1LJ1A

Crystal structure of q363f/r402a mutant flavocytochrome c3
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIFAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Engineering Water to act as the active site acid catalyst in a soluble fumarate reductase
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords flavocytochrome c3
total genus 193
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1lj1A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lj1A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1lj1A01
2AQJA 4RSLA 1W4XA 2AAQA 2WOIA 5FS6A 2BXSA 3VRDB 2BCPA 4IA5A 4O5QA 4GR1A 4U8LA 1FL2A 4C74A 2H89A 4B65A 4H4WA 3NTDA 2ACZA 2Z5YA 3P4QA 3M0OA 1TYTA 5HYMA 2R0GA 3CNPA 4DSHA 4APNA 3S7WA 4NTCA 1JRYA 4Z25A 2Q0KA 5BUKA 3GYJA 4U8PA 3G5RA 3KKJA 3K7TA 3IHMA 4NEVA 3QVRA 3BHFA 4JNAA 1TRBA 2C70A 3FIMB 1EL8A 1GU6A 1FECA 3E1TA 3P4PA 1DODA 2XFUA 1PJ6A 2Q6UA 3UOVA 5KVHA 2UZZA 5ER0A 3GRTA 2A8XA 2C3DA 1S3EA 3NKSA 5GRTA 4YTNA 2A89A 4NTDA 4HB9A 1GNDA 2V5ZA 4PAAA 3UKLA 2WETA 1Q1RA 1NHSA 1FEAA 3GMCA 2Z5XA 1H83A 4B64A 3UKAA 2GF3A 3AEEA 2FBWA 4A65A 2ZZBA 4CNJA 4D04A 2XFPA 1E6EA 1B5QA 1YKJA 2WQYA 3P4SA 4AP1A 1FS7A 2VQBA 1QLBA 2WS3A 5FS8A 3COXA 4EIPA 1IUXA 1L9CA 1JRXA 1O94A 3BHKA 2GR3A 2BK5A 3DMEA 3C96A 2C64A 2BCGG 4HA6A 2CFYA 4EIQA 4B68A 2LFCA 2DKHA 3LXDA 1TDFA 2JBVA 2C73A 3KPFA 2C65A 3GM6A 1FT6A 1XDIA 2GR1A 2QCUA 5DBJA 4L3XA 3EANA 1ZY8A 4YXDA 4U2SA 1ZMCA 3CGBA 4U2TA 2VQ7A 2YG5A 2NPXA 2XLTA 4U8JA 5KVIA 3K7QX 1BVBA 1SP3A 2EQ8A 1OJDA 3REDA 3NGCX 4BK2A 2B9WA 3KVEA 4RG4A 4BJZA 1VG0A 2XFOA 1TYPA 2YM2A 1K0JA 2XLUA 3FMWA 2YR5A 3QVPA 3PVCA 1L9EA 2R4EA 3CNJA 1ZP0A 4J57A 2CDUA 3AEBA 3FBSA 4C5OA 1ZOYA 3CN8A 4H4UA 2BYBA 2YAUA 2JK6A 3VRBA 2RF7A 1GERA 2QA2A 4U8IA 4UP3A 4I58A 4Y4NA 1V59A 3AB1A 1ONFA 1JOAA 2GMJA 4C3XA 2X8GA 1O95A 4AT2A 2Q7VA 1QJDA 2YVFA 3AE4A 2B7SA 4WJYA 1CHUA 3NTAA 4H4TA 4OPGA 3V76A 4Z2TA 4OPDA 4U8MA 4Q1OA 4YTMA 1NG4A 5M0ZA 1RP0A 4GF7A 5GSNA 3UKKA 1Z6LA 2XYOA 1XANA 3P9UA 1CL0A 3SXQA 1S2YA 4Q4UA 3GDPA 4H2NA 2BA9A 2GEWA 3LADA 2R0PA 3DH9A 1FOHA 3F8RA 4CCRA 4JY3A 1KSUA 4K5RA 2VZ2A 4BURA 1BKWA 1RSGA 2J3NA 4TM3A 3V3OA 1JNIA 1GRGA 1PJ5A 2YG4A 2R0CA 1EBDA 3LZWA 5JCIA 4EM3A 3KLJA 1E1KA 3QSEA 4K22A 1MO9A 3H4KA 3BI4A 4YTPA 3QFAA 3ALJA 1B37A 2O9ZA 2RDZA 1TDOA 4GDPA 2W0HA 3PS9A 4K8DA 3M12A 5CKUA 1JRZA 1XPQA 3I6DA 3C4NA 1VQWA 2VVLG 4DGKA 2OA1A 2BS2A 1LQTA 1H7WA 2R9ZA 3D8XA 2GH5A 2FJDA 1CJ4A 4U8KA 3D1IA 3GYIA 1REOA 1P2EA 1O5WA 2ZZCA 1CC2A 2WPEA 2XVFA 4X4JA 5L46A 3BNFA 3AE5A 1PXAA 1H6VA 3OZ2A 4JQ9A 1YQ4A 3BNUA 3ATQA 3DJJA 3CNTA 3CNDA 2A87A 3GSIA 1N4UA 4NZHA 4EQWA 2GQFA 2TMDA 3NT6A 4NEWA 1AOGA 2WDRA 4PABA 4CNKA 3AXBA 2YR6A 1ZDLA 2J7AA 3BNJA 1OJ9A 2E4GA 3ADAB 4L38A 4DSGA 3FO3A 3BI2A 3UOYA 3NK2X 4H4ZA 2XVHA 3IF9A 5FS9A 1FT5A 1DJNA 4N9XA 1HYUA 1GXFA 2BABA 4USQA 1PBEA 2NVKX 2BS3A 2YR4A 3AD7B 2X8HA 1GT8A 3DGHA 4CCQA 1PHHA 4EQSA 4A7AA 4Q0TA 3AE1A 2B9XA 3IHGA 3QJ4A 3BI5A 1OJCA 3AE8A 5LV9A 3NHOX 4H4XA 2VRLA 2FJAA 4ZN0A 1NHQA 2B7RA 3UU9A 1FS8A 2WOWA 3UTHA 1JU2A 1NG3A 3F29A 2VVLA 3AYLA 2YVGA 3OC4A 1MOKA 3AE2A 1DNCA 1RYIA 4H4RA 4LIIA 2V61A 4BJYA 2XDOA 2E81A 1DOEA 4Z43A 2RGOA 3GDNA 3II4A 4X9MA 3CGDA 3SQPA 4JNQA 2X50A 4GUVA 2BC0A 4YSYA 2YLTA 1ZX9A 1GESA 3AEDA 1GTEA 3G5SA 5JCKA 2JB3A 1PXBA 4YT0A 2XVIA 2Y6QA 4OPLA 4J36A 1F6MA 1VDCA 2WP9A 1KFYA 2C7GA 4H4YA 3AEGA 3RP8A 1DOBA 4L3ZA 2WU2A 3GD3A 3ICTA 4DNAA 5HY5A 2RGJA 1DOCA 3ICSA 4C77A 1GREA 1GOSA 1Y56B 4TLZA 3DJEA 1PS9A 1S3BA 1NAAA 1GTHA 3BNHA 1P2HA 1PBBA 5EB5A 5JCLA 1GALA 3BNGA 3EPTA 4KX6A 3S61A 4J56A 4ADWA 1IUSA 4YSXA 3DGZA 1Q1WA 2RABA 3H8LA 4Z2UA 3ZYXA 1M6IA 1B4VA 3AYJA 3VR9A 5BVAA 3GMBA 3SM8A 3LGQA 4H50A 5U63A 4EMIA 1D7YA 4JN9A 5M10A 3ABVA 2B9YA 4REKA 2EQ9A 1Y0PA 4ICYA 1D5TA 3KD9A 1COYA 2PYXA 4LU6A 1TDEA 3DK4A 4OCGA 5KRQA 4CRTA 1TDKA 3VR8A 3SCEA 4OPCA 2YLWA 3PO7A 1PBDA 3QSSA 4H2PA 4EMWA 4B66A 2IVEA 2BACA 2AR8A 1YQZA 3HZLA 3LOVA 3VRAA 1PDHA 3TTBA 1CC6A 1LTXR 2BK4A 3B3RA 1KNRA 3UCLA 4AT0A 5BRTA 1EL7A 3AEFA 3SFDA 3EF6A 2E5VA 2YLZA 2GB0A 3IC9A 1K4QA 4P9SA 4XWRA 4TM4A 2Y6RA 2XLRA 4H7UA 1D7LA 1E1NA 4JDRA 1PJ7A 4Z44A 5EOWA 4GDEA 3SGLA 5J60A 3I3LA 4UDPA 3T37A 2YWLA 3NG7X 3UTEA 2QA1A 4J34A 2OAMA 2CULA 4Y4LA 1NPXA 5EB4A 2GRTA 4K7ZA 3RNMA 5IQ4A 2OLOA 1IJHA 1YQ3A 2C67A 4YSHA 3WE0A 1OAHA 3DK9A 3UKPA 2YM1A 1LQUA 1DXLA 2WP6A 3AE9A 3G5QA 4Z2RA 4X9NA 2ZO5A 2VOUA 3AWIA 4A79A 4E0VA 2RGHA 3SFEA 2BC1A 2JB1A 2EQ7A 1F8WA 4B69A 3AD9B 1PN0A 3ATRA 3CTYA 5HXIA 3ZDNA 2DKIA 2WPFA 3GD4A 3CPHG 1JNRA 1BF3A 1NHRA 2I0ZA 3NN6X 2VRMA 2XFQA 1LV0A 3R9UA 2V3AA 3VQRA 1NHPA 3NYFA 5IPYA 1VRQB 1Q9IA 3OWMA 5FS7A 4BK1A 2YG7A 3UOXA 4XWZA 4K5SA 3NIXA 3UTFA 3KA7A 5U25A 1VG9A 1F8RA 1GV4A 3JSKA 1E39A 4FK1A 4H4SA 3LG1A 4WCTA 1M1PA 1LPFA 2CVJA 2YG6A 3ALMA 1XHCA 4U8OA 3QFBA 2GAHB 1OJTA 1YY5A 2XFNA 3CGEA 3QSMA 3UTGA 5KWFA 1CJ3A 3DJGX 2VR0A 1CJ2A 5KOWA 1H86A 3MMOA 1UKVG 4CBQA 1Y56A 3NRNA 1GETA 5EBKA 4U8NA 4Z24A 3K30A 2XLSA 4FDCB 3NYCA 1GSNA 2F5ZA 4EMJA 2YLRA 3CIRA 2R4JA 5KXJA 3KU9A 1EL9A 2WOVA 4KPRA 3AE6A 3EAOA 5U1OA 1H81A 4YKFA 4NTEA 1IUUA 4K2XA 2C66A 2IIDA 3NN0X 2K3VA 3GRSA 4J33A 1L0VA 4EQRA 2BXRA 2GAGB 3GWFA 3NNEA 3DA1A 3ICRA 3UKFA 3K7MX 2WHDA 3UP5A 4ECHA 2C3CA 1JNZA 2WEUA 3LJPA 5BULA 2C76A 3IWAA 3CPJG 4H4QA 1GEUA 4A6NA 4B63A 4CY8A 5JCMA 1KF6A 4LA1A 4OVIA 1NEKA 4OPUA 1K0LA 3NK1X 4M52A 4H2QA 2YVJA 3AD8B 1GRBA 1TDNA 2X8CA 1IUTA 1OJAA 4H2RA 4BV6A 3NLCA 2GV8A 2WBAA 3P1WA 1D4EA 4Q5CA 3BNMA 5KOXA 3TORA 2YLXA 4YWOA 1K0IA 4FX9A 4TLXA 4IVMB 5TR3A 1H84A 2BK3A 2X3NA 4ZCDA 3NYEA 4AP3A 2GR2A 1IUVA 4Q5BA 2WDVA 3AECA 1ZMDA 2WDQA 1LJ1A 4H4PA 1FS9A 1NDAA 1GRTA 2R45A 1DJQA 2QAEA 1ZOVA 3B6DA 5J7XA 1S2QA 3AE7A 1M1RA 1CF3A 1FEBA 2JB2A 3DK8A 3L8KA 4IVOB 2C75A 3DJDA 3S5WA 2ZZ0A 4A99A 2GMHA 1CC4A 2YQUA 2E80A 4B1BA 1IUWA 3UBRA 2V3BA 4UDRA 4B67A 4YKGA 3RKHA 4CY6A 5CQFA 4D03A 1GRFA 3Q6JA 2GQWA 4ZCCA 4EQXA 3ITJA 5C3JA 3O0HA 1N1PA 4FK1C 5HHFA 5IQ1A 3URHA 4L3YA 1E1MA 2E1MA 2OLNA 1PXCA 4IA6A 5C2TA 4A9WA 2GVCA 4U2LA 1MXTA 2R46A 2WP5A 1D4CA 3AE3A 2YG3A 1D4DA 4UDQA 4YSZA 3C4AA 3RHAA 2H88A 3UP4A 2APGA 3NH3X 1CBOA 2OALA 2HQMA 3AYIA 1B8SA 3L1RA 2OT4A 4JY2A 5FMHA 4H4VA 2WESA 3L1TA 1N4VA 3AEAA 3RP7A 4C3YA 1F3PA 4OPIA 3UKQA 3F8DA 2ARDA 3D1CA 1ZKQA 2Q0LA 1H7XA 3M13A 3P4RA 1GPEA 3FPZA 4WX1A 4Q17A 3FG2P 1M1QA 4A6NB 2C72A 2PHHA 4RG3A 2ZBWA 4Y4MA 2WU5A 3CPIG 3ISHA 4AOXA 4EM4A 1ELIA 3NK0X 3V3NA 2XCGA 4GRTA 1SEZA 3CGCA 3ALLA 3UOZA 3RP6A 3LZXA 2XVEA 1QO8A 2IVDA 2V6OA 1LVLA 1E1LA 2GR0A 1BZLA 1KSSA 4XXGA 4Z26A 3UKHA 1NENA 4TM1A 4I59A 1PBFA 1KNPA 1JEHA 2XVJA 1QDBA 4USRA 4OPTA 3H8IA 2TPRA 5JCNA 1BGJA 1EL5A 1F8SA 2BS4A 3GYXA 1GRHA 3GWDA 1GRAA 1M64A 1PBCA 4AOSA 4MJWA 1N4WA 3Q9TA 4GCMA 4J2WA 1BGNA 3F8PA 3CNSA 1H82A 4TM0A 4A5LA 4J31A 2YLSA 2B76A 2VVMA 4BK3A 1L9DA 2EQ6A 1X31B 1CJCA 2FJEA 4O5UA 1BWCA 2XLPA 2JKCA 1ZK7A 3LB8A 2JAEA 1E7PA 2X99A 1FCDA 2WPCA 2FJBA 1KDGA 4IV9A 2V60A
chains in the Genus database with same CATH superfamily
2AQJA 4RSLA 1W4XA 2AAQA 2WOIA 5FS6A 2BXSA 3VRDB 2BCPA 4IA5A 4O5QA 4GR1A 4U8LA 1FL2A 4C74A 2H89A 4B65A 4H4WA 3NTDA 2ACZA 3SYIA 2Z5YA 3P4QA 3M0OA 1TYTA 5HYMA 2R0GA 3CNPA 4DSHA 4APNA 3S7WA 4NTCA 1JRYA 4Z25A 2Q0KA 5BUKA 3GYJA 4U8PA 3G5RA 3KKJA 3K7TA 3IHMA 4NEVA 3QVRA 3BHFA 4JNAA 1TRBA 2C70A 3FIMB 1EL8A 1GU6A 1FECA 3E1TA 3P4PA 1DODA 2XFUA 1PJ6A 2Q6UA 3UOVA 5KVHA 2UZZA 5ER0A 3GRTA 2A8XA 2C3DA 1S3EA 3NKSA 5GRTA 4YTNA 2A89A 4NTDA 4HB9A 1GNDA 2V5ZA 4PAAA 3SZFA 3UKLA 2WETA 1Q1RA 1NHSA 1FEAA 3GMCA 2Z5XA 1H83A 4B64A 3UKAA 2GF3A 3AEEA 2FBWA 4G6HA 4A65A 2ZZBA 4CNJA 4D04A 2XFPA 1E6EA 1B5QA 1YKJA 2WQYA 3P4SA 4AP1A 1FS7A 2VQBA 3T0KA 1QLBA 2WS3A 5FS8A 3COXA 4EIPA 1IUXA 1L9CA 1JRXA 1O94A 3BHKA 2GR3A 4GAVA 2BK5A 3DMEA 3C96A 2C64A 2BCGG 4HA6A 2CFYA 4EIQA 4B68A 2LFCA 2DKHA 3SY4A 3LXDA 4G74A 1TDFA 2JBVA 2C73A 3KPFA 2C65A 3GM6A 1FT6A 1XDIA 2GR1A 2QCUA 5DBJA 4L3XA 3EANA 1ZY8A 4YXDA 4U2SA 1ZMCA 3CGBA 4U2TA 2VQ7A 3SZ0A 2YG5A 2NPXA 2XLTA 4U8JA 5KVIA 3K7QX 1BVBA 1SP3A 2EQ8A 1OJDA 3REDA 3NGCX 4BK2A 2B9WA 3KVEA 4RG4A 4BJZA 1VG0A 2XFOA 1TYPA 2YM2A 1K0JA 2XLUA 3FMWA 5KNLA 2YR5A 3QVPA 3PVCA 3SZCA 1L9EA 2R4EA 3CNJA 1ZP0A 4J57A 2CDUA 3AEBA 3FBSA 4C5OA 1ZOYA 3CN8A 4H4UA 2BYBA 2YAUA 2JK6A 3VRBA 2RF7A 1GERA 2QA2A 4U8IA 4UP3A 4I58A 4Y4NA 1V59A 3AB1A 1ONFA 1JOAA 3T2KA 2GMJA 4C3XA 2X8GA 1O95A 3SZWA 4AT2A 2Q7VA 1QJDA 2YVFA 3AE4A 2B7SA 4WJYA 1CHUA 3NTAA 4H4TA 4OPGA 3T2YA 4G6GA 3V76A 4OPDA 4U8MA 4Q1OA 4YTMA 1NG4A 5M0ZA 1RP0A 4GF7A 5GSNA 3UKKA 1Z6LA 2XYOA 1XANA 3P9UA 1CL0A 3SXQA 1S2YA 4Q4UA 3GDPA 4H2NA 2BA9A 2GEWA 3LADA 2R0PA 3DH9A 1FOHA 3F8RA 4CCRA 4JY3A 1KSUA 4K5RA 2VZ2A 4BURA 1BKWA 1RSGA 2J3NA 4TM3A 3V3OA 1JNIA 1GRGA 1PJ5A 2YG4A 2R0CA 1EBDA 3LZWA 2BRYA 5JCIA 4EM3A 3KLJA 1E1KA 3QSEA 4K22A 1MO9A 3H4KA 3BI4A 4YTPA 3QFAA 3ALJA 1B37A 2O9ZA 2RDZA 1TDOA 4GDPA 2W0HA 3PS9A 4K8DA 3M12A 5CKUA 1JRZA 1XPQA 3I6DA 3C4NA 1VQWA 2VVLG 4DGKA 2OA1A 2BS2A 1LQTA 1H7WA 2R9ZA 3D8XA 2GH5A 2FJDA 1CJ4A 4NWZA 4U8KA 3D1IA 3GYIA 1REOA 1P2EA 1O5WA 2ZZCA 1CC2A 2WPEA 2XVFA 4X4JA 5L46A 3BNFA 3AE5A 1PXAA 1H6VA 3OZ2A 4JQ9A 1YQ4A 3BNUA 3ATQA 3DJJA 3CNTA 3CNDA 2A87A 3GSIA 1N4UA 4NZHA 4EQWA 2GQFA 2TMDA 3NT6A 4NEWA 1AOGA 2WDRA 4PABA 4CNKA 4GAPA 3AXBA 2YR6A 1ZDLA 2J7AA 3BNJA 1OJ9A 2E4GA 3ADAB 4L38A 4DSGA 3FO3A 3BI2A 3UOYA 3NK2X 4H4ZA 2XVHA 3IF9A 5FS9A 1FT5A 1DJNA 4N9XA 1HYUA 1GXFA 2BABA 4USQA 1PBEA 2NVKX 3T2ZA 2BS3A 2YR4A 3AD7B 2X8HA 1GT8A 3HYWA 3DGHA 4CCQA 1PHHA 4EQSA 4II3A 4A7AA 4Q0TA 4II2A 3AE1A 2B9XA 3IHGA 3QJ4A 3BI5A 1OJCA 3AE8A 5LV9A 3NHOX 4H4XA 2VRLA 2FJAA 4ZN0A 1NHQA 2B7RA 3UU9A 1FS8A 2WOWA 3UTHA 1JU2A 1NG3A 3F29A 2VVLA 3AYLA 2YVGA 3OC4A 1MOKA 3AE2A 1DNCA 1RYIA 4H4RA 4LIIA 2V61A 4BJYA 2XDOA 2E81A 1DOEA 4Z43A 2RGOA 3GDNA 3II4A 4X9MA 3CGDA 3SQPA 4JNQA 2X50A 4GUVA 2BC0A 5KMQA 4YSYA 2YLTA 1ZX9A 1GESA 3AEDA 1GTEA 3G5SA 5JCKA 2JB3A 1PXBA 4YT0A 2XVIA 2C4CA 2Y6QA 4J36A 1F6MA 4OPLA 1VDCA 2WP9A 1KFYA 2C7GA 4H4YA 3AEGA 3RP8A 1DOBA 4L3ZA 2WU2A 3GD3A 3ICTA 4DNAA 5KMPA 5HY5A 2RGJA 1DOCA 3ICSA 4C77A 1GREA 4Z2TA 1GOSA 1Y56B 4TLZA 3DJEA 1PS9A 1S3BA 1NAAA 1GTHA 3BNHA 3HYXA 1P2HA 1PBBA 5EB5A 5JCLA 1GALA 3BNGA 3EPTA 4KX6A 3S61A 4J56A 4ADWA 1IUSA 4YSXA 3DGZA 1Q1WA 2RABA 3H8LA 4Z2UA 3ZYXA 1M6IA 1B4VA 3AYJA 3VR9A 5BVAA 3GMBA 3SM8A 3LGQA 4H50A 5U63A 4EMIA 1D7YA 4JN9A 5M10A 3ABVA 2B9YA 4REKA 2EQ9A 1Y0PA 4ICYA 3KPKA 1D5TA 3KD9A 1COYA 2PYXA 4LU6A 1TDEA 3DK4A 4OCGA 5KRQA 4CRTA 1TDKA 3VR8A 3SCEA 4OPCA 2YLWA 3PO7A 1PBDA 3QSSA 4H2PA 4EMWA 4B66A 2IVEA 2BACA 2AR8A 1YQZA 3HZLA 3LOVA 5KMSA 3VRAA 1PDHA 3TTBA 1CC6A 1LTXR 2BK4A 3B3RA 1KNRA 3UCLA 4AT0A 5BRTA 1EL7A 3AEFA 3SFDA 3EF6A 2E5VA 2YLZA 2GB0A 3IC9A 1K4QA 4P9SA 4XWRA 4TM4A 2Y6RA 2XLRA 4H7UA 1D7LA 1E1NA 4JDRA 1PJ7A 4Z44A 5EOWA 4GDEA 3SGLA 5J60A 3I3LA 4UDPA 3T37A 2YWLA 3NG7X 3UTEA 2QA1A 4J34A 2OAMA 2CULA 4Y4LA 1NPXA 5EB4A 2GRTA 4K7ZA 3RNMA 5IQ4A 2OLOA 1IJHA 1YQ3A 2C67A 4YSHA 3WE0A 1OAHA 3DK9A 3UKPA 2YM1A 1LQUA 1DXLA 2WP6A 3AE9A 3G5QA 4Z2RA 4X9NA 2ZO5A 2VOUA 3AWIA 4A79A 4E0VA 2RGHA 3SFEA 2BC1A 2JB1A 2EQ7A 1F8WA 4B69A 2BRAA 3AD9B 1PN0A 3ATRA 3CTYA 5HXIA 3ZDNA 2DKIA 2WPFA 3GD4A 3CPHG 1JNRA 1BF3A 1NHRA 2I0ZA 3NN6X 2VRMA 2XFQA 1LV0A 3R9UA 2V3AA 3VQRA 1NHPA 3NYFA 5IPYA 1VRQB 1Q9IA 3OWMA 5FS7A 4BK1A 2YG7A 3UOXA 4XWZA 4K5SA 3NIXA 3UTFA 3KA7A 5U25A 1VG9A 1F8RA 1GV4A 3JSKA 1E39A 4FK1A 4H4SA 3LG1A 4WCTA 1M1PA 1LPFA 2CVJA 2YG6A 3ALMA 1XHCA 4U8OA 3QFBA 2GAHB 1OJTA 1YY5A 2XFNA 3CGEA 3QSMA 3UTGA 5KWFA 1CJ3A 3DJGX 2VR0A 1CJ2A 5KOWA 1H86A 3MMOA 1UKVG 3T31A 4CBQA 1Y56A 3NRNA 1GETA 5EBKA 4U8NA 3SX6A 4Z24A 3K30A 2XLSA 4FDCB 3NYCA 1GSNA 2F5ZA 4EMJA 2YLRA 3CIRA 2R4JA 5KXJA 3KU9A 1EL9A 2WOVA 4KPRA 3AE6A 3EAOA 5U1OA 1H81A 4YKFA 4NTEA 1IUUA 4K2XA 2C66A 2IIDA 3NN0X 2K3VA 3GRSA 4J33A 1L0VA 4EQRA 2BXRA 2GAGB 3GWFA 3NNEA 3DA1A 3ICRA 3UKFA 3K7MX 2WHDA 3UP5A 4ECHA 2C3CA 1JNZA 2WEUA 3LJPA 5BULA 2C76A 3IWAA 3CPJG 4H4QA 1GEUA 4A6NA 4B63A 4CY8A 5JCMA 1KF6A 4LA1A 4OVIA 1NEKA 4OPUA 1K0LA 3NK1X 4M52A 4H2QA 2YVJA 3AD8B 1GRBA 1TDNA 2X8CA 1IUTA 1OJAA 4H2RA 4BV6A 3NLCA 2GV8A 2WBAA 3P1WA 1D4EA 4Q5CA 3BNMA 5KOXA 3TORA 2YLXA 4YWOA 1K0IA 4FX9A 4TLXA 4IVMB 5KMRA 5TR3A 1H84A 2BK3A 2X3NA 4NNJA 4ZCDA 3NYEA 4AP3A 2GR2A 1IUVA 4Q5BA 2WDVA 3AECA 1ZMDA 2WDQA 1LJ1A 4H4PA 1FS9A 1NDAA 1GRTA 2R45A 1DJQA 2QAEA 1ZOVA 3B6DA 5J7XA 1S2QA 3AE7A 1M1RA 1CF3A 1FEBA 2JB2A 3DK8A 3L8KA 4IVOB 2C75A 3DJDA 3S5WA 2ZZ0A 4A99A 2GMHA 1CC4A 2YQUA 2E80A 4B1BA 1IUWA 3UBRA 2V3BA 4UDRA 4B67A 4YKGA 3RKHA 4CY6A 5CQFA 4D03A 1GRFA 3Q6JA 2GQWA 4ZCCA 4EQXA 4G73A 3ITJA 5C3JA 3O0HA 1N1PA 4FK1C 5HHFA 5IQ1A 3URHA 4L3YA 1E1MA 2E1MA 2OLNA 1PXCA 4IA6A 5C2TA 4A9WA 2GVCA 4U2LA 1MXTA 2R46A 2WP5A 1D4CA 2CZSA 3AE3A 2YG3A 1D4DA 4UDQA 4YSZA 3C4AA 3RHAA 2H88A 3UP4A 2APGA 3NH3X 1CBOA 2OALA 2HQMA 3AYIA 1B8SA 3L1RA 2OT4A 3CMMA 4JY2A 5FMHA 4H4VA 2WESA 3L1TA 1N4VA 3AEAA 3RP7A 4C3YA 1F3PA 4OPIA 3UKQA 3F8DA 4G9KA 2ARDA 3D1CA 1ZKQA 2Q0LA 1H7XA 3M13A 3P4RA 1GPEA 3FPZA 4WX1A 4Q17A 3FG2P 1M1QA 3T14A 2C72A 4A6NB 2PHHA 4RG3A 2ZBWA 4Y4MA 2WU5A 3CPIG 3ISHA 4AOXA 4EM4A 1ELIA 3NK0X 3V3NA 2XCGA 4GRTA 1SEZA 3CGCA 3ALLA 3UOZA 3RP6A 3LZXA 2XVEA 1QO8A 2IVDA 2V6OA 1LVLA 1E1LA 2GR0A 1BZLA 1KSSA 4XXGA 4Z26A 3UKHA 1NENA 4TM1A 4I59A 1PBFA 1KNPA 1JEHA 2XVJA 1QDBA 4USRA 4OPTA 3H8IA 2TPRA 5JCNA 1BGJA 1EL5A 1F8SA 2BS4A 3GYXA 1GRHA 3GWDA 1GRAA 1M64A 1PBCA 4AOSA 4MJWA 1N4WA 3Q9TA 4GCMA 4J2WA 1BGNA 3F8PA 3CNSA 1H82A 4TM0A 4A5LA 4J31A 2YLSA 2B76A 2VVMA 4BK3A 1L9DA 2EQ6A 1X31B 1CJCA 2FJEA 4O5UA 1BWCA 2XLPA 2JKCA 1ZK7A 3HYVA 3LB8A 2JAEA 1E7PA 3SXIA 2X99A 1FCDA 2WPCA 2FJBA 1KDGA 4IV9A 2V60A
chains in the Genus database with same CATH topology
2AQJA 4RSLA 1W4XA 2AAQA 2WOIA 5FS6A 2BXSA 3VRDB 2BCPA 4IA5A 4O5QA 4GR1A 4U8LA 1FL2A 4C74A 2H89A 4B65A 4H4WA 3NTDA 2ACZA 3SYIA 2Z5YA 3P4QA 3M0OA 1TYTA 5HYMA 2R0GA 3CNPA 4DSHA 4APNA 3S7WA 4NTCA 1JRYA 4Z25A 2Q0KA 5BUKA 3GYJA 4U8PA 3G5RA 3KKJA 3K7TA 3IHMA 4NEVA 3QVRA 3BHFA 4JNAA 1TRBA 2C70A 3FIMB 1EL8A 1GU6A 1FECA 3E1TA 3P4PA 1DODA 2XFUA 1PJ6A 2Q6UA 3UOVA 5KVHA 2UZZA 5ER0A 3GRTA 2A8XA 2C3DA 1S3EA 3NKSA 5GRTA 4YTNA 2A89A 4NTDA 4HB9A 1GNDA 2V5ZA 4PAAA 3SZFA 3UKLA 2WETA 1Q1RA 1NHSA 1FEAA 3GMCA 2Z5XA 1H83A 4B64A 3UKAA 2GF3A 3AEEA 2FBWA 4G6HA 4A65A 2ZZBA 4CNJA 4D04A 2XFPA 1E6EA 1B5QA 1YKJA 2WQYA 3P4SA 4AP1A 1FS7A 2VQBA 3T0KA 1QLBA 2WS3A 5FS8A 3COXA 4EIPA 1IUXA 1L9CA 1JRXA 1O94A 3BHKA 2GR3A 4GAVA 2BK5A 3DMEA 3C96A 2C64A 2BCGG 4HA6A 2CFYA 4EIQA 4B68A 2LFCA 2DKHA 3SY4A 3LXDA 4G74A 1TDFA 2JBVA 2C73A 3KPFA 2C65A 3GM6A 1FT6A 1XDIA 2GR1A 2QCUA 5DBJA 4L3XA 3EANA 1ZY8A 4YXDA 4U2SA 1ZMCA 3CGBA 4U2TA 2VQ7A 3SZ0A 2YG5A 2NPXA 2XLTA 4U8JA 5KVIA 3K7QX 1BVBA 1SP3A 2EQ8A 1OJDA 3REDA 3NGCX 4BK2A 2B9WA 3KVEA 4RG4A 4BJZA 1VG0A 2XFOA 1TYPA 2YM2A 1K0JA 2XLUA 3FMWA 5KNLA 2YR5A 3QVPA 3PVCA 3SZCA 1L9EA 2R4EA 3CNJA 1ZP0A 4J57A 2CDUA 3AEBA 3FBSA 4C5OA 1ZOYA 3CN8A 4H4UA 2BYBA 2YAUA 2JK6A 3VRBA 2RF7A 1GERA 2QA2A 4U8IA 4UP3A 4I58A 4Y4NA 1V59A 3AB1A 1ONFA 1JOAA 3T2KA 2GMJA 4C3XA 2X8GA 1O95A 3SZWA 4AT2A 2Q7VA 1QJDA 2YVFA 3AE4A 2B7SA 4WJYA 1CHUA 3NTAA 4H4TA 4OPGA 3T2YA 4G6GA 3V76A 4OPDA 4U8MA 4Q1OA 4YTMA 1NG4A 5M0ZA 1RP0A 4GF7A 5GSNA 3UKKA 1Z6LA 2XYOA 1XANA 3P9UA 1CL0A 3SXQA 1S2YA 4Q4UA 3GDPA 4H2NA 2BA9A 2GEWA 3LADA 2R0PA 3DH9A 1FOHA 3F8RA 4CCRA 4JY3A 1KSUA 4K5RA 2VZ2A 4BURA 1BKWA 1RSGA 2J3NA 4TM3A 3V3OA 1JNIA 1GRGA 1PJ5A 2YG4A 2R0CA 1EBDA 3LZWA 2BRYA 5JCIA 4EM3A 3KLJA 1E1KA 3QSEA 4K22A 1MO9A 3H4KA 3BI4A 4YTPA 3QFAA 3ALJA 1B37A 2O9ZA 2RDZA 1TDOA 4GDPA 2W0HA 3PS9A 4K8DA 3M12A 5CKUA 1JRZA 1XPQA 3I6DA 3C4NA 1VQWA 2VVLG 4DGKA 2OA1A 2BS2A 1LQTA 1H7WA 2R9ZA 3D8XA 2GH5A 2FJDA 1CJ4A 4NWZA 4U8KA 3D1IA 3GYIA 1REOA 1P2EA 1O5WA 2ZZCA 1CC2A 2WPEA 2XVFA 4X4JA 5L46A 3BNFA 3AE5A 1PXAA 1H6VA 3OZ2A 4JQ9A 1YQ4A 3BNUA 3ATQA 3DJJA 3CNTA 3CNDA 2A87A 3GSIA 1N4UA 4NZHA 4EQWA 2GQFA 2TMDA 3NT6A 4NEWA 1AOGA 2WDRA 4PABA 4CNKA 4GAPA 3AXBA 2YR6A 1ZDLA 2J7AA 3BNJA 1OJ9A 2E4GA 3ADAB 4L38A 4DSGA 3FO3A 3BI2A 3UOYA 3NK2X 4H4ZA 2XVHA 3IF9A 5FS9A 1FT5A 1DJNA 4N9XA 1HYUA 1GXFA 2BABA 4USQA 1PBEA 2NVKX 3T2ZA 2BS3A 2YR4A 3AD7B 2X8HA 1GT8A 3HYWA 3DGHA 4CCQA 1PHHA 4EQSA 4II3A 4A7AA 4Q0TA 4II2A 3AE1A 2B9XA 3IHGA 3QJ4A 3BI5A 1OJCA 3AE8A 5LV9A 3NHOX 4H4XA 2VRLA 2FJAA 4ZN0A 1NHQA 2B7RA 3UU9A 1FS8A 2WOWA 3UTHA 1JU2A 1NG3A 3F29A 2VVLA 3AYLA 2YVGA 3OC4A 1MOKA 3AE2A 1DNCA 1RYIA 4H4RA 4LIIA 2V61A 4BJYA 2XDOA 2E81A 1DOEA 4Z43A 2RGOA 3GDNA 3II4A 4X9MA 3CGDA 3SQPA 4JNQA 2X50A 4GUVA 2BC0A 5KMQA 4YSYA 2YLTA 1ZX9A 1GESA 3AEDA 1GTEA 3G5SA 5JCKA 2JB3A 1PXBA 4YT0A 2XVIA 2C4CA 2Y6QA 4J36A 1F6MA 4OPLA 1VDCA 2WP9A 1KFYA 2C7GA 4H4YA 3AEGA 3RP8A 1DOBA 4L3ZA 2WU2A 3GD3A 3ICTA 4DNAA 5KMPA 5HY5A 2RGJA 1DOCA 3ICSA 4C77A 1GREA 4Z2TA 1GOSA 1Y56B 4TLZA 3DJEA 1PS9A 1S3BA 1NAAA 1GTHA 3BNHA 3HYXA 1P2HA 1PBBA 5EB5A 5JCLA 1GALA 3BNGA 3EPTA 4KX6A 3S61A 4J56A 4ADWA 1IUSA 4YSXA 3DGZA 1Q1WA 2RABA 3H8LA 4Z2UA 3ZYXA 1M6IA 1B4VA 3AYJA 3VR9A 5BVAA 3GMBA 3SM8A 3LGQA 4H50A 5U63A 4EMIA 1D7YA 4JN9A 5M10A 3ABVA 2B9YA 4REKA 2EQ9A 1Y0PA 4ICYA 3KPKA 1D5TA 3KD9A 1COYA 2PYXA 4LU6A 1TDEA 3DK4A 4OCGA 5KRQA 4CRTA 1TDKA 3VR8A 3SCEA 4OPCA 2YLWA 3PO7A 1PBDA 3QSSA 4H2PA 4EMWA 4B66A 2IVEA 2BACA 2AR8A 1YQZA 3HZLA 3LOVA 5KMSA 3VRAA 1PDHA 3TTBA 1CC6A 1LTXR 2BK4A 3B3RA 1KNRA 3UCLA 4AT0A 5BRTA 1EL7A 3AEFA 3SFDA 3EF6A 2E5VA 2YLZA 2GB0A 3IC9A 1K4QA 4P9SA 4XWRA 4TM4A 2Y6RA 2XLRA 4H7UA 1D7LA 1E1NA 4JDRA 1PJ7A 4Z44A 5EOWA 4GDEA 3SGLA 5J60A 3I3LA 4UDPA 3T37A 2YWLA 3NG7X 3UTEA 2QA1A 4J34A 2OAMA 2CULA 4Y4LA 1NPXA 5EB4A 2GRTA 4K7ZA 3RNMA 5IQ4A 2OLOA 1IJHA 1YQ3A 2C67A 4YSHA 3WE0A 1OAHA 3DK9A 3UKPA 2YM1A 1LQUA 1DXLA 2WP6A 3AE9A 3G5QA 4Z2RA 4X9NA 2ZO5A 2VOUA 3AWIA 4A79A 4E0VA 2RGHA 3SFEA 2BC1A 2JB1A 2EQ7A 1F8WA 4B69A 2BRAA 3AD9B 1PN0A 3ATRA 3CTYA 5HXIA 3ZDNA 2DKIA 2WPFA 3GD4A 3CPHG 1JNRA 1BF3A 1NHRA 2I0ZA 3NN6X 2VRMA 2XFQA 1LV0A 3R9UA 2V3AA 3VQRA 1NHPA 3NYFA 5IPYA 1VRQB 1Q9IA 3OWMA 5FS7A 4BK1A 2YG7A 3UOXA 4XWZA 4K5SA 3NIXA 3UTFA 3KA7A 5U25A 1VG9A 1F8RA 1GV4A 3JSKA 1E39A 4FK1A 4H4SA 3LG1A 4WCTA 1M1PA 1LPFA 2CVJA 2YG6A 3ALMA 1XHCA 4U8OA 3QFBA 2GAHB 1OJTA 1YY5A 2XFNA 3CGEA 3QSMA 3UTGA 5KWFA 1CJ3A 3DJGX 2VR0A 1CJ2A 5KOWA 1H86A 3MMOA 1UKVG 3T31A 4CBQA 1Y56A 3NRNA 1GETA 5EBKA 4U8NA 3SX6A 4Z24A 3K30A 2XLSA 4FDCB 3NYCA 1GSNA 2F5ZA 4EMJA 2YLRA 3CIRA 2R4JA 5KXJA 3KU9A 1EL9A 2WOVA 4KPRA 3AE6A 3EAOA 5U1OA 1H81A 4YKFA 4NTEA 1IUUA 4K2XA 2C66A 2IIDA 3NN0X 2K3VA 3GRSA 4J33A 1L0VA 4EQRA 2BXRA 2GAGB 3GWFA 3NNEA 3DA1A 3ICRA 3UKFA 3K7MX 2WHDA 3UP5A 4ECHA 2C3CA 1JNZA 2WEUA 3LJPA 5BULA 2C76A 3IWAA 3CPJG 4H4QA 1GEUA 4A6NA 4B63A 4CY8A 5JCMA 1KF6A 4LA1A 4OVIA 1NEKA 4OPUA 1K0LA 3NK1X 4M52A 4H2QA 2YVJA 3AD8B 1GRBA 1TDNA 2X8CA 1IUTA 1OJAA 4H2RA 4BV6A 3NLCA 2GV8A 2WBAA 3P1WA 1D4EA 4Q5CA 3BNMA 5KOXA 3TORA 2YLXA 4YWOA 1K0IA 4FX9A 4TLXA 4IVMB 5KMRA 5TR3A 1H84A 2BK3A 2X3NA 4NNJA 4ZCDA 3NYEA 4AP3A 2GR2A 1IUVA 4Q5BA 2WDVA 3AECA 1ZMDA 2WDQA 1LJ1A 4H4PA 1FS9A 1NDAA 1GRTA 2R45A 1DJQA 2QAEA 1ZOVA 3B6DA 5J7XA 1S2QA 3AE7A 1M1RA 1CF3A 1FEBA 2JB2A 3DK8A 3L8KA 4IVOB 2C75A 3DJDA 3S5WA 2ZZ0A 4A99A 2GMHA 1CC4A 2YQUA 2E80A 4B1BA 1IUWA 3UBRA 2V3BA 4UDRA 4B67A 4YKGA 3RKHA 4CY6A 5CQFA 4D03A 1GRFA 3Q6JA 2GQWA 4ZCCA 4EQXA 4G73A 3ITJA 5C3JA 3O0HA 1N1PA 4FK1C 5HHFA 5IQ1A 3URHA 4L3YA 1E1MA 2E1MA 2OLNA 1PXCA 4IA6A 5C2TA 4A9WA 2GVCA 4U2LA 1MXTA 2R46A 2WP5A 1D4CA 3AE3A 2YG3A 1D4DA 4UDQA 4YSZA 3C4AA 3RHAA 2H88A 3UP4A 2APGA 3NH3X 1CBOA 2OALA 2HQMA 3AYIA 1B8SA 3L1RA 2OT4A 3CMMA 4JY2A 5FMHA 4H4VA 2WESA 3L1TA 1N4VA 3AEAA 3RP7A 4C3YA 1F3PA 4OPIA 3UKQA 3F8DA 4G9KA 2ARDA 3D1CA 1ZKQA 2Q0LA 1H7XA 3M13A 3P4RA 1GPEA 3FPZA 4WX1A 4Q17A 3FG2P 1M1QA 3T14A 2C72A 4A6NB 2PHHA 4RG3A 2ZBWA 4Y4MA 2WU5A 3CPIG 3ISHA 4AOXA 4EM4A 1ELIA 3NK0X 3V3NA 2XCGA 4GRTA 1SEZA 3CGCA 3ALLA 3UOZA 3RP6A 3LZXA 2XVEA 1QO8A 2IVDA 2V6OA 1LVLA 1E1LA 2GR0A 1BZLA 1KSSA 4XXGA 4Z26A 3UKHA 1NENA 4TM1A 4I59A 1PBFA 1KNPA 1JEHA 2XVJA 1QDBA 4USRA 4OPTA 3H8IA 2TPRA 5JCNA 1BGJA 1EL5A 1F8SA 2BS4A 3GYXA 1GRHA 3GWDA 1GRAA 1M64A 1PBCA 4AOSA 4MJWA 1N4WA 3Q9TA 4GCMA 4J2WA 1BGNA 3F8PA 3CNSA 1H82A 4TM0A 4A5LA 4J31A 2YLSA 2B76A 2VVMA 4BK3A 1L9DA 2EQ6A 1X31B 1CJCA 2FJEA 4O5UA 1BWCA 2XLPA 2JKCA 1ZK7A 3HYVA 3LB8A 2JAEA 1E7PA 3SXIA 2X99A 1FCDA 2WPCA 2FJBA 1KDGA 4IV9A 2V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQJ A;  4RSL A;  1W4X A;  2AAQ A;  2WOI A;  5FS6 A;  2BXS A;  3VRD B;  2BCP A;  4IA5 A;  4O5Q A;  4GR1 A;  4U8L A;  1FL2 A;  4C74 A;  2H89 A;  4B65 A;  4H4W A;  3NTD A;  2ACZ A;  2Z5Y A;  3P4Q A;  3M0O A;  1TYT A;  5HYM A;  2R0G A;  3CNP A;  4DSH A;  4APN A;  3S7W A;  4NTC A;  1JRY A;  4Z25 A;  2Q0K A;  5BUK A;  3GYJ A;  4U8P A;  3G5R A;  3KKJ A;  3K7T A;  3IHM A;  4NEV A;  3QVR A;  3BHF A;  4JNA A;  1TRB A;  2C70 A;  3FIM B;  1EL8 A;  1GU6 A;  1FEC A;  3E1T A;  3P4P A;  1DOD A;  2XFU A;  1PJ6 A;  2Q6U A;  3UOV A;  5KVH A;  2UZZ A;  5ER0 A;  3GRT A;  2A8X A;  2C3D A;  1S3E A;  3NKS A;  5GRT A;  4YTN A;  2A89 A;  4NTD A;  4HB9 A;  1GND A;  2V5Z A;  4PAA A;  3UKL A;  2WET A;  1Q1R A;  1NHS A;  1FEA A;  3GMC A;  2Z5X A;  1H83 A;  4B64 A;  3UKA A;  2GF3 A;  3AEE A;  2FBW A;  4A65 A;  2ZZB A;  4CNJ A;  4D04 A;  2XFP A;  1E6E A;  1B5Q A;  1YKJ A;  2WQY A;  3P4S A;  4AP1 A;  1FS7 A;  2VQB A;  1QLB A;  2WS3 A;  5FS8 A;  3COX A;  4EIP A;  1IUX A;  1L9C A;  1JRX A;  1O94 A;  3BHK A;  2GR3 A;  2BK5 A;  3DME A;  3C96 A;  2C64 A;  2BCG G;  4HA6 A;  2CFY A;  4EIQ A;  4B68 A;  2LFC A;  2DKH A;  3LXD A;  1TDF A;  2JBV A;  2C73 A;  3KPF A;  2C65 A;  3GM6 A;  1FT6 A;  1XDI A;  2GR1 A;  2QCU A;  5DBJ A;  4L3X A;  3EAN A;  1ZY8 A;  4YXD A;  4U2S A;  1ZMC A;  3CGB A;  4U2T A;  2VQ7 A;  2YG5 A;  2NPX A;  2XLT A;  4U8J A;  5KVI A;  3K7Q X;  1BVB A;  1SP3 A;  2EQ8 A;  1OJD A;  3RED A;  3NGC X;  4BK2 A;  2B9W A;  3KVE A;  4RG4 A;  4BJZ A;  1VG0 A;  2XFO A;  1TYP A;  2YM2 A;  1K0J A;  2XLU A;  3FMW A;  2YR5 A;  3QVP A;  3PVC A;  1L9E A;  2R4E A;  3CNJ A;  1ZP0 A;  4J57 A;  2CDU A;  3AEB A;  3FBS A;  4C5O A;  1ZOY A;  3CN8 A;  4H4U A;  2BYB A;  2YAU A;  2JK6 A;  3VRB A;  2RF7 A;  1GER A;  2QA2 A;  4U8I A;  4UP3 A;  4I58 A;  4Y4N A;  1V59 A;  3AB1 A;  1ONF A;  1JOA A;  2GMJ A;  4C3X A;  2X8G A;  1O95 A;  4AT2 A;  2Q7V A;  1QJD A;  2YVF A;  3AE4 A;  2B7S A;  4WJY A;  1CHU A;  3NTA A;  4H4T A;  4OPG A;  3V76 A;  4Z2T A;  4OPD A;  4U8M A;  4Q1O A;  4YTM A;  1NG4 A;  5M0Z A;  1RP0 A;  4GF7 A;  5GSN A;  3UKK A;  1Z6L A;  2XYO A;  1XAN A;  3P9U A;  1CL0 A;  3SXQ A;  1S2Y A;  4Q4U A;  3GDP A;  4H2N A;  2BA9 A;  2GEW A;  3LAD A;  2R0P A;  3DH9 A;  1FOH A;  3F8R A;  4CCR A;  4JY3 A;  1KSU A;  4K5R A;  2VZ2 A;  4BUR A;  1BKW A;  1RSG A;  2J3N A;  4TM3 A;  3V3O A;  1JNI A;  1GRG A;  1PJ5 A;  2YG4 A;  2R0C A;  1EBD A;  3LZW A;  5JCI A;  4EM3 A;  3KLJ A;  1E1K A;  3QSE A;  4K22 A;  1MO9 A;  3H4K A;  3BI4 A;  4YTP A;  3QFA A;  3ALJ A;  1B37 A;  2O9Z A;  2RDZ A;  1TDO A;  4GDP A;  2W0H A;  3PS9 A;  4K8D A;  3M12 A;  5CKU A;  1JRZ A;  1XPQ A;  3I6D A;  3C4N A;  1VQW A;  2VVL G;  4DGK A;  2OA1 A;  2BS2 A;  1LQT A;  1H7W A;  2R9Z A;  3D8X A;  2GH5 A;  2FJD A;  1CJ4 A;  4U8K A;  3D1I A;  3GYI A;  1REO A;  1P2E A;  1O5W A;  2ZZC A;  1CC2 A;  2WPE A;  2XVF A;  4X4J A;  5L46 A;  3BNF A;  3AE5 A;  1PXA A;  1H6V A;  3OZ2 A;  4JQ9 A;  1YQ4 A;  3BNU A;  3ATQ A;  3DJJ A;  3CNT A;  3CND A;  2A87 A;  3GSI A;  1N4U A;  4NZH A;  4EQW A;  2GQF A;  2TMD A;  3NT6 A;  4NEW A;  1AOG A;  2WDR A;  4PAB A;  4CNK A;  3AXB A;  2YR6 A;  1ZDL A;  2J7A A;  3BNJ A;  1OJ9 A;  2E4G A;  3ADA B;  4L38 A;  4DSG A;  3FO3 A;  3BI2 A;  3UOY A;  3NK2 X;  4H4Z A;  2XVH A;  3IF9 A;  5FS9 A;  1FT5 A;  1DJN A;  4N9X A;  1HYU A;  1GXF A;  2BAB A;  4USQ A;  1PBE A;  2NVK X;  2BS3 A;  2YR4 A;  3AD7 B;  2X8H A;  1GT8 A;  3DGH A;  4CCQ A;  1PHH A;  4EQS A;  4A7A A;  4Q0T A;  3AE1 A;  2B9X A;  3IHG A;  3QJ4 A;  3BI5 A;  1OJC A;  3AE8 A;  5LV9 A;  3NHO X;  4H4X A;  2VRL A;  2FJA A;  4ZN0 A;  1NHQ A;  2B7R A;  3UU9 A;  1FS8 A;  2WOW A;  3UTH A;  1JU2 A;  1NG3 A;  3F29 A;  2VVL A;  3AYL A;  2YVG A;  3OC4 A;  1MOK A;  3AE2 A;  1DNC A;  1RYI A;  4H4R A;  4LII A;  2V61 A;  4BJY A;  2XDO A;  2E81 A;  1DOE A;  4Z43 A;  2RGO A;  3GDN A;  3II4 A;  4X9M A;  3CGD A;  3SQP A;  4JNQ A;  2X50 A;  4GUV A;  2BC0 A;  4YSY A;  2YLT A;  1ZX9 A;  1GES A;  3AED A;  1GTE A;  3G5S A;  5JCK A;  2JB3 A;  1PXB A;  4YT0 A;  2XVI A;  2Y6Q A;  4OPL A;  4J36 A;  1F6M A;  1VDC A;  2WP9 A;  1KFY A;  2C7G A;  4H4Y A;  3AEG A;  3RP8 A;  1DOB A;  4L3Z A;  2WU2 A;  3GD3 A;  3ICT A;  4DNA A;  5HY5 A;  2RGJ A;  1DOC A;  3ICS A;  4C77 A;  1GRE A;  1GOS A;  1Y56 B;  4TLZ A;  3DJE A;  1PS9 A;  1S3B A;  1NAA A;  1GTH A;  3BNH A;  1P2H A;  1PBB A;  5EB5 A;  5JCL A;  1GAL A;  3BNG A;  3EPT A;  4KX6 A;  3S61 A;  4J56 A;  4ADW A;  1IUS A;  4YSX A;  3DGZ A;  1Q1W A;  2RAB A;  3H8L A;  4Z2U A;  3ZYX A;  1M6I A;  1B4V A;  3AYJ A;  3VR9 A;  5BVA A;  3GMB A;  3SM8 A;  3LGQ A;  4H50 A;  5U63 A;  4EMI A;  1D7Y A;  4JN9 A;  5M10 A;  3ABV A;  2B9Y A;  4REK A;  2EQ9 A;  1Y0P A;  4ICY A;  1D5T A;  3KD9 A;  1COY A;  2PYX A;  4LU6 A;  1TDE A;  3DK4 A;  4OCG A;  5KRQ A;  4CRT A;  1TDK A;  3VR8 A;  3SCE A;  4OPC A;  2YLW A;  3PO7 A;  1PBD A;  3QSS A;  4H2P A;  4EMW A;  4B66 A;  2IVE A;  2BAC A;  2AR8 A;  1YQZ A;  3HZL A;  3LOV A;  3VRA A;  1PDH A;  3TTB A;  1CC6 A;  1LTX R;  2BK4 A;  3B3R A;  1KNR A;  3UCL A;  4AT0 A;  5BRT A;  1EL7 A;  3AEF A;  3SFD A;  3EF6 A;  2E5V A;  2YLZ A;  2GB0 A;  3IC9 A;  1K4Q A;  4P9S A;  4XWR A;  4TM4 A;  2Y6R A;  2XLR A;  4H7U A;  1D7L A;  1E1N A;  4JDR A;  1PJ7 A;  4Z44 A;  5EOW A;  4GDE A;  3SGL A;  5J60 A;  3I3L A;  4UDP A;  3T37 A;  2YWL A;  3NG7 X;  3UTE A;  2QA1 A;  4J34 A;  2OAM A;  2CUL A;  4Y4L A;  1NPX A;  5EB4 A;  2GRT A;  4K7Z A;  3RNM A;  5IQ4 A;  2OLO A;  1IJH A;  1YQ3 A;  2C67 A;  4YSH A;  3WE0 A;  1OAH A;  3DK9 A;  3UKP A;  2YM1 A;  1LQU A;  1DXL A;  2WP6 A;  3AE9 A;  3G5Q A;  4Z2R A;  4X9N A;  2ZO5 A;  2VOU A;  3AWI A;  4A79 A;  4E0V A;  2RGH A;  3SFE A;  2BC1 A;  2JB1 A;  2EQ7 A;  1F8W A;  4B69 A;  3AD9 B;  1PN0 A;  3ATR A;  3CTY A;  5HXI A;  3ZDN A;  2DKI A;  2WPF A;  3GD4 A;  3CPH G;  1JNR A;  1BF3 A;  1NHR A;  2I0Z A;  3NN6 X;  2VRM A;  2XFQ A;  1LV0 A;  3R9U A;  2V3A A;  3VQR A;  1NHP A;  3NYF A;  5IPY A;  1VRQ B;  1Q9I A;  3OWM A;  5FS7 A;  4BK1 A;  2YG7 A;  3UOX A;  4XWZ A;  4K5S A;  3NIX A;  3UTF A;  3KA7 A;  5U25 A;  1VG9 A;  1F8R A;  1GV4 A;  3JSK A;  1E39 A;  4FK1 A;  4H4S A;  3LG1 A;  4WCT A;  1M1P A;  1LPF A;  2CVJ A;  2YG6 A;  3ALM A;  1XHC A;  4U8O A;  3QFB A;  2GAH B;  1OJT A;  1YY5 A;  2XFN A;  3CGE A;  3QSM A;  3UTG A;  5KWF A;  1CJ3 A;  3DJG X;  2VR0 A;  1CJ2 A;  5KOW A;  1H86 A;  3MMO A;  1UKV G;  4CBQ A;  1Y56 A;  3NRN A;  1GET A;  5EBK A;  4U8N A;  4Z24 A;  3K30 A;  2XLS A;  4FDC B;  3NYC A;  1GSN A;  2F5Z A;  4EMJ A;  2YLR A;  3CIR A;  2R4J A;  5KXJ A;  3KU9 A;  1EL9 A;  2WOV A;  4KPR A;  3AE6 A;  3EAO A;  5U1O A;  1H81 A;  4YKF A;  4NTE A;  1IUU A;  4K2X A;  2C66 A;  2IID A;  3NN0 X;  2K3V A;  3GRS A;  4J33 A;  1L0V A;  4EQR A;  2BXR A;  2GAG B;  3GWF A;  3NNE A;  3DA1 A;  3ICR A;  3UKF A;  3K7M X;  2WHD A;  3UP5 A;  4ECH A;  2C3C A;  1JNZ A;  2WEU A;  3LJP A;  5BUL A;  2C76 A;  3IWA A;  3CPJ G;  4H4Q A;  1GEU A;  4A6N A;  4B63 A;  4CY8 A;  5JCM A;  1KF6 A;  4LA1 A;  4OVI A;  1NEK A;  4OPU A;  1K0L A;  3NK1 X;  4M52 A;  4H2Q A;  2YVJ A;  3AD8 B;  1GRB A;  1TDN A;  2X8C A;  1IUT A;  1OJA A;  4H2R A;  4BV6 A;  3NLC A;  2GV8 A;  2WBA A;  3P1W A;  1D4E A;  4Q5C A;  3BNM A;  5KOX A;  3TOR A;  2YLX A;  4YWO A;  1K0I A;  4FX9 A;  4TLX A;  4IVM B;  5TR3 A;  1H84 A;  2BK3 A;  2X3N A;  4ZCD A;  3NYE A;  4AP3 A;  2GR2 A;  1IUV A;  4Q5B A;  2WDV A;  3AEC A;  1ZMD A;  2WDQ A;  1LJ1 A;  4H4P A;  1FS9 A;  1NDA A;  1GRT A;  2R45 A;  1DJQ A;  2QAE A;  1ZOV A;  3B6D A;  5J7X A;  1S2Q A;  3AE7 A;  1M1R A;  1CF3 A;  1FEB A;  2JB2 A;  3DK8 A;  3L8K A;  4IVO B;  2C75 A;  3DJD A;  3S5W A;  2ZZ0 A;  4A99 A;  2GMH A;  1CC4 A;  2YQU A;  2E80 A;  4B1B A;  1IUW A;  3UBR A;  2V3B A;  4UDR A;  4B67 A;  4YKG A;  3RKH A;  4CY6 A;  5CQF A;  4D03 A;  1GRF A;  3Q6J A;  2GQW A;  4ZCC A;  4EQX A;  3ITJ A;  5C3J A;  3O0H A;  1N1P A;  4FK1 C;  5HHF A;  5IQ1 A;  3URH A;  4L3Y A;  1E1M A;  2E1M A;  2OLN A;  1PXC A;  4IA6 A;  5C2T A;  4A9W A;  2GVC A;  4U2L A;  1MXT A;  2R46 A;  2WP5 A;  1D4C A;  3AE3 A;  2YG3 A;  1D4D A;  4UDQ A;  4YSZ A;  3C4A A;  3RHA A;  2H88 A;  3UP4 A;  2APG A;  3NH3 X;  1CBO A;  2OAL A;  2HQM A;  3AYI A;  1B8S A;  3L1R A;  2OT4 A;  4JY2 A;  5FMH A;  4H4V A;  2WES A;  3L1T A;  1N4V A;  3AEA A;  3RP7 A;  4C3Y A;  1F3P A;  4OPI A;  3UKQ A;  3F8D A;  2ARD A;  3D1C A;  1ZKQ A;  2Q0L A;  1H7X A;  3M13 A;  3P4R A;  1GPE A;  3FPZ A;  4WX1 A;  4Q17 A;  3FG2 P;  1M1Q A;  4A6N B;  2C72 A;  2PHH A;  4RG3 A;  2ZBW A;  4Y4M A;  2WU5 A;  3CPI G;  3ISH A;  4AOX A;  4EM4 A;  1ELI A;  3NK0 X;  3V3N A;  2XCG A;  4GRT A;  1SEZ A;  3CGC A;  3ALL A;  3UOZ A;  3RP6 A;  3LZX A;  2XVE A;  1QO8 A;  2IVD A;  2V6O A;  1LVL A;  1E1L A;  2GR0 A;  1BZL A;  1KSS A;  4XXG A;  4Z26 A;  3UKH A;  1NEN A;  4TM1 A;  4I59 A;  1PBF A;  1KNP A;  1JEH A;  2XVJ A;  1QDB A;  4USR A;  4OPT A;  3H8I A;  2TPR A;  5JCN A;  1BGJ A;  1EL5 A;  1F8S A;  2BS4 A;  3GYX A;  1GRH A;  3GWD A;  1GRA A;  1M64 A;  1PBC A;  4AOS A;  4MJW A;  1N4W A;  3Q9T A;  4GCM A;  4J2W A;  1BGN A;  3F8P A;  3CNS A;  1H82 A;  4TM0 A;  4A5L A;  4J31 A;  2YLS A;  2B76 A;  2VVM A;  4BK3 A;  1L9D A;  2EQ6 A;  1X31 B;  1CJC A;  2FJE A;  4O5U A;  1BWC A;  2XLP A;  2JKC A;  1ZK7 A;  3LB8 A;  2JAE A;  1E7P A;  2X99 A;  1FCD A;  2WPC A;  2FJB A;  1KDG A;  4IV9 A;  2V60 A; 
#chains in the Genus database with same CATH topology
 2AQJ A;  4RSL A;  1W4X A;  2AAQ A;  2WOI A;  5FS6 A;  2BXS A;  3VRD B;  2BCP A;  4IA5 A;  4O5Q A;  4GR1 A;  4U8L A;  1FL2 A;  4C74 A;  2H89 A;  4B65 A;  4H4W A;  3NTD A;  2ACZ A;  3SYI A;  2Z5Y A;  3P4Q A;  3M0O A;  1TYT A;  5HYM A;  2R0G A;  3CNP A;  4DSH A;  4APN A;  3S7W A;  4NTC A;  1JRY A;  4Z25 A;  2Q0K A;  5BUK A;  3GYJ A;  4U8P A;  3G5R A;  3KKJ A;  3K7T A;  3IHM A;  4NEV A;  3QVR A;  3BHF A;  4JNA A;  1TRB A;  2C70 A;  3FIM B;  1EL8 A;  1GU6 A;  1FEC A;  3E1T A;  3P4P A;  1DOD A;  2XFU A;  1PJ6 A;  2Q6U A;  3UOV A;  5KVH A;  2UZZ A;  5ER0 A;  3GRT A;  2A8X A;  2C3D A;  1S3E A;  3NKS A;  5GRT A;  4YTN A;  2A89 A;  4NTD A;  4HB9 A;  1GND A;  2V5Z A;  4PAA A;  3SZF A;  3UKL A;  2WET A;  1Q1R A;  1NHS A;  1FEA A;  3GMC A;  2Z5X A;  1H83 A;  4B64 A;  3UKA A;  2GF3 A;  3AEE A;  2FBW A;  4G6H A;  4A65 A;  2ZZB A;  4CNJ A;  4D04 A;  2XFP A;  1E6E A;  1B5Q A;  1YKJ A;  2WQY A;  3P4S A;  4AP1 A;  1FS7 A;  2VQB A;  3T0K A;  1QLB A;  2WS3 A;  5FS8 A;  3COX A;  4EIP A;  1IUX A;  1L9C A;  1JRX A;  1O94 A;  3BHK A;  2GR3 A;  4GAV A;  2BK5 A;  3DME A;  3C96 A;  2C64 A;  2BCG G;  4HA6 A;  2CFY A;  4EIQ A;  4B68 A;  2LFC A;  2DKH A;  3SY4 A;  3LXD A;  4G74 A;  1TDF A;  2JBV A;  2C73 A;  3KPF A;  2C65 A;  3GM6 A;  1FT6 A;  1XDI A;  2GR1 A;  2QCU A;  5DBJ A;  4L3X A;  3EAN A;  1ZY8 A;  4YXD A;  4U2S A;  1ZMC A;  3CGB A;  4U2T A;  2VQ7 A;  3SZ0 A;  2YG5 A;  2NPX A;  2XLT A;  4U8J A;  5KVI A;  3K7Q X;  1BVB A;  1SP3 A;  2EQ8 A;  1OJD A;  3RED A;  3NGC X;  4BK2 A;  2B9W A;  3KVE A;  4RG4 A;  4BJZ A;  1VG0 A;  2XFO A;  1TYP A;  2YM2 A;  1K0J A;  2XLU A;  3FMW A;  5KNL A;  2YR5 A;  3QVP A;  3PVC A;  3SZC A;  1L9E A;  2R4E A;  3CNJ A;  1ZP0 A;  4J57 A;  2CDU A;  3AEB A;  3FBS A;  4C5O A;  1ZOY A;  3CN8 A;  4H4U A;  2BYB A;  2YAU A;  2JK6 A;  3VRB A;  2RF7 A;  1GER A;  2QA2 A;  4U8I A;  4UP3 A;  4I58 A;  4Y4N A;  1V59 A;  3AB1 A;  1ONF A;  1JOA A;  3T2K A;  2GMJ A;  4C3X A;  2X8G A;  1O95 A;  3SZW A;  4AT2 A;  2Q7V A;  1QJD A;  2YVF A;  3AE4 A;  2B7S A;  4WJY A;  1CHU A;  3NTA A;  4H4T A;  4OPG A;  3T2Y A;  4G6G A;  3V76 A;  4OPD A;  4U8M A;  4Q1O A;  4YTM A;  1NG4 A;  5M0Z A;  1RP0 A;  4GF7 A;  5GSN A;  3UKK A;  1Z6L A;  2XYO A;  1XAN A;  3P9U A;  1CL0 A;  3SXQ A;  1S2Y A;  4Q4U A;  3GDP A;  4H2N A;  2BA9 A;  2GEW A;  3LAD A;  2R0P A;  3DH9 A;  1FOH A;  3F8R A;  4CCR A;  4JY3 A;  1KSU A;  4K5R A;  2VZ2 A;  4BUR A;  1BKW A;  1RSG A;  2J3N A;  4TM3 A;  3V3O A;  1JNI A;  1GRG A;  1PJ5 A;  2YG4 A;  2R0C A;  1EBD A;  3LZW A;  2BRY A;  5JCI A;  4EM3 A;  3KLJ A;  1E1K A;  3QSE A;  4K22 A;  1MO9 A;  3H4K A;  3BI4 A;  4YTP A;  3QFA A;  3ALJ A;  1B37 A;  2O9Z A;  2RDZ A;  1TDO A;  4GDP A;  2W0H A;  3PS9 A;  4K8D A;  3M12 A;  5CKU A;  1JRZ A;  1XPQ A;  3I6D A;  3C4N A;  1VQW A;  2VVL G;  4DGK A;  2OA1 A;  2BS2 A;  1LQT A;  1H7W A;  2R9Z A;  3D8X A;  2GH5 A;  2FJD A;  1CJ4 A;  4NWZ A;  4U8K A;  3D1I A;  3GYI A;  1REO A;  1P2E A;  1O5W A;  2ZZC A;  1CC2 A;  2WPE A;  2XVF A;  4X4J A;  5L46 A;  3BNF A;  3AE5 A;  1PXA A;  1H6V A;  3OZ2 A;  4JQ9 A;  1YQ4 A;  3BNU A;  3ATQ A;  3DJJ A;  3CNT A;  3CND A;  2A87 A;  3GSI A;  1N4U A;  4NZH A;  4EQW A;  2GQF A;  2TMD A;  3NT6 A;  4NEW A;  1AOG A;  2WDR A;  4PAB A;  4CNK A;  4GAP A;  3AXB A;  2YR6 A;  1ZDL A;  2J7A A;  3BNJ A;  1OJ9 A;  2E4G A;  3ADA B;  4L38 A;  4DSG A;  3FO3 A;  3BI2 A;  3UOY A;  3NK2 X;  4H4Z A;  2XVH A;  3IF9 A;  5FS9 A;  1FT5 A;  1DJN A;  4N9X A;  1HYU A;  1GXF A;  2BAB A;  4USQ A;  1PBE A;  2NVK X;  3T2Z A;  2BS3 A;  2YR4 A;  3AD7 B;  2X8H A;  1GT8 A;  3HYW A;  3DGH A;  4CCQ A;  1PHH A;  4EQS A;  4II3 A;  4A7A A;  4Q0T A;  4II2 A;  3AE1 A;  2B9X A;  3IHG A;  3QJ4 A;  3BI5 A;  1OJC A;  3AE8 A;  5LV9 A;  3NHO X;  4H4X A;  2VRL A;  2FJA A;  4ZN0 A;  1NHQ A;  2B7R A;  3UU9 A;  1FS8 A;  2WOW A;  3UTH A;  1JU2 A;  1NG3 A;  3F29 A;  2VVL A;  3AYL A;  2YVG A;  3OC4 A;  1MOK A;  3AE2 A;  1DNC A;  1RYI A;  4H4R A;  4LII A;  2V61 A;  4BJY A;  2XDO A;  2E81 A;  1DOE A;  4Z43 A;  2RGO A;  3GDN A;  3II4 A;  4X9M A;  3CGD A;  3SQP A;  4JNQ A;  2X50 A;  4GUV A;  2BC0 A;  5KMQ A;  4YSY A;  2YLT A;  1ZX9 A;  1GES A;  3AED A;  1GTE A;  3G5S A;  5JCK A;  2JB3 A;  1PXB A;  4YT0 A;  2XVI A;  2C4C A;  2Y6Q A;  4J36 A;  1F6M A;  4OPL A;  1VDC A;  2WP9 A;  1KFY A;  2C7G A;  4H4Y A;  3AEG A;  3RP8 A;  1DOB A;  4L3Z A;  2WU2 A;  3GD3 A;  3ICT A;  4DNA A;  5KMP A;  5HY5 A;  2RGJ A;  1DOC A;  3ICS A;  4C77 A;  1GRE A;  4Z2T A;  1GOS A;  1Y56 B;  4TLZ A;  3DJE A;  1PS9 A;  1S3B A;  1NAA A;  1GTH A;  3BNH A;  3HYX A;  1P2H A;  1PBB A;  5EB5 A;  5JCL A;  1GAL A;  3BNG A;  3EPT A;  4KX6 A;  3S61 A;  4J56 A;  4ADW A;  1IUS A;  4YSX A;  3DGZ A;  1Q1W A;  2RAB A;  3H8L A;  4Z2U A;  3ZYX A;  1M6I A;  1B4V A;  3AYJ A;  3VR9 A;  5BVA A;  3GMB A;  3SM8 A;  3LGQ A;  4H50 A;  5U63 A;  4EMI A;  1D7Y A;  4JN9 A;  5M10 A;  3ABV A;  2B9Y A;  4REK A;  2EQ9 A;  1Y0P A;  4ICY A;  3KPK A;  1D5T A;  3KD9 A;  1COY A;  2PYX A;  4LU6 A;  1TDE A;  3DK4 A;  4OCG A;  5KRQ A;  4CRT A;  1TDK A;  3VR8 A;  3SCE A;  4OPC A;  2YLW A;  3PO7 A;  1PBD A;  3QSS A;  4H2P A;  4EMW A;  4B66 A;  2IVE A;  2BAC A;  2AR8 A;  1YQZ A;  3HZL A;  3LOV A;  5KMS A;  3VRA A;  1PDH A;  3TTB A;  1CC6 A;  1LTX R;  2BK4 A;  3B3R A;  1KNR A;  3UCL A;  4AT0 A;  5BRT A;  1EL7 A;  3AEF A;  3SFD A;  3EF6 A;  2E5V A;  2YLZ A;  2GB0 A;  3IC9 A;  1K4Q A;  4P9S A;  4XWR A;  4TM4 A;  2Y6R A;  2XLR A;  4H7U A;  1D7L A;  1E1N A;  4JDR A;  1PJ7 A;  4Z44 A;  5EOW A;  4GDE A;  3SGL A;  5J60 A;  3I3L A;  4UDP A;  3T37 A;  2YWL A;  3NG7 X;  3UTE A;  2QA1 A;  4J34 A;  2OAM A;  2CUL A;  4Y4L A;  1NPX A;  5EB4 A;  2GRT A;  4K7Z A;  3RNM A;  5IQ4 A;  2OLO A;  1IJH A;  1YQ3 A;  2C67 A;  4YSH A;  3WE0 A;  1OAH A;  3DK9 A;  3UKP A;  2YM1 A;  1LQU A;  1DXL A;  2WP6 A;  3AE9 A;  3G5Q A;  4Z2R A;  4X9N A;  2ZO5 A;  2VOU A;  3AWI A;  4A79 A;  4E0V A;  2RGH A;  3SFE A;  2BC1 A;  2JB1 A;  2EQ7 A;  1F8W A;  4B69 A;  2BRA A;  3AD9 B;  1PN0 A;  3ATR A;  3CTY A;  5HXI A;  3ZDN A;  2DKI A;  2WPF A;  3GD4 A;  3CPH G;  1JNR A;  1BF3 A;  1NHR A;  2I0Z A;  3NN6 X;  2VRM A;  2XFQ A;  1LV0 A;  3R9U A;  2V3A A;  3VQR A;  1NHP A;  3NYF A;  5IPY A;  1VRQ B;  1Q9I A;  3OWM A;  5FS7 A;  4BK1 A;  2YG7 A;  3UOX A;  4XWZ A;  4K5S A;  3NIX A;  3UTF A;  3KA7 A;  5U25 A;  1VG9 A;  1F8R A;  1GV4 A;  3JSK A;  1E39 A;  4FK1 A;  4H4S A;  3LG1 A;  4WCT A;  1M1P A;  1LPF A;  2CVJ A;  2YG6 A;  3ALM A;  1XHC A;  4U8O A;  3QFB A;  2GAH B;  1OJT A;  1YY5 A;  2XFN A;  3CGE A;  3QSM A;  3UTG A;  5KWF A;  1CJ3 A;  3DJG X;  2VR0 A;  1CJ2 A;  5KOW A;  1H86 A;  3MMO A;  1UKV G;  3T31 A;  4CBQ A;  1Y56 A;  3NRN A;  1GET A;  5EBK A;  4U8N A;  3SX6 A;  4Z24 A;  3K30 A;  2XLS A;  4FDC B;  3NYC A;  1GSN A;  2F5Z A;  4EMJ A;  2YLR A;  3CIR A;  2R4J A;  5KXJ A;  3KU9 A;  1EL9 A;  2WOV A;  4KPR A;  3AE6 A;  3EAO A;  5U1O A;  1H81 A;  4YKF A;  4NTE A;  1IUU A;  4K2X A;  2C66 A;  2IID A;  3NN0 X;  2K3V A;  3GRS A;  4J33 A;  1L0V A;  4EQR A;  2BXR A;  2GAG B;  3GWF A;  3NNE A;  3DA1 A;  3ICR A;  3UKF A;  3K7M X;  2WHD A;  3UP5 A;  4ECH A;  2C3C A;  1JNZ A;  2WEU A;  3LJP A;  5BUL A;  2C76 A;  3IWA A;  3CPJ G;  4H4Q A;  1GEU A;  4A6N A;  4B63 A;  4CY8 A;  5JCM A;  1KF6 A;  4LA1 A;  4OVI A;  1NEK A;  4OPU A;  1K0L A;  3NK1 X;  4M52 A;  4H2Q A;  2YVJ A;  3AD8 B;  1GRB A;  1TDN A;  2X8C A;  1IUT A;  1OJA A;  4H2R A;  4BV6 A;  3NLC A;  2GV8 A;  2WBA A;  3P1W A;  1D4E A;  4Q5C A;  3BNM A;  5KOX A;  3TOR A;  2YLX A;  4YWO A;  1K0I A;  4FX9 A;  4TLX A;  4IVM B;  5KMR A;  5TR3 A;  1H84 A;  2BK3 A;  2X3N A;  4NNJ A;  4ZCD A;  3NYE A;  4AP3 A;  2GR2 A;  1IUV A;  4Q5B A;  2WDV A;  3AEC A;  1ZMD A;  2WDQ A;  1LJ1 A;  4H4P A;  1FS9 A;  1NDA A;  1GRT A;  2R45 A;  1DJQ A;  2QAE A;  1ZOV A;  3B6D A;  5J7X A;  1S2Q A;  3AE7 A;  1M1R A;  1CF3 A;  1FEB A;  2JB2 A;  3DK8 A;  3L8K A;  4IVO B;  2C75 A;  3DJD A;  3S5W A;  2ZZ0 A;  4A99 A;  2GMH A;  1CC4 A;  2YQU A;  2E80 A;  4B1B A;  1IUW A;  3UBR A;  2V3B A;  4UDR A;  4B67 A;  4YKG A;  3RKH A;  4CY6 A;  5CQF A;  4D03 A;  1GRF A;  3Q6J A;  2GQW A;  4ZCC A;  4EQX A;  4G73 A;  3ITJ A;  5C3J A;  3O0H A;  1N1P A;  4FK1 C;  5HHF A;  5IQ1 A;  3URH A;  4L3Y A;  1E1M A;  2E1M A;  2OLN A;  1PXC A;  4IA6 A;  5C2T A;  4A9W A;  2GVC A;  4U2L A;  1MXT A;  2R46 A;  2WP5 A;  1D4C A;  2CZS A;  3AE3 A;  2YG3 A;  1D4D A;  4UDQ A;  4YSZ A;  3C4A A;  3RHA A;  2H88 A;  3UP4 A;  2APG A;  3NH3 X;  1CBO A;  2OAL A;  2HQM A;  3AYI A;  1B8S A;  3L1R A;  2OT4 A;  3CMM A;  4JY2 A;  5FMH A;  4H4V A;  2WES A;  3L1T A;  1N4V A;  3AEA A;  3RP7 A;  4C3Y A;  1F3P A;  4OPI A;  3UKQ A;  3F8D A;  4G9K A;  2ARD A;  3D1C A;  1ZKQ A;  2Q0L A;  1H7X A;  3M13 A;  3P4R A;  1GPE A;  3FPZ A;  4WX1 A;  4Q17 A;  3FG2 P;  1M1Q A;  3T14 A;  2C72 A;  4A6N B;  2PHH A;  4RG3 A;  2ZBW A;  4Y4M A;  2WU5 A;  3CPI G;  3ISH A;  4AOX A;  4EM4 A;  1ELI A;  3NK0 X;  3V3N A;  2XCG A;  4GRT A;  1SEZ A;  3CGC A;  3ALL A;  3UOZ A;  3RP6 A;  3LZX A;  2XVE A;  1QO8 A;  2IVD A;  2V6O A;  1LVL A;  1E1L A;  2GR0 A;  1BZL A;  1KSS A;  4XXG A;  4Z26 A;  3UKH A;  1NEN A;  4TM1 A;  4I59 A;  1PBF A;  1KNP A;  1JEH A;  2XVJ A;  1QDB A;  4USR A;  4OPT A;  3H8I A;  2TPR A;  5JCN A;  1BGJ A;  1EL5 A;  1F8S A;  2BS4 A;  3GYX A;  1GRH A;  3GWD A;  1GRA A;  1M64 A;  1PBC A;  4AOS A;  4MJW A;  1N4W A;  3Q9T A;  4GCM A;  4J2W A;  1BGN A;  3F8P A;  3CNS A;  1H82 A;  4TM0 A;  4A5L A;  4J31 A;  2YLS A;  2B76 A;  2VVM A;  4BK3 A;  1L9D A;  2EQ6 A;  1X31 B;  1CJC A;  2FJE A;  4O5U A;  1BWC A;  2XLP A;  2JKC A;  1ZK7 A;  3HYV A;  3LB8 A;  2JAE A;  1E7P A;  3SXI A;  2X99 A;  1FCD A;  2WPC A;  2FJB A;  1KDG A;  4IV9 A;  2V60 A; 
#chains in the Genus database with same CATH homology
 2AQJ A;  4RSL A;  1W4X A;  2AAQ A;  2WOI A;  5FS6 A;  2BXS A;  3VRD B;  2BCP A;  4IA5 A;  4O5Q A;  4GR1 A;  4U8L A;  1FL2 A;  4C74 A;  2H89 A;  4B65 A;  4H4W A;  3NTD A;  2ACZ A;  3SYI A;  2Z5Y A;  3P4Q A;  3M0O A;  1TYT A;  5HYM A;  2R0G A;  3CNP A;  4DSH A;  4APN A;  3S7W A;  4NTC A;  1JRY A;  4Z25 A;  2Q0K A;  5BUK A;  3GYJ A;  4U8P A;  3G5R A;  3KKJ A;  3K7T A;  3IHM A;  4NEV A;  3QVR A;  3BHF A;  4JNA A;  1TRB A;  2C70 A;  3FIM B;  1EL8 A;  1GU6 A;  1FEC A;  3E1T A;  3P4P A;  1DOD A;  2XFU A;  1PJ6 A;  2Q6U A;  3UOV A;  5KVH A;  2UZZ A;  5ER0 A;  3GRT A;  2A8X A;  2C3D A;  1S3E A;  3NKS A;  5GRT A;  4YTN A;  2A89 A;  4NTD A;  4HB9 A;  1GND A;  2V5Z A;  4PAA A;  3SZF A;  3UKL A;  2WET A;  1Q1R A;  1NHS A;  1FEA A;  3GMC A;  2Z5X A;  1H83 A;  4B64 A;  3UKA A;  2GF3 A;  3AEE A;  2FBW A;  4G6H A;  4A65 A;  2ZZB A;  4CNJ A;  4D04 A;  2XFP A;  1E6E A;  1B5Q A;  1YKJ A;  2WQY A;  3P4S A;  4AP1 A;  1FS7 A;  2VQB A;  3T0K A;  1QLB A;  2WS3 A;  5FS8 A;  3COX A;  4EIP A;  1IUX A;  1L9C A;  1JRX A;  1O94 A;  3BHK A;  2GR3 A;  4GAV A;  2BK5 A;  3DME A;  3C96 A;  2C64 A;  2BCG G;  4HA6 A;  2CFY A;  4EIQ A;  4B68 A;  2LFC A;  2DKH A;  3SY4 A;  3LXD A;  4G74 A;  1TDF A;  2JBV A;  2C73 A;  3KPF A;  2C65 A;  3GM6 A;  1FT6 A;  1XDI A;  2GR1 A;  2QCU A;  5DBJ A;  4L3X A;  3EAN A;  1ZY8 A;  4YXD A;  4U2S A;  1ZMC A;  3CGB A;  4U2T A;  2VQ7 A;  3SZ0 A;  2YG5 A;  2NPX A;  2XLT A;  4U8J A;  5KVI A;  3K7Q X;  1BVB A;  1SP3 A;  2EQ8 A;  1OJD A;  3RED A;  3NGC X;  4BK2 A;  2B9W A;  3KVE A;  4RG4 A;  4BJZ A;  1VG0 A;  2XFO A;  1TYP A;  2YM2 A;  1K0J A;  2XLU A;  3FMW A;  5KNL A;  2YR5 A;  3QVP A;  3PVC A;  3SZC A;  1L9E A;  2R4E A;  3CNJ A;  1ZP0 A;  4J57 A;  2CDU A;  3AEB A;  3FBS A;  4C5O A;  1ZOY A;  3CN8 A;  4H4U A;  2BYB A;  2YAU A;  2JK6 A;  3VRB A;  2RF7 A;  1GER A;  2QA2 A;  4U8I A;  4UP3 A;  4I58 A;  4Y4N A;  1V59 A;  3AB1 A;  1ONF A;  1JOA A;  3T2K A;  2GMJ A;  4C3X A;  2X8G A;  1O95 A;  3SZW A;  4AT2 A;  2Q7V A;  1QJD A;  2YVF A;  3AE4 A;  2B7S A;  4WJY A;  1CHU A;  3NTA A;  4H4T A;  4OPG A;  3T2Y A;  4G6G A;  3V76 A;  4OPD A;  4U8M A;  4Q1O A;  4YTM A;  1NG4 A;  5M0Z A;  1RP0 A;  4GF7 A;  5GSN A;  3UKK A;  1Z6L A;  2XYO A;  1XAN A;  3P9U A;  1CL0 A;  3SXQ A;  1S2Y A;  4Q4U A;  3GDP A;  4H2N A;  2BA9 A;  2GEW A;  3LAD A;  2R0P A;  3DH9 A;  1FOH A;  3F8R A;  4CCR A;  4JY3 A;  1KSU A;  4K5R A;  2VZ2 A;  4BUR A;  1BKW A;  1RSG A;  2J3N A;  4TM3 A;  3V3O A;  1JNI A;  1GRG A;  1PJ5 A;  2YG4 A;  2R0C A;  1EBD A;  3LZW A;  2BRY A;  5JCI A;  4EM3 A;  3KLJ A;  1E1K A;  3QSE A;  4K22 A;  1MO9 A;  3H4K A;  3BI4 A;  4YTP A;  3QFA A;  3ALJ A;  1B37 A;  2O9Z A;  2RDZ A;  1TDO A;  4GDP A;  2W0H A;  3PS9 A;  4K8D A;  3M12 A;  5CKU A;  1JRZ A;  1XPQ A;  3I6D A;  3C4N A;  1VQW A;  2VVL G;  4DGK A;  2OA1 A;  2BS2 A;  1LQT A;  1H7W A;  2R9Z A;  3D8X A;  2GH5 A;  2FJD A;  1CJ4 A;  4NWZ A;  4U8K A;  3D1I A;  3GYI A;  1REO A;  1P2E A;  1O5W A;  2ZZC A;  1CC2 A;  2WPE A;  2XVF A;  4X4J A;  5L46 A;  3BNF A;  3AE5 A;  1PXA A;  1H6V A;  3OZ2 A;  4JQ9 A;  1YQ4 A;  3BNU A;  3ATQ A;  3DJJ A;  3CNT A;  3CND A;  2A87 A;  3GSI A;  1N4U A;  4NZH A;  4EQW A;  2GQF A;  2TMD A;  3NT6 A;  4NEW A;  1AOG A;  2WDR A;  4PAB A;  4CNK A;  4GAP A;  3AXB A;  2YR6 A;  1ZDL A;  2J7A A;  3BNJ A;  1OJ9 A;  2E4G A;  3ADA B;  4L38 A;  4DSG A;  3FO3 A;  3BI2 A;  3UOY A;  3NK2 X;  4H4Z A;  2XVH A;  3IF9 A;  5FS9 A;  1FT5 A;  1DJN A;  4N9X A;  1HYU A;  1GXF A;  2BAB A;  4USQ A;  1PBE A;  2NVK X;  3T2Z A;  2BS3 A;  2YR4 A;  3AD7 B;  2X8H A;  1GT8 A;  3HYW A;  3DGH A;  4CCQ A;  1PHH A;  4EQS A;  4II3 A;  4A7A A;  4Q0T A;  4II2 A;  3AE1 A;  2B9X A;  3IHG A;  3QJ4 A;  3BI5 A;  1OJC A;  3AE8 A;  5LV9 A;  3NHO X;  4H4X A;  2VRL A;  2FJA A;  4ZN0 A;  1NHQ A;  2B7R A;  3UU9 A;  1FS8 A;  2WOW A;  3UTH A;  1JU2 A;  1NG3 A;  3F29 A;  2VVL A;  3AYL A;  2YVG A;  3OC4 A;  1MOK A;  3AE2 A;  1DNC A;  1RYI A;  4H4R A;  4LII A;  2V61 A;  4BJY A;  2XDO A;  2E81 A;  1DOE A;  4Z43 A;  2RGO A;  3GDN A;  3II4 A;  4X9M A;  3CGD A;  3SQP A;  4JNQ A;  2X50 A;  4GUV A;  2BC0 A;  5KMQ A;  4YSY A;  2YLT A;  1ZX9 A;  1GES A;  3AED A;  1GTE A;  3G5S A;  5JCK A;  2JB3 A;  1PXB A;  4YT0 A;  2XVI A;  2C4C A;  2Y6Q A;  4J36 A;  1F6M A;  4OPL A;  1VDC A;  2WP9 A;  1KFY A;  2C7G A;  4H4Y A;  3AEG A;  3RP8 A;  1DOB A;  4L3Z A;  2WU2 A;  3GD3 A;  3ICT A;  4DNA A;  5KMP A;  5HY5 A;  2RGJ A;  1DOC A;  3ICS A;  4C77 A;  1GRE A;  4Z2T A;  1GOS A;  1Y56 B;  4TLZ A;  3DJE A;  1PS9 A;  1S3B A;  1NAA A;  1GTH A;  3BNH A;  3HYX A;  1P2H A;  1PBB A;  5EB5 A;  5JCL A;  1GAL A;  3BNG A;  3EPT A;  4KX6 A;  3S61 A;  4J56 A;  4ADW A;  1IUS A;  4YSX A;  3DGZ A;  1Q1W A;  2RAB A;  3H8L A;  4Z2U A;  3ZYX A;  1M6I A;  1B4V A;  3AYJ A;  3VR9 A;  5BVA A;  3GMB A;  3SM8 A;  3LGQ A;  4H50 A;  5U63 A;  4EMI A;  1D7Y A;  4JN9 A;  5M10 A;  3ABV A;  2B9Y A;  4REK A;  2EQ9 A;  1Y0P A;  4ICY A;  3KPK A;  1D5T A;  3KD9 A;  1COY A;  2PYX A;  4LU6 A;  1TDE A;  3DK4 A;  4OCG A;  5KRQ A;  4CRT A;  1TDK A;  3VR8 A;  3SCE A;  4OPC A;  2YLW A;  3PO7 A;  1PBD A;  3QSS A;  4H2P A;  4EMW A;  4B66 A;  2IVE A;  2BAC A;  2AR8 A;  1YQZ A;  3HZL A;  3LOV A;  5KMS A;  3VRA A;  1PDH A;  3TTB A;  1CC6 A;  1LTX R;  2BK4 A;  3B3R A;  1KNR A;  3UCL A;  4AT0 A;  5BRT A;  1EL7 A;  3AEF A;  3SFD A;  3EF6 A;  2E5V A;  2YLZ A;  2GB0 A;  3IC9 A;  1K4Q A;  4P9S A;  4XWR A;  4TM4 A;  2Y6R A;  2XLR A;  4H7U A;  1D7L A;  1E1N A;  4JDR A;  1PJ7 A;  4Z44 A;  5EOW A;  4GDE A;  3SGL A;  5J60 A;  3I3L A;  4UDP A;  3T37 A;  2YWL A;  3NG7 X;  3UTE A;  2QA1 A;  4J34 A;  2OAM A;  2CUL A;  4Y4L A;  1NPX A;  5EB4 A;  2GRT A;  4K7Z A;  3RNM A;  5IQ4 A;  2OLO A;  1IJH A;  1YQ3 A;  2C67 A;  4YSH A;  3WE0 A;  1OAH A;  3DK9 A;  3UKP A;  2YM1 A;  1LQU A;  1DXL A;  2WP6 A;  3AE9 A;  3G5Q A;  4Z2R A;  4X9N A;  2ZO5 A;  2VOU A;  3AWI A;  4A79 A;  4E0V A;  2RGH A;  3SFE A;  2BC1 A;  2JB1 A;  2EQ7 A;  1F8W A;  4B69 A;  2BRA A;  3AD9 B;  1PN0 A;  3ATR A;  3CTY A;  5HXI A;  3ZDN A;  2DKI A;  2WPF A;  3GD4 A;  3CPH G;  1JNR A;  1BF3 A;  1NHR A;  2I0Z A;  3NN6 X;  2VRM A;  2XFQ A;  1LV0 A;  3R9U A;  2V3A A;  3VQR A;  1NHP A;  3NYF A;  5IPY A;  1VRQ B;  1Q9I A;  3OWM A;  5FS7 A;  4BK1 A;  2YG7 A;  3UOX A;  4XWZ A;  4K5S A;  3NIX A;  3UTF A;  3KA7 A;  5U25 A;  1VG9 A;  1F8R A;  1GV4 A;  3JSK A;  1E39 A;  4FK1 A;  4H4S A;  3LG1 A;  4WCT A;  1M1P A;  1LPF A;  2CVJ A;  2YG6 A;  3ALM A;  1XHC A;  4U8O A;  3QFB A;  2GAH B;  1OJT A;  1YY5 A;  2XFN A;  3CGE A;  3QSM A;  3UTG A;  5KWF A;  1CJ3 A;  3DJG X;  2VR0 A;  1CJ2 A;  5KOW A;  1H86 A;  3MMO A;  1UKV G;  3T31 A;  4CBQ A;  1Y56 A;  3NRN A;  1GET A;  5EBK A;  4U8N A;  3SX6 A;  4Z24 A;  3K30 A;  2XLS A;  4FDC B;  3NYC A;  1GSN A;  2F5Z A;  4EMJ A;  2YLR A;  3CIR A;  2R4J A;  5KXJ A;  3KU9 A;  1EL9 A;  2WOV A;  4KPR A;  3AE6 A;  3EAO A;  5U1O A;  1H81 A;  4YKF A;  4NTE A;  1IUU A;  4K2X A;  2C66 A;  2IID A;  3NN0 X;  2K3V A;  3GRS A;  4J33 A;  1L0V A;  4EQR A;  2BXR A;  2GAG B;  3GWF A;  3NNE A;  3DA1 A;  3ICR A;  3UKF A;  3K7M X;  2WHD A;  3UP5 A;  4ECH A;  2C3C A;  1JNZ A;  2WEU A;  3LJP A;  5BUL A;  2C76 A;  3IWA A;  3CPJ G;  4H4Q A;  1GEU A;  4A6N A;  4B63 A;  4CY8 A;  5JCM A;  1KF6 A;  4LA1 A;  4OVI A;  1NEK A;  4OPU A;  1K0L A;  3NK1 X;  4M52 A;  4H2Q A;  2YVJ A;  3AD8 B;  1GRB A;  1TDN A;  2X8C A;  1IUT A;  1OJA A;  4H2R A;  4BV6 A;  3NLC A;  2GV8 A;  2WBA A;  3P1W A;  1D4E A;  4Q5C A;  3BNM A;  5KOX A;  3TOR A;  2YLX A;  4YWO A;  1K0I A;  4FX9 A;  4TLX A;  4IVM B;  5KMR A;  5TR3 A;  1H84 A;  2BK3 A;  2X3N A;  4NNJ A;  4ZCD A;  3NYE A;  4AP3 A;  2GR2 A;  1IUV A;  4Q5B A;  2WDV A;  3AEC A;  1ZMD A;  2WDQ A;  1LJ1 A;  4H4P A;  1FS9 A;  1NDA A;  1GRT A;  2R45 A;  1DJQ A;  2QAE A;  1ZOV A;  3B6D A;  5J7X A;  1S2Q A;  3AE7 A;  1M1R A;  1CF3 A;  1FEB A;  2JB2 A;  3DK8 A;  3L8K A;  4IVO B;  2C75 A;  3DJD A;  3S5W A;  2ZZ0 A;  4A99 A;  2GMH A;  1CC4 A;  2YQU A;  2E80 A;  4B1B A;  1IUW A;  3UBR A;  2V3B A;  4UDR A;  4B67 A;  4YKG A;  3RKH A;  4CY6 A;  5CQF A;  4D03 A;  1GRF A;  3Q6J A;  2GQW A;  4ZCC A;  4EQX A;  4G73 A;  3ITJ A;  5C3J A;  3O0H A;  1N1P A;  4FK1 C;  5HHF A;  5IQ1 A;  3URH A;  4L3Y A;  1E1M A;  2E1M A;  2OLN A;  1PXC A;  4IA6 A;  5C2T A;  4A9W A;  2GVC A;  4U2L A;  1MXT A;  2R46 A;  2WP5 A;  1D4C A;  3AE3 A;  2YG3 A;  1D4D A;  4UDQ A;  4YSZ A;  3C4A A;  3RHA A;  2H88 A;  3UP4 A;  2APG A;  3NH3 X;  1CBO A;  2OAL A;  2HQM A;  3AYI A;  1B8S A;  3L1R A;  2OT4 A;  3CMM A;  4JY2 A;  5FMH A;  4H4V A;  2WES A;  3L1T A;  1N4V A;  3AEA A;  3RP7 A;  4C3Y A;  1F3P A;  4OPI A;  3UKQ A;  3F8D A;  4G9K A;  2ARD A;  3D1C A;  1ZKQ A;  2Q0L A;  1H7X A;  3M13 A;  3P4R A;  1GPE A;  3FPZ A;  4WX1 A;  4Q17 A;  3FG2 P;  1M1Q A;  3T14 A;  2C72 A;  4A6N B;  2PHH A;  4RG3 A;  2ZBW A;  4Y4M A;  2WU5 A;  3CPI G;  3ISH A;  4AOX A;  4EM4 A;  1ELI A;  3NK0 X;  3V3N A;  2XCG A;  4GRT A;  1SEZ A;  3CGC A;  3ALL A;  3UOZ A;  3RP6 A;  3LZX A;  2XVE A;  1QO8 A;  2IVD A;  2V6O A;  1LVL A;  1E1L A;  2GR0 A;  1BZL A;  1KSS A;  4XXG A;  4Z26 A;  3UKH A;  1NEN A;  4TM1 A;  4I59 A;  1PBF A;  1KNP A;  1JEH A;  2XVJ A;  1QDB A;  4USR A;  4OPT A;  3H8I A;  2TPR A;  5JCN A;  1BGJ A;  1EL5 A;  1F8S A;  2BS4 A;  3GYX A;  1GRH A;  3GWD A;  1GRA A;  1M64 A;  1PBC A;  4AOS A;  4MJW A;  1N4W A;  3Q9T A;  4GCM A;  4J2W A;  1BGN A;  3F8P A;  3CNS A;  1H82 A;  4TM0 A;  4A5L A;  4J31 A;  2YLS A;  2B76 A;  2VVM A;  4BK3 A;  1L9D A;  2EQ6 A;  1X31 B;  1CJC A;  2FJE A;  4O5U A;  1BWC A;  2XLP A;  2JKC A;  1ZK7 A;  3HYV A;  3LB8 A;  2JAE A;  1E7P A;  3SXI A;  2X99 A;  1FCD A;  2WPC A;  2FJB A;  1KDG A;  4IV9 A;  2V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...