A;  2Q6U A;  3NK2 X;  3Q6J A;  5KVH A;  1ZY8 A;  4CY8 A;  4TM4 A;  1ZMC A;  3UKF A;  1KF6 A;  4ADW A;  4Z2U A;  1LJ1 A;  2Y6R A;  1DOB A;  2TMD A;  2X3N A;  3IF9 A;  3P4R A;  3SCE A;  3IWA A;  4A99 A;  3H8I A;  4K22 A;  4MJW A;  5JCK A;  3AEG A;  3ICR A;  3TOR A;  3OZ2 A;  3ALM A;  1K0L A;  4H4R A;  5HHF A;  4DNA A;  1ZKQ A;  1GV4 A;  1FEB A;  1GET A;  1UKV G;  5CKU A;  3DME A;  4IA5 A;  4UDR A;  4YSX A;  3EF6 A;  1H83 A;  5KWF A;  2X50 A;  3S61 A;  4B69 A;  3RP8 A;  1YKJ A;  4U8O A;  4EIP A;  3I6D A;  4H4Q A;  4PAA A;  2J3N A;  3CIR A;  1JEH A;  2C76 A;  4Q5B A;  2XDO A;  2YG4 A;  2WDR A;  4FK1 C;  2GB0 A;  4J56 A;  3COX A;  1PJ5 A;  4AT2 A;  4B1B A;  1LV0 A;  3ABV A;  1PBE A;  2VZ2 A;  3LZX A;  4Y4M A;  1O95 A;  4GRT A;  4YKF A;  1EBD A;  3QFB A;  4FX9 A;  1PBF A;  2XVJ A;  3LXD A;  1QDB A;  3H8L A;  2Z5X A;  5JCL A;  2GH5 A;  3F8D A;  4IVO B;  3TTB A;  4NEV A;  4U2T A;  5BUK A;  1FT6 A;  3DGH A;  3UBR A;  2CVJ A;  2JAE A;  2R0G A;  1PBC A;  4GR1 A;  2BS4 A;  1XAN A;  3AEA A;  3NG7 X;  1REO A;  2E80 A;  1JNI A;  3BNG A;  3UOV A;  2XFN A;  3LZW A;  3P4Q A;  1H7X A;  2XFP A;  5JCI A;  2GR3 A;  3BNM A;  1NHS A;  2YG7 A;  1D4D A;  2FJE A;  4RG3 A;  5L46 A;  1GES A;  4J57 A;  2YG5 A;  1E1L A;  3II4 A;  4YWO A;  4CCQ A;  5IPY A;  3KVE A;  2E4G A;  3UP4 A;  4Z2T A;  2YVJ A;  1FL2 A;  3KU9 A;  4OCG A;  3S5W A;  3QSS A;  1RP0 A;  2B76 A;  1PN0 A;  3BI4 A;  1B5Q A;  1RYI A;  3H4K A;  1ZOY A;  4CNJ A;  2YLT A;  3AE2 A;  3QSM A;  4FDC B;  2AQJ A;  2VRM A;  2VR0 A;  2BCP A;  4DSG A;  3CNP A;  4U2L A;  2BS2 A;  2R4E A;  2B9X A;  3ICT A;  1PS9 A;  4U8K A;  4WCT A;  1GEU A;  1GRE A;  2H88 A;  2R9Z A;  2X8C A;  1PDH A;  3C4N A;  2UZZ A;  2V61 A;  4U8P A;  3BNH A;  1F6M A;  2YG6 A;  4Y4N A;  4IA6 A;  1PBB A;  3CGB A;  1OJ9 A;  2JBV A;  4J33 A;  4E0V A;  4O5U A;  4L38 A;  2W0H A;  1CJ4 A;  2R46 A;  2GAG B;  3I3L A;  3KPF A;  3UOZ A;  2NVK X;  3QJ4 A;  1DJQ A;  3GD3 A;  1DOD A;  1FS7 A;  5KRQ A;  1ZDL A;  3PS9 A;  4EM4 A;  2C73 A;  2GAH B;  2J7A A;  4A7A A;  2I0Z A;  1GND A;  5KXJ A;  1KFY A;  1JNR A;  4O5Q A;  2ACZ A;  1K4Q A;  4BUR A;  5EBK A;  3DJG X;  1D4E A;  4Z25 A;  1DJN A;  2YVG A;  3NHO X;  3NYF A;  1JRZ A;  1NHQ A;  1F8W A;  1MOK A;  1D5T A;  2GEW A;  2WP6 A;  3B6D A;  1GER A;  4NTC A;  4A5L A;  1BWC A;  3ZDN A;  2WET A;  2WP9 A;  1DOC A;  1VDC A;  2YLX A;  3UTE A;  4K8D A;  1N1P A;  1CC6 A;  1N4W A;  3C96 A;  4APN A;  1W4X A;  4BK1 A;  5J60 A;  2BS3 A;  2ZO5 A;  5M0Z A;  2YLZ A;  4I59 A;  1GAL A;  1NEN A;  3S7W A;  4H4Y A;  4OPC A;  5IQ1 A;  2QCU A;  1VQW A;  1ONF A;  4H2N A;  4TM3 A;  3D1I A;  3DJD A;  2EQ6 A;  5TR3 A;  4K7Z A;  2Q0L A;  4JDR A;  1Q9I A;  3P4S A;  2XFQ A;  3CNT A;  3SM8 A;  3UKQ A;  3BNF A;  1N4U A;  2AR8 A;  2NPX A;  2WBA A;  3NKS A;  1N4V A;  2WES A;  1TDF A;  3P4P A;  3UTG A;  2CUL A;  1CJC A;  2BK5 A;  2BK3 A;  1XDI A;  1S3E A;  3NK0 X;  2WPC A;  3NRN A;  5BVA A;  1IUV A;  2YWL A;  1XPQ A;  3UP5 A;  2BCG G;  4B65 A;  5C3J A;  4NTD A;  2BAC A;  3FO3 A;  1LTX R;  5CQF A;  1H7W A;  2RF7 A;  3GYJ A;  1MO9 A;  4BV6 A;  2YAU A;  1S2Y A;  3E1T A;  3UKA A;  3GYI A;  1Z6L A;  4LII A;  2QA2 A;  5JCN A;  3P9U A;  2R4J A;  1S3B A;  3RP6 A;  3GYX A;  1OJD A;  4CRT A;  1NHP A;  3ALJ A;  1GT8 A;  4AP1 A;  2B9W A;  4YSZ A;  2EQ9 A;  1ZX9 A;  2YLR A;  2XLR A;  1M64 A;  1JU2 A;  2WHD A;  3L8K A;  5HXI A;  5ER0 A;  2YR6 A;  3CPI G;  3NIX A;  3RP7 A;  2BC1 A;  4YT0 A;  2GV8 A;  3DGZ A;  4CBQ A;  2GMH A;  4X4J A;  4TM1 A;  3UKL A;  3SQP A;  4I58 A;  1EL8 A;  1K0I A;  4TLX A;  4B67 A;  1Q1W A;  2XVF A;  4GUV A;  3NGC X;  4CNK A;  3G5Q A;  4YSY A;  3ALL A;  3LB8 A;  1BZL A;  3GMB A;  3M12 A;  2A8X A;  4C3X A; 
#chains in the Genus database with same CATH topology
 3G5R A;  4JNA A;  1S2Q A;  3FG2 P;  3IHM A;  4M52 A;  2A89 A;  1NAA A;  1RSG A;  1KNR A;  1TDN A;  2V60 A;  2Q7V A;  1E1M A;  5JCM A;  3UKP A;  5HYM A;  3NNE A;  2R0C A;  3AEE A;  5FS6 A;  2LFC A;  4PAB A;  1NPX A;  3URH A;  4H50 A;  3AB1 A;  4EQW A;  5GRT A;  4X9N A;  5HY5 A;  3NTA A;  1VG9 A;  4BK3 A;  2RGH A;  2RDZ A;  2XVE A;  3CTY A;  3NTD A;  1PHH A;  1L9E A;  2V3B A;  4WX1 A;  2WOI A;  3IC9 A;  1O94 A;  4J34 A;  2WPF A;  2XFU A;  4AT0 A;  3RHA A;  3V76 A;  3K7Q X;  4GDP A;  2FJB A;  4UDP A;  4YSH A;  1DXL A;  3AE3 A;  3T37 A;  2EQ7 A;  1IJH A;  1JOA A;  2C3C A;  5EB4 A;  2WOW A;  2XLP A;  3DK4 A;  1GPE A;  2WDQ A;  1BKW A;  1PXA A;  2Y6Q A;  2QAE A;  4ZN0 A;  3UKK A;  4RSL A;  4Q4U A;  2C75 A;  1IUX A;  1H84 A;  3QSE A;  1PXB A;  2B9Y A;  1H86 A;  2GF3 A;  1TDE A;  2WS3 A;  1M1P A;  3KLJ A;  3NYC A;  2YM2 A;  4KPR A;  5FS8 A;  3CGD A;  1LPF A;  2VVL G;  3LJP A;  4NZH A;  2B7S A;  3UOY A;  1E7P A;  3BHK A;  1HYU A;  1JNZ A;  1NDA A;  2R45 A;  1GRA A;  3Q9T A;  3AE7 A;  5KMS A;  1TYP A;  4U2S A;  2JK6 A;  1MXT A;  3LG1 A;  3UTH A;  2IVD A;  3UKH A;  2BYB A;  2QA1 A;  5GSN A;  1Y0P A;  1BF3 A;  2Q0K A;  2VOU A;  3SXI A;  4AP3 A;  4H2R A;  3AE8 A;  2VVL A;  1GRB A;  2K3V A;  2XVH A;  3GRS A;  3GDN A;  2XYO A;  1TYT A;  1OAH A;  2X99 A;  3IHG A;  1JRX A;  3GWF A;  3ZYX A;  3ATQ A;  5DBJ A;  1FOH A;  1GSN A;  4GF7 A;  4IVM B;  4Z24 A;  4ECH A;  2RGO A;  2AAQ A;  3CPJ G;  3CN8 A;  3SGL A;  1SEZ A;  4XWR A;  3MMO A;  4P9S A;  3CNS A;  3LGQ A;  1NG3 A;  4K2X A;  1IUU A;  2EQ8 A;  3OWM A;  2OA1 A;  3DJJ A;  2XLS A;  1YQZ A;  4OVI A;  4U8J A;  2WEU A;  1EL7 A;  4EMW A;  1H81 A;  2IVE A;  1GOS A;  4A9W A;  3F29 A;  2H89 A;  1H82 A;  2FBW A;  4Q5C A;  3AYI A;  4OPT A;  3NLC A;  2O9Z A;  1SP3 A;  4II3 A;  2E1M A;  3KA7 A;  3NN6 X;  4H4S A;  3SY4 A;  2XFO A;  1CL0 A;  1CJ2 A;  3NH3 X;  3P1W A;  2FJA A;  1CHU A;  2ZZC A;  5U1O A;  4Z43 A;  1F8S A;  1YQ4 A;  5KMP A;  2DKH A;  2C4C A;  2BC0 A;  2OT4 A;  4BJY A;  2XVI A;  4GDE A;  4G9K A;  4B64 A;  4C3Y A;  3DH9 A;  5U63 A;  2V5Z A;  1GTE A;  3EPT A;  4YTM A;  3R9U A;  2C7G A;  2YQU A;  5FS9 A;  4ZCC A;  1KSS A;  2HQM A;  3GMC A;  5KVI A;  4BK2 A;  4H4T A;  5C2T A;  4B63 A;  4OPI A;  2GR0 A;  4EQX A;  4Y4L A;  1OJC A;  3NK1 X;  1GRF A;  4EQR A;  1CC4 A;  5EB5 A;  3DK8 A;  5FMH A;  3UTF A;  1GXF A;  1H6V A;  2WOV A;  2XLU A;  3NN0 X;  1GRG A;  3PVC A;  4J36 A;  4FK1 A;  4JQ9 A;  3CND A;  2DKI A;  1M1Q A;  3C4A A;  2GR2 A;  5KNL A;  2BXS A;  4TLZ A;  1KDG A;  1X31 B;  3SXQ A;  2R0P A;  2WPE A;  3AEB A;  2B7R A;  1YY5 A;  2YR4 A;  3AED A;  4H2P A;  2GQW A;  2JKC A;  3T2Z A;  3M13 A;  3LOV A;  1BGN A;  3RED A;  4HA6 A;  4U8L A;  3AEF A;  3CMM A;  4G6H A;  2VQB A;  1OJA A;  2X8G A;  3VRA A;  2E81 A;  4X9M A;  4A65 A;  1EL9 A;  5KMR A;  3L1T A;  2WQY A;  2JB3 A;  4UDQ A;  2RGJ A;  2WP5 A;  3GDP A;  2ARD A;  1GRT A;  1EL5 A;  1Q1R A;  2ZBW A;  4IV9 A;  4OPU A;  1PJ6 A;  1FEC A;  2CFY A;  2VRL A;  3VRD B;  3VR9 A;  3L1R A;  4XXG A;  3NT6 A;  2YLW A;  2JB1 A;  3JSK A;  4JY2 A;  1K0J A;  2GQF A;  4OPG A;  4USR A;  1QJD A;  2WU5 A;  4YTN A;  2V3A A;  2E5V A;  5FS7 A;  4OPL A;  4H2Q A;  4A6N A;  1CF3 A;  1KNP A;  1VG0 A;  1VRQ B;  4H4U A;  1LQU A;  1IUS A;  4BJZ A;  5IQ4 A;  1ZMD A;  2Z5Y A;  1PXC A;  3G5S A;  4A6N B;  4YXD A;  2OLN A;  3B3R A;  1ELI A;  4LA1 A;  4OPD A;  3AE4 A;  2X8H A;  4U8I A;  1E1K A;  3SZW A;  3NYE A;  1GRH A;  1TRB A;  3AYJ A;  1FT5 A;  1Y56 A;  3D1C A;  3SX6 A;  1ZK7 A;  1OJT A;  3DJE A;  4G73 A;  4Z26 A;  2BK4 A;  1LQT A;  1FCD A;  1DNC A;  3AD7 B;  4EIQ A;  2JB2 A;  1Y56 B;  5KOX A;  3QVP A;  4UP3 A;  4JN9 A;  2BXR A;  4GCM A;  4C74 A;  4DGK A;  2GMJ A;  1FS8 A;  1GU6 A;  3D8X A;  1E6E A;  3VQR A;  4H4X A;  1BGJ A;  4G6G A;  1QLB A;  3SFE A;  2C70 A;  3BHF A;  3QFA A;  1L0V A;  5KMQ A;  3M0O A;  3SFD A;  2OLO A;  3K7T A;  2F5Z A;  1V59 A;  4CCR A;  4L3Z A;  4D03 A;  1P2E A;  2XLT A;  4YTP A;  2YLS A;  1NG4 A;  4Z44 A;  1BVB A;  3DA1 A;  1NHR A;  2VVM A;  1D7Y A;  3F8P A;  3AE9 A;  3CGE A;  2WDV A;  3FBS A;  2ZZ0 A;  2C72 A;  3AYL A;  1GTH A;  4Q17 A;  3FIM B;  4L3X A;  3KKJ A;  1CJ3 A;  3AWI A;  4H7U A;  4AOX A;  5M10 A;  3PO7 A;  4AOS A;  3SYI A;  1ZP0 A;  4A79 A;  4C77 A;  3LAD A;  2RAB A;  2VQ7 A;  4ZCD A;  4Z2R A;  3RKH A;  3QVR A;  2GRT A;  4EMJ A;  2C66 A;  4HB9 A;  3AD9 B;  3FPZ A;  2YM1 A;  5KOW A;  2YR5 A;  4L3Y A;  3F8R A;  1B8S A;  1IUT A;  3DK9 A;  4WJY A;  3AE6 A;  3GD4 A;  4KX6 A;  3VR8 A;  4D04 A;  3AEC A;  5LV9 A;  1JRY A;  3AD8 B;  2C65 A;  2IID A;  4H4Z A;  1P2H A;  2BA9 A;  1COY A;  2V6O A;  3T2Y A;  4YKG A;  1KSU A;  4J2W A;  2OAL A;  3WE0 A;  2CZS A;  4ICY A;  4Q1O A;  1D7L A;  3GRT A;  1L9D A;  4USQ A;  4EM3 A;  3GWD A;  5BUL A;  3ADA B;  3GSI A;  2BRA A;  3UU9 A;  3V3N A;  1XHC A;  4LU6 A;  3RNM A;  4EQS A;  4DSH A;  4NEW A;  5BRT A;  1NEK A;  1D4C A;  5U25 A;  2GR1 A;  1E39 A;  2APG A;  2BAB A;  2C67 A;  1DOE A;  4II2 A;  3SZF A;  4B68 A;  4C5O A;  4CY6 A;  4U8M A;  1FS9 A;  3BI2 A;  1B37 A;  2PHH A;  3AE1 A;  4JNQ A;  2C64 A;  3OC4 A;  1FEA A;  2TPR A;  4J31 A;  4JY3 A;  4XWZ A;  1PJ7 A;  3HZL A;  3ITJ A;  2C3D A;  2XCG A;  2GVC A;  1CBO A;  2ZZB A;  3ATR A;  1F3P A;  1B4V A;  4NTE A;  3UOX A;  4EMI A;  1LVL A;  3EAO A;  3EAN A;  4RG4 A;  2PYX A;  4REK A;  3AXB A;  1CC2 A;  3K30 A;  3T14 A;  3UCL A;  3K7M X;  1QO8 A;  3O0H A;  4B66 A;  3BNU A;  2YG3 A;  3CGC A;  3KD9 A;  3GM6 A;  1AOG A;  2OAM A;  3CNJ A;  1E1N A;  1TDO A;  3ICS A;  4H4P A;  1M6I A;  3VRB A;  1O5W A;  1IUW A;  1L9C A;  1ZOV A;  4G74 A;  3ISH A;  1YQ3 A;  1PBD A;  3HYV A;  3AE5 A;  1TDK A;  4U8N A;  3CPH G;  4H4W A;  1F8R A;  1M1R A;  4TM0 A;  2FJD A;  4Q0T A;  2A87 A;  5J7X A;  4N9X A;  4K5S A;  2CDU A;  3V3O A;  2YVF A;  2WU2 A;  3BI5 A;  3FMW A;  3BNJ A;  4H4V A;  5EOW A;  4K5R A;  2Q6U A;  3NK2 X;  3Q6J A;  5KVH A;  1ZY8 A;  4CY8 A;  4TM4 A;  1ZMC A;  3UKF A;  1KF6 A;  4ADW A;  4Z2U A;  1LJ1 A;  2Y6R A;  1DOB A;  2TMD A;  2X3N A;  3IF9 A;  3P4R A;  3SCE A;  3IWA A;  4A99 A;  3H8I A;  4K22 A;  4MJW A;  5JCK A;  3AEG A;  3ICR A;  3TOR A;  3OZ2 A;  3ALM A;  1K0L A;  4H4R A;  5HHF A;  4DNA A;  1ZKQ A;  1GV4 A;  1FEB A;  1GET A;  1UKV G;  5CKU A;  3DME A;  4IA5 A;  4UDR A;  4YSX A;  3EF6 A;  1H83 A;  5KWF A;  2X50 A;  3S61 A;  4B69 A;  3RP8 A;  1YKJ A;  4U8O A;  4EIP A;  3I6D A;  4H4Q A;  4PAA A;  2J3N A;  3CIR A;  1JEH A;  2C76 A;  4Q5B A;  2XDO A;  2YG4 A;  2WDR A;  4FK1 C;  2GB0 A;  4J56 A;  3COX A;  1PJ5 A;  4AT2 A;  4B1B A;  1LV0 A;  3ABV A;  1PBE A;  2VZ2 A;  3LZX A;  4Y4M A;  1O95 A;  4GRT A;  4YKF A;  1EBD A;  3QFB A;  4FX9 A;  1PBF A;  4GAP A;  2XVJ A;  3LXD A;  1QDB A;  3H8L A;  2Z5X A;  5JCL A;  2GH5 A;  3F8D A;  4IVO B;  3TTB A;  4NEV A;  4U2T A;  5BUK A;  1FT6 A;  3DGH A;  3UBR A;  2CVJ A;  2JAE A;  2R0G A;  1PBC A;  4GR1 A;  2BS4 A;  1XAN A;  3AEA A;  3NG7 X;  1REO A;  2E80 A;  3T0K A;  1JNI A;  3BNG A;  3SZC A;  2XFN A;  3LZW A;  3P4Q A;  3UOV A;  1H7X A;  2XFP A;  5JCI A;  2GR3 A;  3BNM A;  1NHS A;  2YG7 A;  1D4D A;  2FJE A;  4RG3 A;  5L46 A;  1GES A;  4J57 A;  2YG5 A;  1E1L A;  3II4 A;  4GAV A;  4YWO A;  4CCQ A;  3SZ0 A;  3KVE A;  5IPY A;  2E4G A;  3UP4 A;  4Z2T A;  2YVJ A;  1FL2 A;  3KU9 A;  4OCG A;  3S5W A;  3QSS A;  1RP0 A;  2B76 A;  1PN0 A;  3BI4 A;  1B5Q A;  1RYI A;  3H4K A;  1ZOY A;  4CNJ A;  2YLT A;  3AE2 A;  3QSM A;  4FDC B;  2AQJ A;  2VRM A;  2VR0 A;  2BCP A;  4DSG A;  3CNP A;  4U2L A;  2BS2 A;  2R4E A;  2B9X A;  3ICT A;  1PS9 A;  4U8K A;  4WCT A;  1GEU A;  1GRE A;  2H88 A;  2R9Z A;  2X8C A;  1PDH A;  3C4N A;  2UZZ A;  2V61 A;  4U8P A;  3BNH A;  1F6M A;  2YG6 A;  4Y4N A;  4IA6 A;  1PBB A;  3CGB A;  1OJ9 A;  2JBV A;  4J33 A;  4E0V A;  4O5U A;  4L38 A;  2W0H A;  1CJ4 A;  2R46 A;  2GAG B;  3I3L A;  3KPF A;  3UOZ A;  2NVK X;  3QJ4 A;  1DJQ A;  3GD3 A;  1DOD A;  1FS7 A;  5KRQ A;  1ZDL A;  3PS9 A;  4EM4 A;  2C73 A;  2GAH B;  2J7A A;  4A7A A;  2I0Z A;  1GND A;  5KXJ A;  1KFY A;  1JNR A;  4O5Q A;  2ACZ A;  1K4Q A;  4BUR A;  5EBK A;  2BRY A;  1D4E A;  3DJG X;  1DJN A;  2YVG A;  3NHO X;  3NYF A;  1JRZ A;  1NHQ A;  1F8W A;  1MOK A;  1D5T A;  2GEW A;  2WP6 A;  3B6D A;  1GER A;  4NTC A;  4A5L A;  1BWC A;  3ZDN A;  2WET A;  2WP9 A;  1DOC A;  1VDC A;  2YLX A;  3UTE A;  4K8D A;  1N1P A;  1CC6 A;  1N4W A;  3C96 A;  4APN A;  1W4X A;  4BK1 A;  5J60 A;  2BS3 A;  2ZO5 A;  5M0Z A;  2YLZ A;  4I59 A;  1GAL A;  1NEN A;  3S7W A;  4H4Y A;  4NWZ A;  4OPC A;  5IQ1 A;  2QCU A;  1VQW A;  1ONF A;  4H2N A;  4TM3 A;  3D1I A;  3DJD A;  2EQ6 A;  5TR3 A;  4K7Z A;  2Q0L A;  3KPK A;  4JDR A;  1Q9I A;  3P4S A;  2XFQ A;  3CNT A;  3SM8 A;  3UKQ A;  3BNF A;  4NNJ A;  1N4U A;  2AR8 A;  2NPX A;  2WBA A;  3NKS A;  1N4V A;  2WES A;  1TDF A;  3P4P A;  3UTG A;  2CUL A;  1CJC A;  2BK5 A;  2BK3 A;  1XDI A;  1S3E A;  3NK0 X;  2WPC A;  3NRN A;  5BVA A;  1IUV A;  2YWL A;  1XPQ A;  3UP5 A;  2BCG G;  4B65 A;  5C3J A;  4NTD A;  2BAC A;  3FO3 A;  1LTX R;  5CQF A;  1H7W A;  2RF7 A;  3GYJ A;  1MO9 A;  4BV6 A;  2YAU A;  1S2Y A;  3E1T A;  3UKA A;  4Z25 A;  3GYI A;  3T31 A;  1Z6L A;  4LII A;  2QA2 A;  5JCN A;  3P9U A;  2R4J A;  1S3B A;  3RP6 A;  3GYX A;  1OJD A;  4CRT A;  1NHP A;  3ALJ A;  1GT8 A;  4AP1 A;  2B9W A;  4YSZ A;  2EQ9 A;  1ZX9 A;  2YLR A;  2XLR A;  1M64 A;  1JU2 A;  2WHD A;  3L8K A;  5HXI A;  3T2K A;  3HYX A;  5ER0 A;  2YR6 A;  3CPI G;  3NIX A;  3RP7 A;  2BC1 A;  4YT0 A;  2GV8 A;  3DGZ A;  4CBQ A;  2GMH A;  4X4J A;  4TM1 A;  3UKL A;  3HYW A;  3SQP A;  4I58 A;  1EL8 A;  1K0I A;  4TLX A;  4B67 A;  1Q1W A;  2XVF A;  4GUV A;  3NGC X;  4CNK A;  3G5Q A;  4YSY A;  3ALL A;  3LB8 A;  1BZL A;  3GMB A;  3M12 A;  2A8X A;  4C3X A; 
#chains in the Genus database with same CATH homology
 3G5R A;  4JNA A;  1S2Q A;  3FG2 P;  3IHM A;  4M52 A;  2A89 A;  1NAA A;  1RSG A;  1KNR A;  1TDN A;  2V60 A;  2Q7V A;  1E1M A;  5JCM A;  3UKP A;  5HYM A;  3NNE A;  2R0C A;  3AEE A;  5FS6 A;  2LFC A;  4PAB A;  1NPX A;  3URH A;  4H50 A;  3AB1 A;  4EQW A;  5GRT A;  4X9N A;  5HY5 A;  3NTA A;  1VG9 A;  4BK3 A;  2RGH A;  2RDZ A;  2XVE A;  3CTY A;  3NTD A;  1PHH A;  1L9E A;  2V3B A;  4WX1 A;  2WOI A;  3IC9 A;  1O94 A;  4J34 A;  2WPF A;  2XFU A;  4AT0 A;  3RHA A;  3V76 A;  3K7Q X;  4GDP A;  2FJB A;  4UDP A;  4YSH A;  1DXL A;  3AE3 A;  3T37 A;  2EQ7 A;  1IJH A;  1JOA A;  2C3C A;  5EB4 A;  2WOW A;  2XLP A;  3DK4 A;  1GPE A;  2WDQ A;  1BKW A;  1PXA A;  2Y6Q A;  2QAE A;  4ZN0 A;  3UKK A;  4RSL A;  4Q4U A;  2C75 A;  1IUX A;  1H84 A;  3QSE A;  1PXB A;  2B9Y A;  1H86 A;  2GF3 A;  1TDE A;  2WS3 A;  1M1P A;  3KLJ A;  3NYC A;  2YM2 A;  4KPR A;  5FS8 A;  3CGD A;  1LPF A;  2VVL G;  3LJP A;  4NZH A;  2B7S A;  3UOY A;  1E7P A;  3BHK A;  1HYU A;  1JNZ A;  1NDA A;  2R45 A;  1GRA A;  3Q9T A;  3AE7 A;  5KMS A;  1TYP A;  4U2S A;  2JK6 A;  1MXT A;  3LG1 A;  3UTH A;  2IVD A;  3UKH A;  2BYB A;  2QA1 A;  5GSN A;  1Y0P A;  1BF3 A;  2Q0K A;  2VOU A;  3SXI A;  4AP3 A;  4H2R A;  3AE8 A;  2VVL A;  1GRB A;  2K3V A;  2XVH A;  3GRS A;  3GDN A;  2XYO A;  1TYT A;  1OAH A;  2X99 A;  3IHG A;  1JRX A;  3GWF A;  3ZYX A;  3ATQ A;  5DBJ A;  1FOH A;  1GSN A;  4GF7 A;  4IVM B;  4Z24 A;  4ECH A;  2RGO A;  2AAQ A;  3CPJ G;  3CN8 A;  3SGL A;  1SEZ A;  4XWR A;  3MMO A;  4P9S A;  3CNS A;  3LGQ A;  1NG3 A;  4K2X A;  1IUU A;  2EQ8 A;  3OWM A;  2OA1 A;  3DJJ A;  2XLS A;  1YQZ A;  4OVI A;  4U8J A;  2WEU A;  1EL7 A;  4EMW A;  1H81 A;  2IVE A;  1GOS A;  4A9W A;  3F29 A;  2H89 A;  1H82 A;  2FBW A;  4Q5C A;  3AYI A;  4OPT A;  3NLC A;  2O9Z A;  1SP3 A;  4II3 A;  2E1M A;  3KA7 A;  3NN6 X;  4H4S A;  3SY4 A;  2XFO A;  1CL0 A;  1CJ2 A;  3NH3 X;  3P1W A;  2FJA A;  1CHU A;  2ZZC A;  5U1O A;  4Z43 A;  1F8S A;  1YQ4 A;  5KMP A;  2DKH A;  2C4C A;  2BC0 A;  2OT4 A;  4BJY A;  2XVI A;  4GDE A;  4G9K A;  4B64 A;  4C3Y A;  3DH9 A;  5U63 A;  2V5Z A;  1GTE A;  3EPT A;  4YTM A;  3R9U A;  2C7G A;  2YQU A;  5FS9 A;  4ZCC A;  1KSS A;  2HQM A;  3GMC A;  5KVI A;  4BK2 A;  4H4T A;  5C2T A;  4B63 A;  4OPI A;  2GR0 A;  4EQX A;  4Y4L A;  1OJC A;  3NK1 X;  1GRF A;  4EQR A;  1CC4 A;  5EB5 A;  3DK8 A;  5FMH A;  3UTF A;  1GXF A;  1H6V A;  2WOV A;  2XLU A;  3NN0 X;  1GRG A;  3PVC A;  4J36 A;  4FK1 A;  4JQ9 A;  3CND A;  2DKI A;  1M1Q A;  3C4A A;  2GR2 A;  5KNL A;  2BXS A;  4TLZ A;  1KDG A;  1X31 B;  3SXQ A;  2R0P A;  2WPE A;  3AEB A;  2B7R A;  1YY5 A;  2YR4 A;  3AED A;  4H2P A;  2GQW A;  2JKC A;  3T2Z A;  3M13 A;  3LOV A;  1BGN A;  3RED A;  4HA6 A;  4U8L A;  3AEF A;  3CMM A;  4G6H A;  2VQB A;  1OJA A;  2X8G A;  3VRA A;  2E81 A;  4X9M A;  4A65 A;  1EL9 A;  5KMR A;  3L1T A;  2WQY A;  2JB3 A;  4UDQ A;  2RGJ A;  2WP5 A;  3GDP A;  2ARD A;  1GRT A;  1EL5 A;  1Q1R A;  2ZBW A;  4IV9 A;  4OPU A;  1PJ6 A;  1FEC A;  2CFY A;  2VRL A;  3VRD B;  3VR9 A;  3L1R A;  4XXG A;  3NT6 A;  2YLW A;  2JB1 A;  3JSK A;  4JY2 A;  1K0J A;  2GQF A;  4OPG A;  4USR A;  1QJD A;  2WU5 A;  4YTN A;  2V3A A;  2E5V A;  5FS7 A;  4OPL A;  4H2Q A;  4A6N A;  1CF3 A;  1KNP A;  1VG0 A;  1VRQ B;  4H4U A;  1LQU A;  1IUS A;  4BJZ A;  5IQ4 A;  1ZMD A;  2Z5Y A;  1PXC A;  3G5S A;  4A6N B;  4YXD A;  2OLN A;  3B3R A;  1ELI A;  4LA1 A;  4OPD A;  3AE4 A;  2X8H A;  4U8I A;  1E1K A;  3SZW A;  3NYE A;  1GRH A;  1TRB A;  3AYJ A;  1FT5 A;  1Y56 A;  3D1C A;  3SX6 A;  1ZK7 A;  1OJT A;  3DJE A;  4G73 A;  4Z26 A;  2BK4 A;  1LQT A;  1FCD A;  1DNC A;  3AD7 B;  4EIQ A;  2JB2 A;  1Y56 B;  5KOX A;  3QVP A;  4UP3 A;  4JN9 A;  2BXR A;  4GCM A;  4C74 A;  4DGK A;  2GMJ A;  1FS8 A;  1GU6 A;  3D8X A;  1E6E A;  3VQR A;  4H4X A;  1BGJ A;  4G6G A;  1QLB A;  3SFE A;  2C70 A;  3BHF A;  3QFA A;  1L0V A;  5KMQ A;  3M0O A;  3SFD A;  2OLO A;  3K7T A;  2F5Z A;  1V59 A;  4CCR A;  4L3Z A;  4D03 A;  1P2E A;  2XLT A;  4YTP A;  2YLS A;  1NG4 A;  4Z44 A;  1BVB A;  3DA1 A;  1NHR A;  2VVM A;  1D7Y A;  3F8P A;  3AE9 A;  3CGE A;  2WDV A;  3FBS A;  2ZZ0 A;  2C72 A;  3AYL A;  1GTH A;  4Q17 A;  3FIM B;  4L3X A;  3KKJ A;  1CJ3 A;  3AWI A;  4H7U A;  4AOX A;  5M10 A;  3PO7 A;  4AOS A;  3SYI A;  1ZP0 A;  4A79 A;  4C77 A;  3LAD A;  2RAB A;  2VQ7 A;  4ZCD A;  4Z2R A;  3RKH A;  3QVR A;  2GRT A;  4EMJ A;  2C66 A;  4HB9 A;  3AD9 B;  3FPZ A;  2YM1 A;  5KOW A;  2YR5 A;  4L3Y A;  3F8R A;  1B8S A;  1IUT A;  3DK9 A;  4WJY A;  3AE6 A;  3GD4 A;  4KX6 A;  3VR8 A;  4D04 A;  3AEC A;  5LV9 A;  1JRY A;  3AD8 B;  2C65 A;  2IID A;  4H4Z A;  1P2H A;  2BA9 A;  1COY A;  2V6O A;  3T2Y A;  4YKG A;  1KSU A;  4J2W A;  2OAL A;  3WE0 A;  4ICY A;  4USQ A;  4Q1O A;  1D7L A;  3GRT A;  1L9D A;  4EM3 A;  5BUL A;  3GWD A;  3ADA B;  3GSI A;  2BRA A;  3UU9 A;  3V3N A;  1XHC A;  4LU6 A;  3RNM A;  4EQS A;  4DSH A;  4NEW A;  5BRT A;  1NEK A;  1D4C A;  5U25 A;  2GR1 A;  1E39 A;  2APG A;  2BAB A;  2C67 A;  1DOE A;  4II2 A;  3SZF A;  4B68 A;  4C5O A;  4CY6 A;  4U8M A;  1FS9 A;  3BI2 A;  1B37 A;  2PHH A;  3AE1 A;  4JNQ A;  2C64 A;  3OC4 A;  1FEA A;  2TPR A;  4J31 A;  4JY3 A;  4XWZ A;  1PJ7 A;  3HZL A;  3ITJ A;  2C3D A;  2XCG A;  2GVC A;  1CBO A;  2ZZB A;  3ATR A;  1F3P A;  1B4V A;  4NTE A;  3UOX A;  4EMI A;  1LVL A;  3EAO A;  3EAN A;  4RG4 A;  2PYX A;  4REK A;  3AXB A;  1CC2 A;  3K30 A;  3T14 A;  3UCL A;  3K7M X;  1QO8 A;  3O0H A;  4B66 A;  3BNU A;  2YG3 A;  3CGC A;  3KD9 A;  3GM6 A;  1AOG A;  2OAM A;  3CNJ A;  1E1N A;  1TDO A;  3ICS A;  4H4P A;  1M6I A;  3VRB A;  1O5W A;  1IUW A;  1L9C A;  1ZOV A;  4G74 A;  3ISH A;  1YQ3 A;  1PBD A;  3HYV A;  3AE5 A;  1TDK A;  4U8N A;  3CPH G;  4H4W A;  1F8R A;  1M1R A;  4TM0 A;  2FJD A;  4Q0T A;  2A87 A;  5J7X A;  4N9X A;  4K5S A;  2CDU A;  3V3O A;  2YVF A;  2WU2 A;  3BI5 A;  3FMW A;  3BNJ A;  4H4V A;  5EOW A;  4K5R A;  2Q6U A;  3NK2 X;  3Q6J A;  5KVH A;  1ZY8 A;  4CY8 A;  4TM4 A;  1ZMC A;  3UKF A;  1KF6 A;  4ADW A;  4Z2U A;  1LJ1 A;  2Y6R A;  1DOB A;  2TMD A;  2X3N A;  3IF9 A;  3P4R A;  3SCE A;  3IWA A;  4A99 A;  3H8I A;  4K22 A;  4MJW A;  5JCK A;  3AEG A;  3ICR A;  3TOR A;  3OZ2 A;  3ALM A;  1K0L A;  4H4R A;  5HHF A;  4DNA A;  1ZKQ A;  1GV4 A;  1FEB A;  1GET A;  1UKV G;  5CKU A;  3DME A;  4IA5 A;  4UDR A;  4YSX A;  3EF6 A;  1H83 A;  5KWF A;  2X50 A;  3S61 A;  4B69 A;  3RP8 A;  1YKJ A;  4U8O A;  4EIP A;  3I6D A;  4H4Q A;  4PAA A;  2J3N A;  3CIR A;  1JEH A;  2C76 A;  4Q5B A;  2XDO A;  2YG4 A;  2WDR A;  4FK1 C;  2GB0 A;  4J56 A;  3COX A;  1PJ5 A;  4AT2 A;  4B1B A;  1LV0 A;  3ABV A;  1PBE A;  2VZ2 A;  3LZX A;  4Y4M A;  1O95 A;  4GRT A;  4YKF A;  1EBD A;  3QFB A;  4FX9 A;  1PBF A;  4GAP A;  2XVJ A;  3LXD A;  1QDB A;  3H8L A;  2Z5X A;  5JCL A;  2GH5 A;  3F8D A;  4IVO B;  3TTB A;  4NEV A;  4U2T A;  5BUK A;  1FT6 A;  3DGH A;  3UBR A;  2CVJ A;  2JAE A;  2R0G A;  1PBC A;  4GR1 A;  2BS4 A;  1XAN A;  3AEA A;  3NG7 X;  1REO A;  2E80 A;  3T0K A;  1JNI A;  3BNG A;  3SZC A;  2XFN A;  3LZW A;  3P4Q A;  3UOV A;  1H7X A;  2XFP A;  5JCI A;  2GR3 A;  3BNM A;  1NHS A;  2YG7 A;  1D4D A;  2FJE A;  4RG3 A;  5L46 A;  1GES A;  4J57 A;  2YG5 A;  1E1L A;  3II4 A;  4GAV A;  4YWO A;  4CCQ A;  3SZ0 A;  3KVE A;  5IPY A;  2E4G A;  3UP4 A;  4Z2T A;  2YVJ A;  1FL2 A;  3KU9 A;  4OCG A;  3S5W A;  3QSS A;  1RP0 A;  2B76 A;  1PN0 A;  3BI4 A;  1B5Q A;  1RYI A;  3H4K A;  1ZOY A;  4CNJ A;  2YLT A;  3AE2 A;  3QSM A;  4FDC B;  2AQJ A;  2VRM A;  2VR0 A;  2BCP A;  4DSG A;  3CNP A;  4U2L A;  2BS2 A;  2R4E A;  2B9X A;  3ICT A;  1PS9 A;  4U8K A;  4WCT A;  1GEU A;  1GRE A;  2H88 A;  2R9Z A;  2X8C A;  1PDH A;  3C4N A;  2UZZ A;  2V61 A;  4U8P A;  3BNH A;  1F6M A;  2YG6 A;  4Y4N A;  4IA6 A;  1PBB A;  3CGB A;  1OJ9 A;  2JBV A;  4J33 A;  4E0V A;  4O5U A;  4L38 A;  2W0H A;  1CJ4 A;  2R46 A;  2GAG B;  3I3L A;  3KPF A;  3UOZ A;  2NVK X;  3QJ4 A;  1DJQ A;  3GD3 A;  1DOD A;  1FS7 A;  5KRQ A;  1ZDL A;  3PS9 A;  4EM4 A;  2C73 A;  2GAH B;  2J7A A;  4A7A A;  2I0Z A;  1GND A;  5KXJ A;  1KFY A;  1JNR A;  4O5Q A;  2ACZ A;  1K4Q A;  4BUR A;  5EBK A;  2BRY A;  1D4E A;  3DJG X;  1DJN A;  2YVG A;  3NHO X;  3NYF A;  1JRZ A;  1NHQ A;  1F8W A;  1MOK A;  1D5T A;  2GEW A;  2WP6 A;  3B6D A;  1GER A;  4NTC A;  4A5L A;  1BWC A;  3ZDN A;  2WET A;  2WP9 A;  1DOC A;  1VDC A;  2YLX A;  3UTE A;  4K8D A;  1N1P A;  1CC6 A;  1N4W A;  3C96 A;  4APN A;  1W4X A;  4BK1 A;  5J60 A;  2BS3 A;  2ZO5 A;  5M0Z A;  2YLZ A;  4I59 A;  1GAL A;  1NEN A;  3S7W A;  4H4Y A;  4NWZ A;  4OPC A;  5IQ1 A;  2QCU A;  1VQW A;  1ONF A;  4H2N A;  4TM3 A;  3D1I A;  3DJD A;  2EQ6 A;  5TR3 A;  4K7Z A;  2Q0L A;  3KPK A;  4JDR A;  1Q9I A;  3P4S A;  2XFQ A;  3CNT A;  3SM8 A;  3UKQ A;  3BNF A;  4NNJ A;  1N4U A;  2AR8 A;  2NPX A;  2WBA A;  3NKS A;  1N4V A;  2WES A;  1TDF A;  3P4P A;  3UTG A;  2CUL A;  1CJC A;  2BK5 A;  2BK3 A;  1XDI A;  1S3E A;  3NK0 X;  2WPC A;  3NRN A;  5BVA A;  1IUV A;  2YWL A;  1XPQ A;  3UP5 A;  2BCG G;  4B65 A;  5C3J A;  4NTD A;  2BAC A;  3FO3 A;  1LTX R;  5CQF A;  1H7W A;  2RF7 A;  3GYJ A;  1MO9 A;  4BV6 A;  2YAU A;  1S2Y A;  3E1T A;  3UKA A;  4Z25 A;  3GYI A;  3T31 A;  1Z6L A;  4LII A;  2QA2 A;  5JCN A;  3P9U A;  2R4J A;  1S3B A;  3RP6 A;  3GYX A;  1OJD A;  4CRT A;  1NHP A;  3ALJ A;  1GT8 A;  4AP1 A;  2B9W A;  4YSZ A;  2EQ9 A;  1ZX9 A;  2YLR A;  2XLR A;  1M64 A;  1JU2 A;  2WHD A;  3L8K A;  5HXI A;  3T2K A;  3HYX A;  5ER0 A;  2YR6 A;  3CPI G;  3NIX A;  3RP7 A;  2BC1 A;  4YT0 A;  2GV8 A;  3DGZ A;  4CBQ A;  2GMH A;  4X4J A;  4TM1 A;  3UKL A;  3HYW A;  3SQP A;  4I58 A;  1EL8 A;  1K0I A;  4TLX A;  4B67 A;  1Q1W A;  2XVF A;  4GUV A;  3NGC X;  4CNK A;  3G5Q A;  4YSY A;  3ALL A;  3LB8 A;  1BZL A;  3GMB A;  3M12 A;  2A8X A;  4C3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...