1P2HA

H61m mutant of flavocytochrome c3
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASMFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords flavocytochrome c3
publication title Histidine 61: An Important Heme Ligand in the Soluble Fumarate Reductase from Shewanella frigidimarina
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 198
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1p2hA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1p2hA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1p2hA01
1FS7A 5JCLA 3P4QA 1LVLA 2X99A 4Z24A 1TRBA 3P4RA 1BGJA 2XLSA 5FS6A 4Z2TA 4L38A 3FMWA 3UKQA 2XDOA 2Z5YA 5U1OA 4XXGA 4YTMA 4DSGA 3I6DA 3ICSA 3KKJA 2C72A 3ATQA 4GRTA 2WOWA 3CPHG 4K5RA 1BGNA 4TM3A 3RHAA 1GV4A 1CJ4A 1DNCA 3AEAA 3C4AA 3OWMA 5HHFA 2GF3A 3NIXA 1D4EA 4APNA 1PXCA 1O5WA 1B4VA 2XLUA 1GU6A 3CGEA 3EF6A 1GRHA 3URHA 4X4JA 4UP3A 4ECHA 2K3VA 4AT0A 2IVDA 4C3XA 2VVLG 4A6NA 1TDFA 4AP1A 2XVJA 3NYFA 3P4PA 1EBDA 2R4JA 2PHHA 3UCLA 3CNJA 3VRDB 2BA9A 1TDKA 2JBVA 2RGJA 1KNRA 5GRTA 2WOVA 4YT0A 2B7RA 1M1RA 3BNMA 2BYBA 2WETA 1PJ6A 4UDPA 4U8PA 2NPXA 5JCMA 1BZLA 1CHUA 2WPCA 3LG1A 4YSHA 3AE2A 3AEDA 2BC0A 1E6EA 3UP5A 2FJAA 1DOEA 4AOSA 4B68A 4BK2A 3FO3A 1GNDA 4JDRA 4CCRA 3L1TA 4J33A 2QA2A 1PJ7A 3LXDA 1D7YA 1OJDA 2E1MA 3SQPA 3BI2A 4DNAA 2YLTA 1NDAA 2WESA 1FCDA 2WBAA 4H4YA 4REKA 3T37A 3RNMA 2AQJA 2QAEA 4KX6A 4J56A 1RYIA 3D8XA 3TORA 4AOXA 3IC9A 4H4TA 3GDNA 2ZZCA 1K0IA 3ZYXA 4CCQA 2Q7VA 2QA1A 3DK9A 3VR8A 3S61A 2JB1A 2WP9A 3CGDA 3H8IA 1F8RA 1LPFA 3F8PA 1ELIA 1COYA 3K7QX 3NKSA 4DSHA 4HA6A 4B64A 4CY6A 5JCIA 3KPFA 3UOVA 3UTHA 1S3EA 2XVFA 1E39A 3KU9A 5EB4A 5FS7A 1SEZA 2BXSA 2YM2A 3NTDA 3AB1A 5M0ZA 1IUWA 4WCTA 1FT6A 2GQWA 1SP3A 2Q0KA 3ADAB 3B3RA 3GYIA 3L1RA 1CBOA 4JNQA 5U63A 5J60A 3AD8B 4BURA 1YQ3A 4U8MA 3AE1A 4EMIA 4Y4MA 4Q1OA 2R0GA 4U2LA 1CC4A 4IA5A 4K5SA 1TYPA 2Z5XA 1BF3A 2WEUA 2Q6UA 1VQWA 1B37A 4OCGA 4L3XA 4P9SA 1XANA 3UKKA 3COXA 1S2YA 1X31B 4NZHA 1DOBA 4U8JA 2GRTA 1PN0A 4WJYA 5HYMA 1PJ5A 3EANA 4ICYA 1DXLA 1N4UA 4H4ZA 4LU6A 5FS9A 2XCGA 1F8WA 4YTPA 3NHOX 3QVPA 4XWRA 4EMWA 4CNKA 4X9NA 1MO9A 1REOA 1RP0A 4B67A 3REDA 1M64A 2CULA 1L9DA 1KFYA 2F5ZA 2OLNA 3UKLA 3K7MX 3V76A 1E1KA 3PVCA 2APGA 4GDPA 1PBBA 4EQSA 3BI4A 3GSIA 2YLRA 1FS9A 4H50A 4B66A 2A8XA 1Y56B 4A7AA 1GXFA 2JKCA 2W0HA 2YVGA 2J3NA 4OPLA 3ALLA 2X8GA 1L0VA 3QSEA 4C5OA 3K7TA 2R0PA 4U2SA 3DJJA 4JY2A 1V59A 1EL9A 4A5LA 2ZBWA 2BCGG 3C4NA 3AXBA 3CN8A 4L3YA 1N4VA 3CGBA 2GAHB 3G5QA 5M10A 1S2QA 2PYXA 2OAMA 2WHDA 1ZMCA 4YKFA 5HXIA 3GD3A 3DJGX 3LJPA 1H6VA 5KWFA 4U8KA 4A99A 3PO7A 2VOUA 1QO8A 4ADWA 1K0LA 1Y0PA 3BNHA 4Q17A 4H4RA 4C3YA 1FOHA 2CDUA 3AE4A 3NH3X 1ZMDA 3BNFA 3RKHA 2OLOA 3KA7A 1OJ9A 2VRMA 2YR6A 2YLSA 2XFPA 2O9ZA 4FK1C 3V3OA 2GMJA 5KVIA 3ITJA 1GRGA 1NHSA 3F8RA 1E1LA 2B9XA 2YAUA 2YR5A 5C3JA 3G5RA 2VZ2A 4EQXA 2XLRA 2C76A 3GM6A 1TYTA 1KDGA 2RABA 1L9CA 3NK1X 4H4SA 4OPCA 4IA6A 1ZOYA 4BK1A 1H7XA 2BXRA 2YLWA 3TTBA 3MMOA 2VR0A 1PBFA 1JOAA 1B8SA 4B69A 2EQ8A 2GH5A 2YQUA 3IHGA 4MJWA 1KF6A 2RGOA 3AECA 3CPIG 3NK2X 4U8IA 3UKPA 3UOXA 3ABVA 3UKAA 1NHPA 3BHKA 3GWFA 3GRTA 3M12A 1H83A 4H4VA 4NTDA 4CY8A 3S5WA 1NHQA 3Q9TA 1DOCA 4A9WA 4EMJA 4C74A 2GQFA 4J31A 3SFEA 3NYCA 1CF3A 2WDQA 2C3DA 2XLTA 4EM3A 1JEHA 2GEWA 2IVEA 1NENA 4TLXA 1M1PA 4IV9A 2GAGB 3SGLA 3OC4A 1D4CA 5IPYA 4GR1A 1F6MA 2WPFA 4JNAA 2C73A 1D7LA 3QVRA 5EOWA 1GETA 3NTAA 2AR8A 3QSSA 1PXAA 1IJHA 4H4XA 3IHMA 3NK0X 3F29A 1AOGA 2FBWA 4K8DA 4J34A 2YLZA 3EAOA 3BNGA 4YKGA 3ATRA 1IUVA 3DK4A 4TM1A 1PBCA 4YXDA 2C67A 4YSXA 4RG4A 4CNJA 3CGCA 2WP5A 4WX1A 2ACZA 5KXJA 1GESA 1XPQA 4K22A 1ZOVA 1NEKA 4GCMA 1KSUA 1IUXA 3RP8A 4YSYA 2BK4A 2XVIA 3EPTA 4H4UA 2OT4A 3VQRA 4AP3A 3FIMB 5HY5A 5KRQA 4Z44A 2XLPA 2VRLA 4TM0A 1FS8A 3KD9A 3LB8A 3WE0A 2V3AA 3DA1A 3I3LA 4PABA 1JRZA 1MOKA 5EB5A 1GTHA 3NT6A 4C77A 3PS9A 3NGCX 2BS4A 3QFBA 1E1NA 1VG9A 4OPTA 2ZZBA 1YQZA 4H7UA 3QSMA 2FJBA 2GVCA 4FK1A 1CC6A 4J36A 3DH9A 3VRBA 3NN0X 4Z43A 2ZO5A 3ALJA 3NYEA 2WQYA 4EIPA 1BKWA 2BS2A 1JNZA 3AE8A 3LOVA 3UU9A 2E80A 1KSSA 1ZDLA 2R9ZA 2YG4A 2E4GA 2RGHA 3UTFA 1LQTA 5TR3A 4H4PA 3AYJA 1JNIA 3AYLA 2ZZ0A 4RSLA 3O0HA 1B5QA 2YG6A 1EL8A 5JCKA 1LQUA 1XDIA 4NTCA 4B1BA 1GOSA 2BC1A 4BJYA 4EQRA 3SXQA 4H2RA 4NEVA 1MXTA 1GPEA 3Q6JA 1GEUA 4H2QA 1NG3A 2EQ7A 4OPIA 4UDQA 3GDPA 3P1WA 4XWZA 1NG4A 1ZKQA 2BS3A 4EQWA 2BABA 4YWOA 4OPUA 4JQ9A 4AT2A 4Z25A 2GMHA 2GB0A 3QJ4A 4U8LA 4YTNA 1TDNA 3M13A 1N4WA 3GWDA 4B65A 2VVLA 4LA1A 1YQ4A 2BK3A 3UKFA 3UBRA 2V6OA 3QFAA 4OVIA 2B9WA 4ZCCA 3AD7B 2V60A 4OPGA 4O5UA 5C2TA 2JB2A 4Q5BA 4A6NB 2X8CA 4K7ZA 4H4QA 1ZK7A 1D4DA 5EBKA 3LGQA 1DJQA 2WS3A 2YVJA 1JNRA 3D1IA 2H88A 2CVJA 3GD4A 2BACA 3GRSA 1GT8A 3ALMA 4EIQA 3P4SA 1PXBA 2WU2A 1CJ2A 1TDOA 2GR2A 1ONFA 1GREA 2FJEA 4Y4LA 3SCEA 1ZP0A 2C64A 2JK6A 1Q9IA 1LJ1A 5BUKA 4CRTA 3GYJA 3CNPA 1O95A 2WP6A 3RP7A 2B76A 4J2WA 1CJ3A 2TMDA 3VRAA 2X3NA 1E7PA 5KOXA 3JSKA 3CNDA 4Q4UA 5KOWA 3NN6X 2OA1A 3UTEA 3GYXA 1CJCA 1QLBA 1H7WA 1Q1WA 4EM4A 4JN9A 1M1QA 3IWAA 3OZ2A 5U25A 1Y56A 1VRQB 2XFNA 1FEAA 2TPRA 1CL0A 2A87A 2VQBA 2YLXA 4GUVA 2HQMA 1Z6LA 3CNTA 3FBSA 3RP6A 2YVFA 2YWLA 2YR4A 2JB3A 3GMCA 4O5QA 4U2TA 1KNPA 3UP4A 2GR1A 3ICTA 2UZZA 2FJDA 2EQ9A 2OALA 1PBEA 3M0OA 1GRFA 1N1PA 2V3BA 3AEEA 3ICRA 3UOYA 1H81A 1W4XA 2Q0LA 3P9UA 5JCNA 1E1MA 1GRAA 3DGHA 4HB9A 4NTEA 3AE5A 1FEBA 2XFUA 3G5SA 1VG0A 4K2XA 1GTEA 1GERA 5CKUA 1EL7A 1Q1RA 1GALA 4N9XA 1P2EA 1JRXA 1H82A 2WOIA 3B6DA 4M52A 1IUUA 3D1CA 1D5TA 2DKIA 2R0CA 3BHFA 1DODA 4U8OA 4X9MA 3S7WA 2LFCA 1IUSA 3UOZA 4D03A 1LV0A 2XVEA 1H84A 3ISHA 3SFDA 2WDRA 4J57A 4TLZA 1IUTA 1GRTA 4USRA 5DBJA 3BNUA 3LZWA 4RG3A 3DJEA 3HZLA 4IVMB 4FDCB 3AE7A 4UDRA 2NVKX 1H86A 5GSNA 2WDVA 3V3NA 2BK5A 1GRBA 1VDCA 3AEGA 3AEBA 3AEFA 1OJAA 3AE3A 1ZY8A 2XFOA 5KVHA 4IVOB 3AE6A 5L46A 2WPEA 3FPZA 2C66A 3KLJA 4JY3A 4NEWA 3LADA 1OJCA 3AE9A 1M6IA 2QCUA 4GDEA 1S3BA 2I0ZA 1OJTA 2R46A 2RF7A 1CC2A 4Z2RA 2YM1A 3K30A 4BK3A 3VR9A 4BV6A 2A89A 2R4EA 1RSGA 1FL2A 3R9UA 1TDEA 2X50A 1NPXA 2XVHA 4KPRA 1YY5A 2VVMA 5CQFA 4H2NA 1K4QA 4CBQA 2B9YA 2GR3A 5IQ1A 2Y6RA 1BWCA 2YG7A 2Y6QA 5BULA 4Q5CA 1PS9A 1HYUA 2WU5A 1XHCA 2XYOA 3E1TA 1PHHA 4FX9A 3SM8A 2C65A 5FS8A 1K0JA 2C3CA 3UKHA 1BVBA 2B7SA 2RDZA 2R45A 3BI5A 4I59A 3NG7X 3UTGA 1EL5A 2V61A 1L9EA 2H89A 1GSNA 1FT5A 4OPDA 2C7GA 3H4KA 3NRNA 5ER0A 1JU2A 2X8HA 3AWIA 4H4WA 2ARDA 2GR0A 3KVEA 3CPJG 4L3ZA 3CNSA 3GMBA 5BVAA 2VQ7A 3CTYA 1ZX9A 3II4A 3L8KA 3H8LA 4A79A 1FECA 1QJDA 3F8DA 2DKHA 1F3PA 1YKJA 3AYIA 4TM4A 3LZXA 3NNEA 3CIRA 4LIIA 1PBDA 3DK8A 2CFYA 4PAAA 4USQA 4D04A 5IQ4A 1F8SA 2IIDA 4A65A 4Z26A 1PDHA 3ZDNA 2JAEA 1NAAA 4DGKA 2GV8A 3IF9A 1P2HA 2E81A 5FMHA 2E5VA 3BNJA 4Z2UA 1O94A 3AD9B 3NLCA 1JRYA 1NHRA 4U8NA 4ZCDA 2C70A 4B63A 2J7AA 2YG3A 2EQ6A 2XFQA 4GF7A 4I58A 3FG2P 2AAQA 1QDBA 3DJDA 3DGZA 4Y4NA 1LTXR 2YG5A 4Q0TA 1DJNA 5LV9A 3DMEA 2C75A 1OAHA 2V5ZA 5J7XA 4BJZA 4E0VA 1UKVG 4H2PA 5BRTA 4YSZA 3C96A 4ZN0A 2BCPA
chains in the Genus database with same CATH superfamily
1FS7A 5JCLA 3P4QA 1LVLA 2X99A 4Z24A 1TRBA 3P4RA 1BGJA 2XLSA 5FS6A 4Z2TA 4L38A 3FMWA 3UKQA 2XDOA 2Z5YA 5U1OA 4XXGA 4YTMA 4DSGA 3I6DA 3ICSA 3KKJA 2C72A 3ATQA 4GRTA 2WOWA 3CPHG 4K5RA 3SZFA 1BGNA 4TM3A 3RHAA 1GV4A 1CJ4A 1DNCA 3AEAA 3C4AA 3OWMA 5HHFA 2GF3A 3NIXA 1D4EA 4APNA 1PXCA 1O5WA 4NNJA 1B4VA 2XLUA 1GU6A 3CGEA 3EF6A 1GRHA 3URHA 4X4JA 4UP3A 4ECHA 2K3VA 4AT0A 2IVDA 4G73A 4C3XA 2VVLG 4A6NA 1TDFA 4AP1A 2XVJA 3NYFA 3P4PA 1EBDA 2R4JA 2PHHA 3UCLA 3CNJA 3VRDB 2BA9A 3T2ZA 1TDKA 2JBVA 2RGJA 1KNRA 5GRTA 2WOVA 4YT0A 2B7RA 1M1RA 3BNMA 2BYBA 2WETA 5KMQA 1PJ6A 4UDPA 4U8PA 2NPXA 5JCMA 1BZLA 1CHUA 2WPCA 3LG1A 4YSHA 3AE2A 3AEDA 2BC0A 1E6EA 3UP5A 2FJAA 1DOEA 4AOSA 2BRYA 4B68A 4BK2A 3FO3A 1GNDA 4JDRA 4CCRA 3L1TA 4J33A 2QA2A 1PJ7A 3LXDA 5KMPA 2CZSA 1D7YA 1OJDA 2E1MA 3SQPA 3BI2A 4DNAA 2YLTA 1NDAA 2WESA 1FCDA 2WBAA 4H4YA 4REKA 3T37A 3RNMA 2AQJA 2QAEA 4KX6A 4J56A 1RYIA 3D8XA 3TORA 4AOXA 4II3A 3IC9A 4H4TA 3GDNA 2ZZCA 1K0IA 3ZYXA 4CCQA 2Q7VA 2QA1A 3DK9A 3VR8A 3S61A 2JB1A 2WP9A 3CGDA 3H8IA 1F8RA 1LPFA 3F8PA 1ELIA 1COYA 3K7QX 3NKSA 4DSHA 4HA6A 4B64A 4CY6A 5JCIA 3KPFA 3UOVA 3UTHA 1S3EA 2XVFA 1E39A 3KU9A 5EB4A 5FS7A 1SEZA 2BXSA 2YM2A 3NTDA 3AB1A 5M0ZA 1IUWA 4WCTA 1FT6A 2GQWA 1SP3A 2Q0KA 3ADAB 3B3RA 3GYIA 3L1RA 1CBOA 4JNQA 5U63A 5J60A 3AD8B 4BURA 1YQ3A 4U8MA 3AE1A 4EMIA 4Y4MA 4Q1OA 2R0GA 4U2LA 1CC4A 4IA5A 4K5SA 1TYPA 2Z5XA 1BF3A 2WEUA 2Q6UA 1VQWA 1B37A 4OCGA 4L3XA 4P9SA 1XANA 3UKKA 3COXA 1S2YA 1X31B 4NZHA 1DOBA 4U8JA 2GRTA 1PN0A 4WJYA 5HYMA 1PJ5A 3EANA 4ICYA 1DXLA 1N4UA 4H4ZA 4LU6A 5FS9A 2XCGA 1F8WA 4YTPA 3NHOX 3QVPA 4XWRA 4EMWA 4CNKA 4X9NA 1MO9A 1REOA 1RP0A 4B67A 3REDA 1M64A 2CULA 1L9DA 1KFYA 2F5ZA 2OLNA 3UKLA 3K7MX 3V76A 1E1KA 3PVCA 2APGA 4GDPA 1PBBA 4EQSA 3BI4A 3GSIA 2YLRA 1FS9A 4H50A 4B66A 2A8XA 1Y56B 4A7AA 1GXFA 2JKCA 2W0HA 2YVGA 2J3NA 4OPLA 3ALLA 2X8GA 1L0VA 3QSEA 4C5OA 3K7TA 2R0PA 4U2SA 3DJJA 4JY2A 1V59A 1EL9A 4A5LA 2ZBWA 2BCGG 3C4NA 3AXBA 3CN8A 5KMSA 4L3YA 1N4VA 3CGBA 2GAHB 3G5QA 5M10A 1S2QA 2PYXA 2OAMA 2WHDA 1ZMCA 4YKFA 5HXIA 3GD3A 3DJGX 3LJPA 1H6VA 5KWFA 4U8KA 4A99A 3PO7A 2VOUA 1QO8A 4ADWA 1K0LA 1Y0PA 3BNHA 4Q17A 4H4RA 4C3YA 1FOHA 2CDUA 3AE4A 3NH3X 1ZMDA 3BNFA 3RKHA 2OLOA 3KA7A 1OJ9A 2VRMA 2YR6A 2YLSA 2XFPA 2O9ZA 4FK1C 3V3OA 2GMJA 5KVIA 3ITJA 1GRGA 1NHSA 3F8RA 1E1LA 2B9XA 2YAUA 2YR5A 5C3JA 3G5RA 2VZ2A 3HYWA 4EQXA 2XLRA 2C76A 3GM6A 1TYTA 1KDGA 2RABA 1L9CA 3NK1X 4H4SA 4OPCA 4IA6A 1ZOYA 4BK1A 1H7XA 2BXRA 2YLWA 3TTBA 3MMOA 2VR0A 1PBFA 1JOAA 1B8SA 4B69A 2EQ8A 2GH5A 2YQUA 3IHGA 4MJWA 1KF6A 2RGOA 3AECA 3CPIG 3NK2X 4U8IA 3UKPA 3SZWA 3UOXA 3ABVA 3UKAA 1NHPA 3BHKA 3GWFA 3GRTA 3M12A 1H83A 4H4VA 4NTDA 4NWZA 4CY8A 3S5WA 1NHQA 3Q9TA 1DOCA 4A9WA 4EMJA 4C74A 2GQFA 4J31A 3SFEA 3NYCA 1CF3A 2WDQA 2C3DA 2XLTA 4EM3A 1JEHA 2GEWA 2IVEA 1NENA 4TLXA 1M1PA 4IV9A 2GAGB 3SGLA 3OC4A 1D4CA 5IPYA 4GR1A 1F6MA 2WPFA 4JNAA 2C73A 1D7LA 3QVRA 3SY4A 5EOWA 1GETA 3NTAA 2AR8A 3QSSA 1PXAA 1IJHA 2C4CA 3IHMA 4H4XA 3NK0X 3F29A 1AOGA 2FBWA 4K8DA 4J34A 3T0KA 2YLZA 3EAOA 3BNGA 4YKGA 3ATRA 1IUVA 3DK4A 4TM1A 1PBCA 4YXDA 2C67A 4YSXA 4RG4A 4CNJA 3CGCA 2WP5A 4WX1A 2ACZA 5KXJA 1GESA 1XPQA 4K22A 1ZOVA 1NEKA 4GCMA 1KSUA 1IUXA 3RP8A 4YSYA 2BK4A 2XVIA 3EPTA 4H4UA 2OT4A 3VQRA 4AP3A 3FIMB 5HY5A 5KRQA 4Z44A 2XLPA 2VRLA 4TM0A 1FS8A 3KD9A 3LB8A 3WE0A 2V3AA 3DA1A 3I3LA 4PABA 1JRZA 1MOKA 5EB5A 1GTHA 3NT6A 4C77A 3PS9A 3NGCX 2BS4A 3QFBA 3T31A 5KMRA 1E1NA 1VG9A 4OPTA 2ZZBA 1YQZA 4H7UA 3QSMA 2FJBA 2GVCA 4FK1A 1CC6A 4J36A 3DH9A 3VRBA 3NN0X 4Z43A 2ZO5A 3ALJA 3NYEA 2WQYA 4EIPA 1BKWA 2BS2A 1JNZA 3AE8A 3LOVA 3UU9A 2E80A 1KSSA 1ZDLA 2R9ZA 2YG4A 2E4GA 2RGHA 3UTFA 1LQTA 5TR3A 4H4PA 3AYJA 1JNIA 3AYLA 2ZZ0A 4RSLA 3O0HA 1B5QA 2YG6A 1EL8A 5JCKA 1LQUA 1XDIA 4NTCA 4B1BA 1GOSA 2BC1A 4BJYA 4EQRA 3SXQA 4H2RA 4NEVA 1MXTA 1GPEA 3Q6JA 1GEUA 4H2QA 3SZCA 1NG3A 2EQ7A 4OPIA 4UDQA 3GDPA 3P1WA 4XWZA 1NG4A 1ZKQA 2BS3A 4EQWA 2BABA 4YWOA 4OPUA 4JQ9A 4II2A 4AT2A 4Z25A 2GMHA 2GB0A 3QJ4A 4U8LA 4YTNA 1TDNA 3HYVA 3M13A 1N4WA 3GWDA 4B65A 2VVLA 4LA1A 1YQ4A 2BK3A 3UKFA 4G74A 3UBRA 2V6OA 2BRAA 3QFAA 4OVIA 2B9WA 4ZCCA 3AD7B 3SX6A 2V60A 4OPGA 4O5UA 5C2TA 2JB2A 4Q5BA 4A6NB 2X8CA 4K7ZA 4H4QA 1ZK7A 1D4DA 5EBKA 3LGQA 1DJQA 2WS3A 2YVJA 1JNRA 3D1IA 2H88A 2CVJA 3GD4A 2BACA 4G6HA 3GRSA 1GT8A 3ALMA 4EIQA 3P4SA 1PXBA 2WU2A 1CJ2A 1TDOA 2GR2A 1ONFA 1GREA 2FJEA 4Y4LA 3SCEA 1ZP0A 2C64A 2JK6A 1Q9IA 1LJ1A 5BUKA 4CRTA 3GYJA 3CNPA 1O95A 2WP6A 3RP7A 2B76A 4J2WA 1CJ3A 2TMDA 3VRAA 2X3NA 1E7PA 5KOXA 3JSKA 3CNDA 4Q4UA 3GYXA 3NN6X 2OA1A 3UTEA 5KOWA 1CJCA 1QLBA 1H7WA 3SYIA 1Q1WA 4EM4A 4JN9A 1M1QA 3IWAA 3OZ2A 5U25A 1Y56A 1VRQB 2XFNA 3T2KA 1FEAA 2TPRA 1CL0A 2A87A 2VQBA 2YLXA 4GUVA 2HQMA 1Z6LA 3CNTA 3FBSA 3RP6A 2YVFA 2YWLA 2YR4A 2JB3A 3GMCA 4G6GA 4O5QA 4U2TA 1KNPA 4GAPA 3UP4A 2GR1A 3ICTA 2UZZA 2FJDA 2EQ9A 2OALA 1PBEA 3M0OA 1GRFA 1N1PA 2V3BA 3AEEA 3ICRA 3UOYA 1H81A 1W4XA 2Q0LA 3P9UA 5KNLA 5JCNA 1E1MA 1GRAA 3DGHA 4HB9A 4NTEA 3AE5A 1FEBA 2XFUA 3G5SA 1VG0A 3HYXA 4K2XA 1GTEA 1GERA 5CKUA 1EL7A 1Q1RA 1GALA 4N9XA 1P2EA 1JRXA 1H82A 2WOIA 3B6DA 4M52A 1IUUA 3D1CA 1D5TA 2DKIA 2R0CA 3BHFA 1DODA 3CMMA 4U8OA 3S7WA 4X9MA 2LFCA 1IUSA 3UOZA 4D03A 1LV0A 2XVEA 1H84A 3ISHA 3SFDA 2WDRA 4J57A 4TLZA 1IUTA 1GRTA 4USRA 5DBJA 3BNUA 3LZWA 4RG3A 3DJEA 3HZLA 4IVMB 4FDCB 3AE7A 4UDRA 2NVKX 1H86A 5GSNA 2WDVA 3V3NA 2BK5A 1GRBA 1VDCA 3AEGA 3AEBA 3AEFA 1OJAA 3AE3A 1ZY8A 2XFOA 5KVHA 4IVOB 3AE6A 5L46A 2WPEA 3FPZA 3SXIA 2C66A 3KLJA 4JY3A 4NEWA 3LADA 1OJCA 3AE9A 1M6IA 2QCUA 4GDEA 1S3BA 2I0ZA 1OJTA 4GAVA 2R46A 2RF7A 1CC2A 4Z2RA 2YM1A 3K30A 4BK3A 3VR9A 4BV6A 2A89A 2R4EA 1RSGA 1FL2A 3R9UA 1TDEA 2X50A 1NPXA 2XVHA 4KPRA 1YY5A 2VVMA 4G9KA 5CQFA 4H2NA 1K4QA 4CBQA 2B9YA 2GR3A 5IQ1A 2Y6RA 1BWCA 2YG7A 2Y6QA 5BULA 4Q5CA 1PS9A 1HYUA 2WU5A 1XHCA 2XYOA 3E1TA 1PHHA 4FX9A 3SM8A 2C65A 5FS8A 1K0JA 2C3CA 3UKHA 1BVBA 2B7SA 2RDZA 2R45A 3BI5A 3KPKA 4I59A 3T2YA 3NG7X 3UTGA 1EL5A 2V61A 1L9EA 2H89A 1GSNA 1FT5A 4OPDA 2C7GA 3H4KA 3NRNA 5ER0A 1JU2A 2X8HA 3AWIA 4H4WA 2ARDA 2GR0A 3KVEA 3CPJG 4L3ZA 3CNSA 3GMBA 5BVAA 2VQ7A 3CTYA 1ZX9A 3II4A 3L8KA 3H8LA 4A79A 1FECA 1QJDA 3F8DA 2DKHA 1F3PA 1YKJA 3SZ0A 3AYIA 4TM4A 3LZXA 3NNEA 3CIRA 4LIIA 1PBDA 3DK8A 2CFYA 4PAAA 4USQA 4D04A 5IQ4A 1F8SA 2IIDA 4A65A 4Z26A 1PDHA 3ZDNA 2JAEA 1NAAA 4DGKA 2GV8A 3IF9A 1P2HA 2E81A 5FMHA 2E5VA 3BNJA 4Z2UA 1O94A 3AD9B 3NLCA 1JRYA 1NHRA 4U8NA 4ZCDA 2C70A 4B63A 2J7AA 2YG3A 2EQ6A 2XFQA 4GF7A 4I58A 3T14A 3FG2P 2AAQA 1QDBA 3DJDA 3DGZA 4Y4NA 1LTXR 2YG5A 4Q0TA 1DJNA 5LV9A 3DMEA 2C75A 1OAHA 2V5ZA 5J7XA 4BJZA 4E0VA 1UKVG 4H2PA 5BRTA 4YSZA 3C96A 4ZN0A 2BCPA
chains in the Genus database with same CATH topology
1FS7A 5JCLA 3P4QA 1LVLA 2X99A 4Z24A 1TRBA 3P4RA 1BGJA 2XLSA 5FS6A 4Z2TA 4L38A 3FMWA 3UKQA 2XDOA 2Z5YA 5U1OA 4XXGA 4YTMA 4DSGA 3I6DA 3ICSA 3KKJA 2C72A 3ATQA 4GRTA 2WOWA 3CPHG 4K5RA 3SZFA 1BGNA 4TM3A 3RHAA 1GV4A 1CJ4A 1DNCA 3AEAA 3C4AA 3OWMA 5HHFA 2GF3A 3NIXA 1D4EA 4APNA 1PXCA 1O5WA 4NNJA 1B4VA 2XLUA 1GU6A 3CGEA 3EF6A 1GRHA 3URHA 4X4JA 4UP3A 4ECHA 2K3VA 4AT0A 2IVDA 4G73A 4C3XA 2VVLG 4A6NA 1TDFA 4AP1A 2XVJA 3NYFA 3P4PA 1EBDA 2R4JA 2PHHA 3UCLA 3CNJA 3VRDB 2BA9A 3T2ZA 1TDKA 2JBVA 2RGJA 1KNRA 5GRTA 2WOVA 4YT0A 2B7RA 1M1RA 3BNMA 2BYBA 2WETA 5KMQA 1PJ6A 4UDPA 4U8PA 2NPXA 5JCMA 1BZLA 1CHUA 2WPCA 3LG1A 4YSHA 3AE2A 3AEDA 2BC0A 1E6EA 3UP5A 2FJAA 1DOEA 4AOSA 2BRYA 4B68A 4BK2A 3FO3A 1GNDA 4JDRA 4CCRA 3L1TA 4J33A 2QA2A 1PJ7A 3LXDA 5KMPA 1D7YA 1OJDA 2E1MA 3SQPA 3BI2A 4DNAA 2YLTA 1NDAA 2WESA 1FCDA 2WBAA 4H4YA 4REKA 3T37A 3RNMA 2AQJA 2QAEA 4KX6A 4J56A 1RYIA 3D8XA 3TORA 4AOXA 4II3A 3IC9A 4H4TA 3GDNA 2ZZCA 1K0IA 3ZYXA 4CCQA 2Q7VA 2QA1A 3DK9A 3VR8A 3S61A 2JB1A 2WP9A 3CGDA 3H8IA 1F8RA 1LPFA 3F8PA 1ELIA 1COYA 3K7QX 3NKSA 4DSHA 4HA6A 4B64A 4CY6A 5JCIA 3KPFA 3UOVA 3UTHA 1S3EA 2XVFA 1E39A 3KU9A 5EB4A 5FS7A 1SEZA 2BXSA 2YM2A 3NTDA 3AB1A 5M0ZA 1IUWA 4WCTA 1FT6A 2GQWA 1SP3A 2Q0KA 3ADAB 3B3RA 3GYIA 3L1RA 1CBOA 4JNQA 5U63A 5J60A 3AD8B 4BURA 1YQ3A 4U8MA 3AE1A 4EMIA 4Y4MA 4Q1OA 2R0GA 4U2LA 1CC4A 4IA5A 4K5SA 1TYPA 2Z5XA 1BF3A 2WEUA 2Q6UA 1VQWA 1B37A 4OCGA 4L3XA 4P9SA 1XANA 3UKKA 3COXA 1S2YA 1X31B 4NZHA 1DOBA 4U8JA 2GRTA 1PN0A 4WJYA 5HYMA 1PJ5A 3EANA 4ICYA 1DXLA 1N4UA 4H4ZA 4LU6A 5FS9A 2XCGA 1F8WA 4YTPA 3NHOX 3QVPA 4XWRA 4EMWA 4CNKA 4X9NA 1MO9A 1REOA 1RP0A 4B67A 3REDA 1M64A 2CULA 1L9DA 1KFYA 2F5ZA 2OLNA 3UKLA 3K7MX 3V76A 1E1KA 3PVCA 2APGA 4GDPA 1PBBA 4EQSA 3BI4A 3GSIA 2YLRA 1FS9A 4H50A 4B66A 2A8XA 1Y56B 4A7AA 1GXFA 2JKCA 2W0HA 2YVGA 2J3NA 4OPLA 3ALLA 2X8GA 1L0VA 3QSEA 4C5OA 3K7TA 2R0PA 4U2SA 3DJJA 4JY2A 1V59A 1EL9A 4A5LA 2ZBWA 2BCGG 3C4NA 3AXBA 3CN8A 5KMSA 4L3YA 1N4VA 3CGBA 2GAHB 3G5QA 5M10A 1S2QA 2PYXA 2OAMA 2WHDA 1ZMCA 4YKFA 5HXIA 3GD3A 3DJGX 3LJPA 1H6VA 5KWFA 4U8KA 4A99A 3PO7A 2VOUA 1QO8A 4ADWA 1K0LA 1Y0PA 3BNHA 4Q17A 4H4RA 4C3YA 1FOHA 2CDUA 3AE4A 3NH3X 1ZMDA 3BNFA 3RKHA 2OLOA 3KA7A 1OJ9A 2VRMA 2YR6A 2YLSA 2XFPA 2O9ZA 4FK1C 3V3OA 2GMJA 5KVIA 3ITJA 1GRGA 1NHSA 3F8RA 1E1LA 2B9XA 2YAUA 2YR5A 5C3JA 3G5RA 2VZ2A 3HYWA 4EQXA 2XLRA 2C76A 3GM6A 1TYTA 1KDGA 2RABA 1L9CA 3NK1X 4H4SA 4OPCA 4IA6A 1ZOYA 4BK1A 1H7XA 2BXRA 2YLWA 3TTBA 3MMOA 2VR0A 1PBFA 1JOAA 1B8SA 4B69A 2EQ8A 2GH5A 2YQUA 3IHGA 4MJWA 1KF6A 2RGOA 3AECA 3CPIG 3NK2X 4U8IA 3UKPA 3SZWA 3UOXA 3ABVA 3UKAA 1NHPA 3BHKA 3GWFA 3GRTA 3M12A 1H83A 4H4VA 4NTDA 4NWZA 4CY8A 3S5WA 1NHQA 3Q9TA 1DOCA 4A9WA 4EMJA 4C74A 2GQFA 4J31A 3SFEA 3NYCA 1CF3A 2WDQA 2C3DA 2XLTA 4EM3A 1JEHA 2GEWA 2IVEA 1NENA 4TLXA 1M1PA 4IV9A 2GAGB 3SGLA 3OC4A 1D4CA 5IPYA 4GR1A 1F6MA 2WPFA 4JNAA 2C73A 1D7LA 3QVRA 3SY4A 5EOWA 1GETA 3NTAA 2AR8A 3QSSA 1PXAA 1IJHA 2C4CA 3IHMA 4H4XA 3NK0X 3F29A 1AOGA 2FBWA 4K8DA 4J34A 3T0KA 2YLZA 3EAOA 3BNGA 4YKGA 3ATRA 1IUVA 3DK4A 4TM1A 1PBCA 4YXDA 2C67A 4YSXA 4RG4A 4CNJA 3CGCA 2WP5A 4WX1A 2ACZA 5KXJA 1GESA 1XPQA 4K22A 1ZOVA 1NEKA 4GCMA 1KSUA 1IUXA 3RP8A 4YSYA 2BK4A 2XVIA 3EPTA 4H4UA 2OT4A 3VQRA 4AP3A 3FIMB 5HY5A 5KRQA 4Z44A 2XLPA 2VRLA 4TM0A 1FS8A 3KD9A 3LB8A 3WE0A 2V3AA 3DA1A 3I3LA 4PABA 1JRZA 1MOKA 5EB5A 1GTHA 3NT6A 4C77A 3PS9A 3NGCX 2BS4A 3QFBA 3T31A 5KMRA 1E1NA 1VG9A 4OPTA 2ZZBA 1YQZA 4H7UA 3QSMA 2FJBA 2GVCA 4FK1A 1CC6A 4J36A 3DH9A 3VRBA 3NN0X 4Z43A 2ZO5A 3ALJA 3NYEA 2WQYA 4EIPA 1BKWA 2BS2A 1JNZA 3AE8A 3LOVA 3UU9A 2E80A 1KSSA 1ZDLA 2R9ZA 2YG4A 2E4GA 2RGHA 3UTFA 1LQTA 5TR3A 4H4PA 3AYJA 1JNIA 3AYLA 2ZZ0A 4RSLA 3O0HA 1B5QA 2YG6A 1EL8A 5JCKA 1LQUA 1XDIA 4NTCA 4B1BA 1GOSA 2BC1A 4BJYA 4EQRA 3SXQA 4H2RA 4NEVA 1MXTA 1GPEA 3Q6JA 1GEUA 4H2QA 3SZCA 1NG3A 2EQ7A 4OPIA 4UDQA 3GDPA 3P1WA 4XWZA 1NG4A 1ZKQA 2BS3A 4EQWA 2BABA 4YWOA 4OPUA 4JQ9A 4II2A 4AT2A 4Z25A 2GMHA 2GB0A 3QJ4A 4U8LA 4YTNA 1TDNA 3HYVA 3M13A 1N4WA 3GWDA 4B65A 2VVLA 4LA1A 1YQ4A 2BK3A 3UKFA 4G74A 3UBRA 2V6OA 2BRAA 3QFAA 4OVIA 2B9WA 4ZCCA 3AD7B 3SX6A 2V60A 4OPGA 4O5UA 5C2TA 2JB2A 4Q5BA 4A6NB 2X8CA 4K7ZA 4H4QA 1ZK7A 1D4DA 5EBKA 3LGQA 1DJQA 2WS3A 2YVJA 1JNRA 3D1IA 2H88A 2CVJA 3GD4A 2BACA 4G6HA 3GRSA 1GT8A 3ALMA 4EIQA 3P4SA 1PXBA 2WU2A 1CJ2A 1TDOA 2GR2A 1ONFA 1GREA 2FJEA 4Y4LA 3SCEA 1ZP0A 2C64A 2JK6A 1Q9IA 1LJ1A 5BUKA 4CRTA 3GYJA 3CNPA 1O95A 2WP6A 3RP7A 2B76A 4J2WA 1CJ3A 2TMDA 3VRAA 2X3NA 1E7PA 5KOXA 3JSKA 3CNDA 4Q4UA 3GYXA 3NN6X 2OA1A 3UTEA 5KOWA 1CJCA 1QLBA 1H7WA 3SYIA 1Q1WA 4EM4A 4JN9A 1M1QA 3IWAA 3OZ2A 5U25A 1Y56A 1VRQB 2XFNA 3T2KA 1FEAA 2TPRA 1CL0A 2A87A 2VQBA 2YLXA 4GUVA 2HQMA 1Z6LA 3CNTA 3FBSA 3RP6A 2YVFA 2YWLA 2YR4A 2JB3A 3GMCA 4G6GA 4O5QA 4U2TA 1KNPA 4GAPA 3UP4A 2GR1A 3ICTA 2UZZA 2FJDA 2EQ9A 2OALA 1PBEA 3M0OA 1GRFA 1N1PA 2V3BA 3AEEA 3ICRA 3UOYA 1H81A 1W4XA 2Q0LA 3P9UA 5KNLA 5JCNA 1E1MA 1GRAA 3DGHA 4HB9A 4NTEA 3AE5A 1FEBA 2XFUA 3G5SA 1VG0A 3HYXA 4K2XA 1GTEA 1GERA 5CKUA 1EL7A 1Q1RA 1GALA 4N9XA 1P2EA 1JRXA 1H82A 2WOIA 3B6DA 4M52A 1IUUA 3D1CA 1D5TA 2DKIA 2R0CA 3BHFA 1DODA 3CMMA 4U8OA 3S7WA 4X9MA 2LFCA 1IUSA 3UOZA 4D03A 1LV0A 2XVEA 1H84A 3ISHA 3SFDA 2WDRA 4J57A 4TLZA 1IUTA 1GRTA 4USRA 5DBJA 3BNUA 3LZWA 4RG3A 3DJEA 3HZLA 4IVMB 4FDCB 3AE7A 4UDRA 2NVKX 1H86A 5GSNA 2WDVA 3V3NA 2BK5A 1GRBA 1VDCA 3AEGA 3AEBA 3AEFA 1OJAA 3AE3A 1ZY8A 2XFOA 5KVHA 4IVOB 3AE6A 5L46A 2WPEA 3FPZA 3SXIA 2C66A 3KLJA 4JY3A 4NEWA 3LADA 1OJCA 3AE9A 1M6IA 2QCUA 4GDEA 1S3BA 2I0ZA 1OJTA 4GAVA 2R46A 2RF7A 1CC2A 4Z2RA 2YM1A 3K30A 4BK3A 3VR9A 4BV6A 2A89A 2R4EA 1RSGA 1FL2A 3R9UA 1TDEA 2X50A 1NPXA 2XVHA 4KPRA 1YY5A 2VVMA 4G9KA 5CQFA 4H2NA 1K4QA 4CBQA 2B9YA 2GR3A 5IQ1A 2Y6RA 1BWCA 2YG7A 2Y6QA 5BULA 4Q5CA 1PS9A 1HYUA 2WU5A 1XHCA 2XYOA 3E1TA 1PHHA 4FX9A 3SM8A 2C65A 5FS8A 1K0JA 2C3CA 3UKHA 1BVBA 2B7SA 2RDZA 2R45A 3BI5A 3KPKA 4I59A 3T2YA 3NG7X 3UTGA 1EL5A 2V61A 1L9EA 2H89A 1GSNA 1FT5A 4OPDA 2C7GA 3H4KA 3NRNA 5ER0A 1JU2A 2X8HA 3AWIA 4H4WA 2ARDA 2GR0A 3KVEA 3CPJG 4L3ZA 3CNSA 3GMBA 5BVAA 2VQ7A 3CTYA 1ZX9A 3II4A 3L8KA 3H8LA 4A79A 1FECA 1QJDA 3F8DA 2DKHA 1F3PA 1YKJA 3SZ0A 3AYIA 4TM4A 3LZXA 3NNEA 3CIRA 4LIIA 1PBDA 3DK8A 2CFYA 4PAAA 4USQA 4D04A 5IQ4A 1F8SA 2IIDA 4A65A 4Z26A 1PDHA 3ZDNA 2JAEA 1NAAA 4DGKA 2GV8A 3IF9A 1P2HA 2E81A 5FMHA 2E5VA 3BNJA 4Z2UA 1O94A 3AD9B 3NLCA 1JRYA 1NHRA 4U8NA 4ZCDA 2C70A 4B63A 2J7AA 2YG3A 2EQ6A 2XFQA 4GF7A 4I58A 3T14A 3FG2P 2AAQA 1QDBA 3DJDA 3DGZA 4Y4NA 1LTXR 2YG5A 4Q0TA 1DJNA 5LV9A 3DMEA 2C75A 1OAHA 2V5ZA 5J7XA 4BJZA 4E0VA 1UKVG 4H2PA 5BRTA 4YSZA 3C96A 4ZN0A 2BCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FS7 A;  5JCL A;  3P4Q A;  1LVL A;  2X99 A;  4Z24 A;  1TRB A;  3P4R A;  1BGJ A;  2XLS A;  5FS6 A;  4Z2T A;  4L38 A;  3FMW A;  3UKQ A;  2XDO A;  2Z5Y A;  5U1O A;  4XXG A;  4YTM A;  4DSG A;  3I6D A;  3ICS A;  3KKJ A;  2C72 A;  3ATQ A;  4GRT A;  2WOW A;  3CPH G;  4K5R A;  1BGN A;  4TM3 A;  3RHA A;  1GV4 A;  1CJ4 A;  1DNC A;  3AEA A;  3C4A A;  3OWM A;  5HHF A;  2GF3 A;  3NIX A;  1D4E A;  4APN A;  1PXC A;  1O5W A;  1B4V A;  2XLU A;  1GU6 A;  3CGE A;  3EF6 A;  1GRH A;  3URH A;  4X4J A;  4UP3 A;  4ECH A;  2K3V A;  4AT0 A;  2IVD A;  4C3X A;  2VVL G;  4A6N A;  1TDF A;  4AP1 A;  2XVJ A;  3NYF A;  3P4P A;  1EBD A;  2R4J A;  2PHH A;  3UCL A;  3CNJ A;  3VRD B;  2BA9 A;  1TDK A;  2JBV A;  2RGJ A;  1KNR A;  5GRT A;  2WOV A;  4YT0 A;  2B7R A;  1M1R A;  3BNM A;  2BYB A;  2WET A;  1PJ6 A;  4UDP A;  4U8P A;  2NPX A;  5JCM A;  1BZL A;  1CHU A;  2WPC A;  3LG1 A;  4YSH A;  3AE2 A;  3AED A;  2BC0 A;  1E6E A;  3UP5 A;  2FJA A;  1DOE A;  4AOS A;  4B68 A;  4BK2 A;  3FO3 A;  1GND A;  4JDR A;  4CCR A;  3L1T A;  4J33 A;  2QA2 A;  1PJ7 A;  3LXD A;  1D7Y A;  1OJD A;  2E1M A;  3SQP A;  3BI2 A;  4DNA A;  2YLT A;  1NDA A;  2WES A;  1FCD A;  2WBA A;  4H4Y A;  4REK A;  3T37 A;  3RNM A;  2AQJ A;  2QAE A;  4KX6 A;  4J56 A;  1RYI A;  3D8X A;  3TOR A;  4AOX A;  3IC9 A;  4H4T A;  3GDN A;  2ZZC A;  1K0I A;  3ZYX A;  4CCQ A;  2Q7V A;  2QA1 A;  3DK9 A;  3VR8 A;  3S61 A;  2JB1 A;  2WP9 A;  3CGD A;  3H8I A;  1F8R A;  1LPF A;  3F8P A;  1ELI A;  1COY A;  3K7Q X;  3NKS A;  4DSH A;  4HA6 A;  4B64 A;  4CY6 A;  5JCI A;  3KPF A;  3UOV A;  3UTH A;  1S3E A;  2XVF A;  1E39 A;  3KU9 A;  5EB4 A;  5FS7 A;  1SEZ A;  2BXS A;  2YM2 A;  3NTD A;  3AB1 A;  5M0Z A;  1IUW A;  4WCT A;  1FT6 A;  2GQW A;  1SP3 A;  2Q0K A;  3ADA B;  3B3R A;  3GYI A;  3L1R A;  1CBO A;  4JNQ A;  5U63 A;  5J60 A;  3AD8 B;  4BUR A;  1YQ3 A;  4U8M A;  3AE1 A;  4EMI A;  4Y4M A;  4Q1O A;  2R0G A;  4U2L A;  1CC4 A;  4IA5 A;  4K5S A;  1TYP A;  2Z5X A;  1BF3 A;  2WEU A;  2Q6U A;  1VQW A;  1B37 A;  4OCG A;  4L3X A;  4P9S A;  1XAN A;  3UKK A;  3COX A;  1S2Y A;  1X31 B;  4NZH A;  1DOB A;  4U8J A;  2GRT A;  1PN0 A;  4WJY A;  5HYM A;  1PJ5 A;  3EAN A;  4ICY A;  1DXL A;  1N4U A;  4H4Z A;  4LU6 A;  5FS9 A;  2XCG A;  1F8W A;  4YTP A;  3NHO X;  3QVP A;  4XWR A;  4EMW A;  4CNK A;  4X9N A;  1MO9 A;  1REO A;  1RP0 A;  4B67 A;  3RED A;  1M64 A;  2CUL A;  1L9D A;  1KFY A;  2F5Z A;  2OLN A;  3UKL A;  3K7M X;  3V76 A;  1E1K A;  3PVC A;  2APG A;  4GDP A;  1PBB A;  4EQS A;  3BI4 A;  3GSI A;  2YLR A;  1FS9 A;  4H50 A;  4B66 A;  2A8X A;  1Y56 B;  4A7A A;  1GXF A;  2JKC A;  2W0H A;  2YVG A;  2J3N A;  4OPL A;  3ALL A;  2X8G A;  1L0V A;  3QSE A;  4C5O A;  3K7T A;  2R0P A;  4U2S A;  3DJJ A;  4JY2 A;  1V59 A;  1EL9 A;  4A5L A;  2ZBW A;  2BCG G;  3C4N A;  3AXB A;  3CN8 A;  4L3Y A;  1N4V A;  3CGB A;  2GAH B;  3G5Q A;  5M10 A;  1S2Q A;  2PYX A;  2OAM A;  2WHD A;  1ZMC A;  4YKF A;  5HXI A;  3GD3 A;  3DJG X;  3LJP A;  1H6V A;  5KWF A;  4U8K A;  4A99 A;  3PO7 A;  2VOU A;  1QO8 A;  4ADW A;  1K0L A;  1Y0P A;  3BNH A;  4Q17 A;  4H4R A;  4C3Y A;  1FOH A;  2CDU A;  3AE4 A;  3NH3 X;  1ZMD A;  3BNF A;  3RKH A;  2OLO A;  3KA7 A;  1OJ9 A;  2VRM A;  2YR6 A;  2YLS A;  2XFP A;  2O9Z A;  4FK1 C;  3V3O A;  2GMJ A;  5KVI A;  3ITJ A;  1GRG A;  1NHS A;  3F8R A;  1E1L A;  2B9X A;  2YAU A;  2YR5 A;  5C3J A;  3G5R A;  2VZ2 A;  4EQX A;  2XLR A;  2C76 A;  3GM6 A;  1TYT A;  1KDG A;  2RAB A;  1L9C A;  3NK1 X;  4H4S A;  4OPC A;  4IA6 A;  1ZOY A;  4BK1 A;  1H7X A;  2BXR A;  2YLW A;  3TTB A;  3MMO A;  2VR0 A;  1PBF A;  1JOA A;  1B8S A;  4B69 A;  2EQ8 A;  2GH5 A;  2YQU A;  3IHG A;  4MJW A;  1KF6 A;  2RGO A;  3AEC A;  3CPI G;  3NK2 X;  4U8I A;  3UKP A;  3UOX A;  3ABV A;  3UKA A;  1NHP A;  3BHK A;  3GWF A;  3GRT A;  3M12 A;  1H83 A;  4H4V A;  4NTD A;  4CY8 A;  3S5W A;  1NHQ A;  3Q9T A;  1DOC A;  4A9W A;  4EMJ A;  4C74 A;  2GQF A;  4J31 A;  3SFE A;  3NYC A;  1CF3 A;  2WDQ A;  2C3D A;  2XLT A;  4EM3 A;  1JEH A;  2GEW A;  2IVE A;  1NEN A;  4TLX A;  1M1P A;  4IV9 A;  2GAG B;  3SGL A;  3OC4 A;  1D4C A;  5IPY A;  4GR1 A;  1F6M A;  2WPF A;  4JNA A;  2C73 A;  1D7L A;  3QVR A;  5EOW A;  1GET A;  3NTA A;  2AR8 A;  3QSS A;  1PXA A;  1IJH A;  4H4X A;  3IHM A;  3NK0 X;  3F29 A;  1AOG A;  2FBW A;  4K8D A;  4J34 A;  2YLZ A;  3EAO A;  3BNG A;  4YKG A;  3ATR A;  1IUV A;  3DK4 A;  4TM1 A;  1PBC A;  4YXD A;  2C67 A;  4YSX A;  4RG4 A;  4CNJ A;  3CGC A;  2WP5 A;  4WX1 A;  2ACZ A;  5KXJ A;  1GES A;  1XPQ A;  4K22 A;  1ZOV A;  1NEK A;  4GCM A;  1KSU A;  1IUX A;  3RP8 A;  4YSY A;  2BK4 A;  2XVI A;  3EPT A;  4H4U A;  2OT4 A;  3VQR A;  4AP3 A;  3FIM B;  5HY5 A;  5KRQ A;  4Z44 A;  2XLP A;  2VRL A;  4TM0 A;  1FS8 A;  3KD9 A;  3LB8 A;  3WE0 A;  2V3A A;  3DA1 A;  3I3L A;  4PAB A;  1JRZ A;  1MOK A;  5EB5 A;  1GTH A;  3NT6 A;  4C77 A;  3PS9 A;  3NGC X;  2BS4 A;  3QFB A;  1E1N A;  1VG9 A;  4OPT A;  2ZZB A;  1YQZ A;  4H7U A;  3QSM A;  2FJB A;  2GVC A;  4FK1 A;  1CC6 A;  4J36 A;  3DH9 A;  3VRB A;  3NN0 X;  4Z43 A;  2ZO5 A;  3ALJ A;  3NYE A;  2WQY A;  4EIP A;  1BKW A;  2BS2 A;  1JNZ A;  3AE8 A;  3LOV A;  3UU9 A;  2E80 A;  1KSS A;  1ZDL A;  2R9Z A;  2YG4 A;  2E4G A;  2RGH A;  3UTF A;  1LQT A;  5TR3 A;  4H4P A;  3AYJ A;  1JNI A;  3AYL A;  2ZZ0 A;  4RSL A;  3O0H A;  1B5Q A;  2YG6 A;  1EL8 A;  5JCK A;  1LQU A;  1XDI A;  4NTC A;  4B1B A;  1GOS A;  2BC1 A;  4BJY A;  4EQR A;  3SXQ A;  4H2R A;  4NEV A;  1MXT A;  1GPE A;  3Q6J A;  1GEU A;  4H2Q A;  1NG3 A;  2EQ7 A;  4OPI A;  4UDQ A;  3GDP A;  3P1W A;  4XWZ A;  1NG4 A;  1ZKQ A;  2BS3 A;  4EQW A;  2BAB A;  4YWO A;  4OPU A;  4JQ9 A;  4AT2 A;  4Z25 A;  2GMH A;  2GB0 A;  3QJ4 A;  4U8L A;  4YTN A;  1TDN A;  3M13 A;  1N4W A;  3GWD A;  4B65 A;  2VVL A;  4LA1 A;  1YQ4 A;  2BK3 A;  3UKF A;  3UBR A;  2V6O A;  3QFA A;  4OVI A;  2B9W A;  4ZCC A;  3AD7 B;  2V60 A;  4OPG A;  4O5U A;  5C2T A;  2JB2 A;  4Q5B A;  4A6N B;  2X8C A;  4K7Z A;  4H4Q A;  1ZK7 A;  1D4D A;  5EBK A;  3LGQ A;  1DJQ A;  2WS3 A;  2YVJ A;  1JNR A;  3D1I A;  2H88 A;  2CVJ A;  3GD4 A;  2BAC A;  3GRS A;  1GT8 A;  3ALM A;  4EIQ A;  3P4S A;  1PXB A;  2WU2 A;  1CJ2 A;  1TDO A;  2GR2 A;  1ONF A;  1GRE A;  2FJE A;  4Y4L A;  3SCE A;  1ZP0 A;  2C64 A;  2JK6 A;  1Q9I A;  1LJ1 A;  5BUK A;  4CRT A;  3GYJ A;  3CNP A;  1O95 A;  2WP6 A;  3RP7 A;  2B76 A;  4J2W A;  1CJ3 A;  2TMD A;  3VRA A;  2X3N A;  1E7P A;  5KOX A;  3JSK A;  3CND A;  4Q4U A;  5KOW A;  3NN6 X;  2OA1 A;  3UTE A;  3GYX A;  1CJC A;  1QLB A;  1H7W A;  1Q1W A;  4EM4 A;  4JN9 A;  1M1Q A;  3IWA A;  3OZ2 A;  5U25 A;  1Y56 A;  1VRQ B;  2XFN A;  1FEA A;  2TPR A;  1CL0 A;  2A87 A;  2VQB A;  2YLX A;  4GUV A;  2HQM A;  1Z6L A;  3CNT A;  3FBS A;  3RP6 A;  2YVF A;  2YWL A;  2YR4 A;  2JB3 A;  3GMC A;  4O5Q A;  4U2T A;  1KNP A;  3UP4 A;  2GR1 A;  3ICT A;  2UZZ A;  2FJD A;  2EQ9 A;  2OAL A;  1PBE A;  3M0O A;  1GRF A;  1N1P A;  2V3B A;  3AEE A;  3ICR A;  3UOY A;  1H81 A;  1W4X A;  2Q0L A;  3P9U A;  5JCN A;  1E1M A;  1GRA A;  3DGH A;  4HB9 A;  4NTE A;  3AE5 A;  1FEB A;  2XFU A;  3G5S A;  1VG0 A;  4K2X A;  1GTE A;  1GER A;  5CKU A;  1EL7 A;  1Q1R A;  1GAL A;  4N9X A;  1P2E A;  1JRX A;  1H82 A;  2WOI A;  3B6D A;  4M52 A;  1IUU A;  3D1C A;  1D5T A;  2DKI A;  2R0C A;  3BHF A;  1DOD A;  4U8O A;  4X9M A;  3S7W A;  2LFC A;  1IUS A;  3UOZ A;  4D03 A;  1LV0 A;  2XVE A;  1H84 A;  3ISH A;  3SFD A;  2WDR A;  4J57 A;  4TLZ A;  1IUT A;  1GRT A;  4USR A;  5DBJ A;  3BNU A;  3LZW A;  4RG3 A;  3DJE A;  3HZL A;  4IVM B;  4FDC B;  3AE7 A;  4UDR A;  2NVK X;  1H86 A;  5GSN A;  2WDV A;  3V3N A;  2BK5 A;  1GRB A;  1VDC A;  3AEG A;  3AEB A;  3AEF A;  1OJA A;  3AE3 A;  1ZY8 A;  2XFO A;  5KVH A;  4IVO B;  3AE6 A;  5L46 A;  2WPE A;  3FPZ A;  2C66 A;  3KLJ A;  4JY3 A;  4NEW A;  3LAD A;  1OJC A;  3AE9 A;  1M6I A;  2QCU A;  4GDE A;  1S3B A;  2I0Z A;  1OJT A;  2R46 A;  2RF7 A;  1CC2 A;  4Z2R A;  2YM1 A;  3K30 A;  4BK3 A;  3VR9 A;  4BV6 A;  2A89 A;  2R4E A;  1RSG A;  1FL2 A;  3R9U A;  1TDE A;  2X50 A;  1NPX A;  2XVH A;  4KPR A;  1YY5 A;  2VVM A;  5CQF A;  4H2N A;  1K4Q A;  4CBQ A;  2B9Y A;  2GR3 A;  5IQ1 A;  2Y6R A;  1BWC A;  2YG7 A;  2Y6Q A;  5BUL A;  4Q5C A;  1PS9 A;  1HYU A;  2WU5 A;  1XHC A;  2XYO A;  3E1T A;  1PHH A;  4FX9 A;  3SM8 A;  2C65 A;  5FS8 A;  1K0J A;  2C3C A;  3UKH A;  1BVB A;  2B7S A;  2RDZ A;  2R45 A;  3BI5 A;  4I59 A;  3NG7 X;  3UTG A;  1EL5 A;  2V61 A;  1L9E A;  2H89 A;  1GSN A;  1FT5 A;  4OPD A;  2C7G A;  3H4K A;  3NRN A;  5ER0 A;  1JU2 A;  2X8H A;  3AWI A;  4H4W A;  2ARD A;  2GR0 A;  3KVE A;  3CPJ G;  4L3Z A;  3CNS A;  3GMB A;  5BVA A;  2VQ7 A;  3CTY A;  1ZX9 A;  3II4 A;  3L8K A;  3H8L A;  4A79 A;  1FEC A;  1QJD A;  3F8D A;  2DKH A;  1F3P A;  1YKJ A;  3AYI A;  4TM4 A;  3LZX A;  3NNE A;  3CIR A;  4LII A;  1PBD A;  3DK8 A;  2CFY A;  4PAA A;  4USQ A;  4D04 A;  5IQ4 A;  1F8S A;  2IID A;  4A65 A;  4Z26 A;  1PDH A;  3ZDN A;  2JAE A;  1NAA A;  4DGK A;  2GV8 A;  3IF9 A;  1P2H A;  2E81 A;  5FMH A;  2E5V A;  3BNJ A;  4Z2U A;  1O94 A;  3AD9 B;  3NLC A;  1JRY A;  1NHR A;  4U8N A;  4ZCD A;  2C70 A;  4B63 A;  2J7A A;  2YG3 A;  2EQ6 A;  2XFQ A;  4GF7 A;  4I58 A;  3FG2 P;  2AAQ A;  1QDB A;  3DJD A;  3DGZ A;  4Y4N A;  1LTX R;  2YG5 A;  4Q0T A;  1DJN A;  5LV9 A;  3DME A;  2C75 A;  1OAH A;  2V5Z A;  5J7X A;  4BJZ A;  4E0V A;  1UKV G;  4H2P A;  5BRT A;  4YSZ A;  3C96 A;  4ZN0 A;  2BCP A; 
#chains in the Genus database with same CATH topology
 1FS7 A;  5JCL A;  3P4Q A;  1LVL A;  2X99 A;  4Z24 A;  1TRB A;  3P4R A;  1BGJ A;  2XLS A;  5FS6 A;  4Z2T A;  4L38 A;  3FMW A;  3UKQ A;  2XDO A;  2Z5Y A;  5U1O A;  4XXG A;  4YTM A;  4DSG A;  3I6D A;  3ICS A;  3KKJ A;  2C72 A;  3ATQ A;  4GRT A;  2WOW A;  3CPH G;  4K5R A;  3SZF A;  1BGN A;  4TM3 A;  3RHA A;  1GV4 A;  1CJ4 A;  1DNC A;  3AEA A;  3C4A A;  3OWM A;  5HHF A;  2GF3 A;  3NIX A;  1D4E A;  4APN A;  1PXC A;  1O5W A;  4NNJ A;  1B4V A;  2XLU A;  1GU6 A;  3CGE A;  3EF6 A;  1GRH A;  3URH A;  4X4J A;  4UP3 A;  4ECH A;  2K3V A;  4AT0 A;  2IVD A;  4G73 A;  4C3X A;  2VVL G;  4A6N A;  1TDF A;  4AP1 A;  2XVJ A;  3NYF A;  3P4P A;  1EBD A;  2R4J A;  2PHH A;  3UCL A;  3CNJ A;  3VRD B;  2BA9 A;  3T2Z A;  1TDK A;  2JBV A;  2RGJ A;  1KNR A;  5GRT A;  2WOV A;  4YT0 A;  2B7R A;  1M1R A;  3BNM A;  2BYB A;  2WET A;  5KMQ A;  1PJ6 A;  4UDP A;  4U8P A;  2NPX A;  5JCM A;  1BZL A;  1CHU A;  2WPC A;  3LG1 A;  4YSH A;  3AE2 A;  3AED A;  2BC0 A;  1E6E A;  3UP5 A;  2FJA A;  1DOE A;  4AOS A;  2BRY A;  4B68 A;  4BK2 A;  3FO3 A;  1GND A;  4JDR A;  4CCR A;  3L1T A;  4J33 A;  2QA2 A;  1PJ7 A;  3LXD A;  5KMP A;  2CZS A;  1D7Y A;  1OJD A;  2E1M A;  3SQP A;  3BI2 A;  4DNA A;  2YLT A;  1NDA A;  2WES A;  1FCD A;  2WBA A;  4H4Y A;  4REK A;  3T37 A;  3RNM A;  2AQJ A;  2QAE A;  4KX6 A;  4J56 A;  1RYI A;  3D8X A;  3TOR A;  4AOX A;  4II3 A;  3IC9 A;  4H4T A;  3GDN A;  2ZZC A;  1K0I A;  3ZYX A;  4CCQ A;  2Q7V A;  2QA1 A;  3DK9 A;  3VR8 A;  3S61 A;  2JB1 A;  2WP9 A;  3CGD A;  3H8I A;  1F8R A;  1LPF A;  3F8P A;  1ELI A;  1COY A;  3K7Q X;  3NKS A;  4DSH A;  4HA6 A;  4B64 A;  4CY6 A;  5JCI A;  3KPF A;  3UOV A;  3UTH A;  1S3E A;  2XVF A;  1E39 A;  3KU9 A;  5EB4 A;  5FS7 A;  1SEZ A;  2BXS A;  2YM2 A;  3NTD A;  3AB1 A;  5M0Z A;  1IUW A;  4WCT A;  1FT6 A;  2GQW A;  1SP3 A;  2Q0K A;  3ADA B;  3B3R A;  3GYI A;  3L1R A;  1CBO A;  4JNQ A;  5U63 A;  5J60 A;  3AD8 B;  4BUR A;  1YQ3 A;  4U8M A;  3AE1 A;  4EMI A;  4Y4M A;  4Q1O A;  2R0G A;  4U2L A;  1CC4 A;  4IA5 A;  4K5S A;  1TYP A;  2Z5X A;  1BF3 A;  2WEU A;  2Q6U A;  1VQW A;  1B37 A;  4OCG A;  4L3X A;  4P9S A;  1XAN A;  3UKK A;  3COX A;  1S2Y A;  1X31 B;  4NZH A;  1DOB A;  4U8J A;  2GRT A;  1PN0 A;  4WJY A;  5HYM A;  1PJ5 A;  3EAN A;  4ICY A;  1DXL A;  1N4U A;  4H4Z A;  4LU6 A;  5FS9 A;  2XCG A;  1F8W A;  4YTP A;  3NHO X;  3QVP A;  4XWR A;  4EMW A;  4CNK A;  4X9N A;  1MO9 A;  1REO A;  1RP0 A;  4B67 A;  3RED A;  1M64 A;  2CUL A;  1L9D A;  1KFY A;  2F5Z A;  2OLN A;  3UKL A;  3K7M X;  3V76 A;  1E1K A;  3PVC A;  2APG A;  4GDP A;  1PBB A;  4EQS A;  3BI4 A;  3GSI A;  2YLR A;  1FS9 A;  4H50 A;  4B66 A;  2A8X A;  1Y56 B;  4A7A A;  1GXF A;  2JKC A;  2W0H A;  2YVG A;  2J3N A;  4OPL A;  3ALL A;  2X8G A;  1L0V A;  3QSE A;  4C5O A;  3K7T A;  2R0P A;  4U2S A;  3DJJ A;  4JY2 A;  1V59 A;  1EL9 A;  4A5L A;  2ZBW A;  2BCG G;  3C4N A;  3AXB A;  3CN8 A;  5KMS A;  4L3Y A;  1N4V A;  3CGB A;  2GAH B;  3G5Q A;  5M10 A;  1S2Q A;  2PYX A;  2OAM A;  2WHD A;  1ZMC A;  4YKF A;  5HXI A;  3GD3 A;  3DJG X;  3LJP A;  1H6V A;  5KWF A;  4U8K A;  4A99 A;  3PO7 A;  2VOU A;  1QO8 A;  4ADW A;  1K0L A;  1Y0P A;  3BNH A;  4Q17 A;  4H4R A;  4C3Y A;  1FOH A;  2CDU A;  3AE4 A;  3NH3 X;  1ZMD A;  3BNF A;  3RKH A;  2OLO A;  3KA7 A;  1OJ9 A;  2VRM A;  2YR6 A;  2YLS A;  2XFP A;  2O9Z A;  4FK1 C;  3V3O A;  2GMJ A;  5KVI A;  3ITJ A;  1GRG A;  1NHS A;  3F8R A;  1E1L A;  2B9X A;  2YAU A;  2YR5 A;  5C3J A;  3G5R A;  2VZ2 A;  3HYW A;  4EQX A;  2XLR A;  2C76 A;  3GM6 A;  1TYT A;  1KDG A;  2RAB A;  1L9C A;  3NK1 X;  4H4S A;  4OPC A;  4IA6 A;  1ZOY A;  4BK1 A;  1H7X A;  2BXR A;  2YLW A;  3TTB A;  3MMO A;  2VR0 A;  1PBF A;  1JOA A;  1B8S A;  4B69 A;  2EQ8 A;  2GH5 A;  2YQU A;  3IHG A;  4MJW A;  1KF6 A;  2RGO A;  3AEC A;  3CPI G;  3NK2 X;  4U8I A;  3UKP A;  3SZW A;  3UOX A;  3ABV A;  3UKA A;  1NHP A;  3BHK A;  3GWF A;  3GRT A;  3M12 A;  1H83 A;  4H4V A;  4NTD A;  4NWZ A;  4CY8 A;  3S5W A;  1NHQ A;  3Q9T A;  1DOC A;  4A9W A;  4EMJ A;  4C74 A;  2GQF A;  4J31 A;  3SFE A;  3NYC A;  1CF3 A;  2WDQ A;  2C3D A;  2XLT A;  4EM3 A;  1JEH A;  2GEW A;  2IVE A;  1NEN A;  4TLX A;  1M1P A;  4IV9 A;  2GAG B;  3SGL A;  3OC4 A;  1D4C A;  5IPY A;  4GR1 A;  1F6M A;  2WPF A;  4JNA A;  2C73 A;  1D7L A;  3QVR A;  3SY4 A;  5EOW A;  1GET A;  3NTA A;  2AR8 A;  3QSS A;  1PXA A;  1IJH A;  2C4C A;  3IHM A;  4H4X A;  3NK0 X;  3F29 A;  1AOG A;  2FBW A;  4K8D A;  4J34 A;  3T0K A;  2YLZ A;  3EAO A;  3BNG A;  4YKG A;  3ATR A;  1IUV A;  3DK4 A;  4TM1 A;  1PBC A;  4YXD A;  2C67 A;  4YSX A;  4RG4 A;  4CNJ A;  3CGC A;  2WP5 A;  4WX1 A;  2ACZ A;  5KXJ A;  1GES A;  1XPQ A;  4K22 A;  1ZOV A;  1NEK A;  4GCM A;  1KSU A;  1IUX A;  3RP8 A;  4YSY A;  2BK4 A;  2XVI A;  3EPT A;  4H4U A;  2OT4 A;  3VQR A;  4AP3 A;  3FIM B;  5HY5 A;  5KRQ A;  4Z44 A;  2XLP A;  2VRL A;  4TM0 A;  1FS8 A;  3KD9 A;  3LB8 A;  3WE0 A;  2V3A A;  3DA1 A;  3I3L A;  4PAB A;  1JRZ A;  1MOK A;  5EB5 A;  1GTH A;  3NT6 A;  4C77 A;  3PS9 A;  3NGC X;  2BS4 A;  3QFB A;  3T31 A;  5KMR A;  1E1N A;  1VG9 A;  4OPT A;  2ZZB A;  1YQZ A;  4H7U A;  3QSM A;  2FJB A;  2GVC A;  4FK1 A;  1CC6 A;  4J36 A;  3DH9 A;  3VRB A;  3NN0 X;  4Z43 A;  2ZO5 A;  3ALJ A;  3NYE A;  2WQY A;  4EIP A;  1BKW A;  2BS2 A;  1JNZ A;  3AE8 A;  3LOV A;  3UU9 A;  2E80 A;  1KSS A;  1ZDL A;  2R9Z A;  2YG4 A;  2E4G A;  2RGH A;  3UTF A;  1LQT A;  5TR3 A;  4H4P A;  3AYJ A;  1JNI A;  3AYL A;  2ZZ0 A;  4RSL A;  3O0H A;  1B5Q A;  2YG6 A;  1EL8 A;  5JCK A;  1LQU A;  1XDI A;  4NTC A;  4B1B A;  1GOS A;  2BC1 A;  4BJY A;  4EQR A;  3SXQ A;  4H2R A;  4NEV A;  1MXT A;  1GPE A;  3Q6J A;  1GEU A;  4H2Q A;  3SZC A;  1NG3 A;  2EQ7 A;  4OPI A;  4UDQ A;  3GDP A;  3P1W A;  4XWZ A;  1NG4 A;  1ZKQ A;  2BS3 A;  4EQW A;  2BAB A;  4YWO A;  4OPU A;  4JQ9 A;  4II2 A;  4AT2 A;  4Z25 A;  2GMH A;  2GB0 A;  3QJ4 A;  4U8L A;  4YTN A;  1TDN A;  3HYV A;  3M13 A;  1N4W A;  3GWD A;  4B65 A;  2VVL A;  4LA1 A;  1YQ4 A;  2BK3 A;  3UKF A;  4G74 A;  3UBR A;  2V6O A;  2BRA A;  3QFA A;  4OVI A;  2B9W A;  4ZCC A;  3AD7 B;  3SX6 A;  2V60 A;  4OPG A;  4O5U A;  5C2T A;  2JB2 A;  4Q5B A;  4A6N B;  2X8C A;  4K7Z A;  4H4Q A;  1ZK7 A;  1D4D A;  5EBK A;  3LGQ A;  1DJQ A;  2WS3 A;  2YVJ A;  1JNR A;  3D1I A;  2H88 A;  2CVJ A;  3GD4 A;  2BAC A;  4G6H A;  3GRS A;  1GT8 A;  3ALM A;  4EIQ A;  3P4S A;  1PXB A;  2WU2 A;  1CJ2 A;  1TDO A;  2GR2 A;  1ONF A;  1GRE A;  2FJE A;  4Y4L A;  3SCE A;  1ZP0 A;  2C64 A;  2JK6 A;  1Q9I A;  1LJ1 A;  5BUK A;  4CRT A;  3GYJ A;  3CNP A;  1O95 A;  2WP6 A;  3RP7 A;  2B76 A;  4J2W A;  1CJ3 A;  2TMD A;  3VRA A;  2X3N A;  1E7P A;  5KOX A;  3JSK A;  3CND A;  4Q4U A;  3GYX A;  3NN6 X;  2OA1 A;  3UTE A;  5KOW A;  1CJC A;  1QLB A;  1H7W A;  3SYI A;  1Q1W A;  4EM4 A;  4JN9 A;  1M1Q A;  3IWA A;  3OZ2 A;  5U25 A;  1Y56 A;  1VRQ B;  2XFN A;  3T2K A;  1FEA A;  2TPR A;  1CL0 A;  2A87 A;  2VQB A;  2YLX A;  4GUV A;  2HQM A;  1Z6L A;  3CNT A;  3FBS A;  3RP6 A;  2YVF A;  2YWL A;  2YR4 A;  2JB3 A;  3GMC A;  4G6G A;  4O5Q A;  4U2T A;  1KNP A;  4GAP A;  3UP4 A;  2GR1 A;  3ICT A;  2UZZ A;  2FJD A;  2EQ9 A;  2OAL A;  1PBE A;  3M0O A;  1GRF A;  1N1P A;  2V3B A;  3AEE A;  3ICR A;  3UOY A;  1H81 A;  1W4X A;  2Q0L A;  3P9U A;  5KNL A;  5JCN A;  1E1M A;  1GRA A;  3DGH A;  4HB9 A;  4NTE A;  3AE5 A;  1FEB A;  2XFU A;  3G5S A;  1VG0 A;  3HYX A;  4K2X A;  1GTE A;  1GER A;  5CKU A;  1EL7 A;  1Q1R A;  1GAL A;  4N9X A;  1P2E A;  1JRX A;  1H82 A;  2WOI A;  3B6D A;  4M52 A;  1IUU A;  3D1C A;  1D5T A;  2DKI A;  2R0C A;  3BHF A;  1DOD A;  3CMM A;  4U8O A;  3S7W A;  4X9M A;  2LFC A;  1IUS A;  3UOZ A;  4D03 A;  1LV0 A;  2XVE A;  1H84 A;  3ISH A;  3SFD A;  2WDR A;  4J57 A;  4TLZ A;  1IUT A;  1GRT A;  4USR A;  5DBJ A;  3BNU A;  3LZW A;  4RG3 A;  3DJE A;  3HZL A;  4IVM B;  4FDC B;  3AE7 A;  4UDR A;  2NVK X;  1H86 A;  5GSN A;  2WDV A;  3V3N A;  2BK5 A;  1GRB A;  1VDC A;  3AEG A;  3AEB A;  3AEF A;  1OJA A;  3AE3 A;  1ZY8 A;  2XFO A;  5KVH A;  4IVO B;  3AE6 A;  5L46 A;  2WPE A;  3FPZ A;  3SXI A;  2C66 A;  3KLJ A;  4JY3 A;  4NEW A;  3LAD A;  1OJC A;  3AE9 A;  1M6I A;  2QCU A;  4GDE A;  1S3B A;  2I0Z A;  1OJT A;  4GAV A;  2R46 A;  2RF7 A;  1CC2 A;  4Z2R A;  2YM1 A;  3K30 A;  4BK3 A;  3VR9 A;  4BV6 A;  2A89 A;  2R4E A;  1RSG A;  1FL2 A;  3R9U A;  1TDE A;  2X50 A;  1NPX A;  2XVH A;  4KPR A;  1YY5 A;  2VVM A;  4G9K A;  5CQF A;  4H2N A;  1K4Q A;  4CBQ A;  2B9Y A;  2GR3 A;  5IQ1 A;  2Y6R A;  1BWC A;  2YG7 A;  2Y6Q A;  5BUL A;  4Q5C A;  1PS9 A;  1HYU A;  2WU5 A;  1XHC A;  2XYO A;  3E1T A;  1PHH A;  4FX9 A;  3SM8 A;  2C65 A;  5FS8 A;  1K0J A;  2C3C A;  3UKH A;  1BVB A;  2B7S A;  2RDZ A;  2R45 A;  3BI5 A;  3KPK A;  4I59 A;  3T2Y A;  3NG7 X;  3UTG A;  1EL5 A;  2V61 A;  1L9E A;  2H89 A;  1GSN A;  1FT5 A;  4OPD A;  2C7G A;  3H4K A;  3NRN A;  5ER0 A;  1JU2 A;  2X8H A;  3AWI A;  4H4W A;  2ARD A;  2GR0 A;  3KVE A;  3CPJ G;  4L3Z A;  3CNS A;  3GMB A;  5BVA A;  2VQ7 A;  3CTY A;  1ZX9 A;  3II4 A;  3L8K A;  3H8L A;  4A79 A;  1FEC A;  1QJD A;  3F8D A;  2DKH A;  1F3P A;  1YKJ A;  3SZ0 A;  3AYI A;  4TM4 A;  3LZX A;  3NNE A;  3CIR A;  4LII A;  1PBD A;  3DK8 A;  2CFY A;  4PAA A;  4USQ A;  4D04 A;  5IQ4 A;  1F8S A;  2IID A;  4A65 A;  4Z26 A;  1PDH A;  3ZDN A;  2JAE A;  1NAA A;  4DGK A;  2GV8 A;  3IF9 A;  1P2H A;  2E81 A;  5FMH A;  2E5V A;  3BNJ A;  4Z2U A;  1O94 A;  3AD9 B;  3NLC A;  1JRY A;  1NHR A;  4U8N A;  4ZCD A;  2C70 A;  4B63 A;  2J7A A;  2YG3 A;  2EQ6 A;  2XFQ A;  4GF7 A;  4I58 A;  3T14 A;  3FG2 P;  2AAQ A;  1QDB A;  3DJD A;  3DGZ A;  4Y4N A;  1LTX R;  2YG5 A;  4Q0T A;  1DJN A;  5LV9 A;  3DME A;  2C75 A;  1OAH A;  2V5Z A;  5J7X A;  4BJZ A;  4E0V A;  1UKV G;  4H2P A;  5BRT A;  4YSZ A;  3C96 A;  4ZN0 A;  2BCP A; 
#chains in the Genus database with same CATH homology
 1FS7 A;  5JCL A;  3P4Q A;  1LVL A;  2X99 A;  4Z24 A;  1TRB A;  3P4R A;  1BGJ A;  2XLS A;  5FS6 A;  4Z2T A;  4L38 A;  3FMW A;  3UKQ A;  2XDO A;  2Z5Y A;  5U1O A;  4XXG A;  4YTM A;  4DSG A;  3I6D A;  3ICS A;  3KKJ A;  2C72 A;  3ATQ A;  4GRT A;  2WOW A;  3CPH G;  4K5R A;  3SZF A;  1BGN A;  4TM3 A;  3RHA A;  1GV4 A;  1CJ4 A;  1DNC A;  3AEA A;  3C4A A;  3OWM A;  5HHF A;  2GF3 A;  3NIX A;  1D4E A;  4APN A;  1PXC A;  1O5W A;  4NNJ A;  1B4V A;  2XLU A;  1GU6 A;  3CGE A;  3EF6 A;  1GRH A;  3URH A;  4X4J A;  4UP3 A;  4ECH A;  2K3V A;  4AT0 A;  2IVD A;  4G73 A;  4C3X A;  2VVL G;  4A6N A;  1TDF A;  4AP1 A;  2XVJ A;  3NYF A;  3P4P A;  1EBD A;  2R4J A;  2PHH A;  3UCL A;  3CNJ A;  3VRD B;  2BA9 A;  3T2Z A;  1TDK A;  2JBV A;  2RGJ A;  1KNR A;  5GRT A;  2WOV A;  4YT0 A;  2B7R A;  1M1R A;  3BNM A;  2BYB A;  2WET A;  5KMQ A;  1PJ6 A;  4UDP A;  4U8P A;  2NPX A;  5JCM A;  1BZL A;  1CHU A;  2WPC A;  3LG1 A;  4YSH A;  3AE2 A;  3AED A;  2BC0 A;  1E6E A;  3UP5 A;  2FJA A;  1DOE A;  4AOS A;  2BRY A;  4B68 A;  4BK2 A;  3FO3 A;  1GND A;  4JDR A;  4CCR A;  3L1T A;  4J33 A;  2QA2 A;  1PJ7 A;  3LXD A;  5KMP A;  1D7Y A;  1OJD A;  2E1M A;  3SQP A;  3BI2 A;  4DNA A;  2YLT A;  1NDA A;  2WES A;  1FCD A;  2WBA A;  4H4Y A;  4REK A;  3T37 A;  3RNM A;  2AQJ A;  2QAE A;  4KX6 A;  4J56 A;  1RYI A;  3D8X A;  3TOR A;  4AOX A;  4II3 A;  3IC9 A;  4H4T A;  3GDN A;  2ZZC A;  1K0I A;  3ZYX A;  4CCQ A;  2Q7V A;  2QA1 A;  3DK9 A;  3VR8 A;  3S61 A;  2JB1 A;  2WP9 A;  3CGD A;  3H8I A;  1F8R A;  1LPF A;  3F8P A;  1ELI A;  1COY A;  3K7Q X;  3NKS A;  4DSH A;  4HA6 A;  4B64 A;  4CY6 A;  5JCI A;  3KPF A;  3UOV A;  3UTH A;  1S3E A;  2XVF A;  1E39 A;  3KU9 A;  5EB4 A;  5FS7 A;  1SEZ A;  2BXS A;  2YM2 A;  3NTD A;  3AB1 A;  5M0Z A;  1IUW A;  4WCT A;  1FT6 A;  2GQW A;  1SP3 A;  2Q0K A;  3ADA B;  3B3R A;  3GYI A;  3L1R A;  1CBO A;  4JNQ A;  5U63 A;  5J60 A;  3AD8 B;  4BUR A;  1YQ3 A;  4U8M A;  3AE1 A;  4EMI A;  4Y4M A;  4Q1O A;  2R0G A;  4U2L A;  1CC4 A;  4IA5 A;  4K5S A;  1TYP A;  2Z5X A;  1BF3 A;  2WEU A;  2Q6U A;  1VQW A;  1B37 A;  4OCG A;  4L3X A;  4P9S A;  1XAN A;  3UKK A;  3COX A;  1S2Y A;  1X31 B;  4NZH A;  1DOB A;  4U8J A;  2GRT A;  1PN0 A;  4WJY A;  5HYM A;  1PJ5 A;  3EAN A;  4ICY A;  1DXL A;  1N4U A;  4H4Z A;  4LU6 A;  5FS9 A;  2XCG A;  1F8W A;  4YTP A;  3NHO X;  3QVP A;  4XWR A;  4EMW A;  4CNK A;  4X9N A;  1MO9 A;  1REO A;  1RP0 A;  4B67 A;  3RED A;  1M64 A;  2CUL A;  1L9D A;  1KFY A;  2F5Z A;  2OLN A;  3UKL A;  3K7M X;  3V76 A;  1E1K A;  3PVC A;  2APG A;  4GDP A;  1PBB A;  4EQS A;  3BI4 A;  3GSI A;  2YLR A;  1FS9 A;  4H50 A;  4B66 A;  2A8X A;  1Y56 B;  4A7A A;  1GXF A;  2JKC A;  2W0H A;  2YVG A;  2J3N A;  4OPL A;  3ALL A;  2X8G A;  1L0V A;  3QSE A;  4C5O A;  3K7T A;  2R0P A;  4U2S A;  3DJJ A;  4JY2 A;  1V59 A;  1EL9 A;  4A5L A;  2ZBW A;  2BCG G;  3C4N A;  3AXB A;  3CN8 A;  5KMS A;  4L3Y A;  1N4V A;  3CGB A;  2GAH B;  3G5Q A;  5M10 A;  1S2Q A;  2PYX A;  2OAM A;  2WHD A;  1ZMC A;  4YKF A;  5HXI A;  3GD3 A;  3DJG X;  3LJP A;  1H6V A;  5KWF A;  4U8K A;  4A99 A;  3PO7 A;  2VOU A;  1QO8 A;  4ADW A;  1K0L A;  1Y0P A;  3BNH A;  4Q17 A;  4H4R A;  4C3Y A;  1FOH A;  2CDU A;  3AE4 A;  3NH3 X;  1ZMD A;  3BNF A;  3RKH A;  2OLO A;  3KA7 A;  1OJ9 A;  2VRM A;  2YR6 A;  2YLS A;  2XFP A;  2O9Z A;  4FK1 C;  3V3O A;  2GMJ A;  5KVI A;  3ITJ A;  1GRG A;  1NHS A;  3F8R A;  1E1L A;  2B9X A;  2YAU A;  2YR5 A;  5C3J A;  3G5R A;  2VZ2 A;  3HYW A;  4EQX A;  2XLR A;  2C76 A;  3GM6 A;  1TYT A;  1KDG A;  2RAB A;  1L9C A;  3NK1 X;  4H4S A;  4OPC A;  4IA6 A;  1ZOY A;  4BK1 A;  1H7X A;  2BXR A;  2YLW A;  3TTB A;  3MMO A;  2VR0 A;  1PBF A;  1JOA A;  1B8S A;  4B69 A;  2EQ8 A;  2GH5 A;  2YQU A;  3IHG A;  4MJW A;  1KF6 A;  2RGO A;  3AEC A;  3CPI G;  3NK2 X;  4U8I A;  3UKP A;  3SZW A;  3UOX A;  3ABV A;  3UKA A;  1NHP A;  3BHK A;  3GWF A;  3GRT A;  3M12 A;  1H83 A;  4H4V A;  4NTD A;  4NWZ A;  4CY8 A;  3S5W A;  1NHQ A;  3Q9T A;  1DOC A;  4A9W A;  4EMJ A;  4C74 A;  2GQF A;  4J31 A;  3SFE A;  3NYC A;  1CF3 A;  2WDQ A;  2C3D A;  2XLT A;  4EM3 A;  1JEH A;  2GEW A;  2IVE A;  1NEN A;  4TLX A;  1M1P A;  4IV9 A;  2GAG B;  3SGL A;  3OC4 A;  1D4C A;  5IPY A;  4GR1 A;  1F6M A;  2WPF A;  4JNA A;  2C73 A;  1D7L A;  3QVR A;  3SY4 A;  5EOW A;  1GET A;  3NTA A;  2AR8 A;  3QSS A;  1PXA A;  1IJH A;  2C4C A;  3IHM A;  4H4X A;  3NK0 X;  3F29 A;  1AOG A;  2FBW A;  4K8D A;  4J34 A;  3T0K A;  2YLZ A;  3EAO A;  3BNG A;  4YKG A;  3ATR A;  1IUV A;  3DK4 A;  4TM1 A;  1PBC A;  4YXD A;  2C67 A;  4YSX A;  4RG4 A;  4CNJ A;  3CGC A;  2WP5 A;  4WX1 A;  2ACZ A;  5KXJ A;  1GES A;  1XPQ A;  4K22 A;  1ZOV A;  1NEK A;  4GCM A;  1KSU A;  1IUX A;  3RP8 A;  4YSY A;  2BK4 A;  2XVI A;  3EPT A;  4H4U A;  2OT4 A;  3VQR A;  4AP3 A;  3FIM B;  5HY5 A;  5KRQ A;  4Z44 A;  2XLP A;  2VRL A;  4TM0 A;  1FS8 A;  3KD9 A;  3LB8 A;  3WE0 A;  2V3A A;  3DA1 A;  3I3L A;  4PAB A;  1JRZ A;  1MOK A;  5EB5 A;  1GTH A;  3NT6 A;  4C77 A;  3PS9 A;  3NGC X;  2BS4 A;  3QFB A;  3T31 A;  5KMR A;  1E1N A;  1VG9 A;  4OPT A;  2ZZB A;  1YQZ A;  4H7U A;  3QSM A;  2FJB A;  2GVC A;  4FK1 A;  1CC6 A;  4J36 A;  3DH9 A;  3VRB A;  3NN0 X;  4Z43 A;  2ZO5 A;  3ALJ A;  3NYE A;  2WQY A;  4EIP A;  1BKW A;  2BS2 A;  1JNZ A;  3AE8 A;  3LOV A;  3UU9 A;  2E80 A;  1KSS A;  1ZDL A;  2R9Z A;  2YG4 A;  2E4G A;  2RGH A;  3UTF A;  1LQT A;  5TR3 A;  4H4P A;  3AYJ A;  1JNI A;  3AYL A;  2ZZ0 A;  4RSL A;  3O0H A;  1B5Q A;  2YG6 A;  1EL8 A;  5JCK A;  1LQU A;  1XDI A;  4NTC A;  4B1B A;  1GOS A;  2BC1 A;  4BJY A;  4EQR A;  3SXQ A;  4H2R A;  4NEV A;  1MXT A;  1GPE A;  3Q6J A;  1GEU A;  4H2Q A;  3SZC A;  1NG3 A;  2EQ7 A;  4OPI A;  4UDQ A;  3GDP A;  3P1W A;  4XWZ A;  1NG4 A;  1ZKQ A;  2BS3 A;  4EQW A;  2BAB A;  4YWO A;  4OPU A;  4JQ9 A;  4II2 A;  4AT2 A;  4Z25 A;  2GMH A;  2GB0 A;  3QJ4 A;  4U8L A;  4YTN A;  1TDN A;  3HYV A;  3M13 A;  1N4W A;  3GWD A;  4B65 A;  2VVL A;  4LA1 A;  1YQ4 A;  2BK3 A;  3UKF A;  4G74 A;  3UBR A;  2V6O A;  2BRA A;  3QFA A;  4OVI A;  2B9W A;  4ZCC A;  3AD7 B;  3SX6 A;  2V60 A;  4OPG A;  4O5U A;  5C2T A;  2JB2 A;  4Q5B A;  4A6N B;  2X8C A;  4K7Z A;  4H4Q A;  1ZK7 A;  1D4D A;  5EBK A;  3LGQ A;  1DJQ A;  2WS3 A;  2YVJ A;  1JNR A;  3D1I A;  2H88 A;  2CVJ A;  3GD4 A;  2BAC A;  4G6H A;  3GRS A;  1GT8 A;  3ALM A;  4EIQ A;  3P4S A;  1PXB A;  2WU2 A;  1CJ2 A;  1TDO A;  2GR2 A;  1ONF A;  1GRE A;  2FJE A;  4Y4L A;  3SCE A;  1ZP0 A;  2C64 A;  2JK6 A;  1Q9I A;  1LJ1 A;  5BUK A;  4CRT A;  3GYJ A;  3CNP A;  1O95 A;  2WP6 A;  3RP7 A;  2B76 A;  4J2W A;  1CJ3 A;  2TMD A;  3VRA A;  2X3N A;  1E7P A;  5KOX A;  3JSK A;  3CND A;  4Q4U A;  3GYX A;  3NN6 X;  2OA1 A;  3UTE A;  5KOW A;  1CJC A;  1QLB A;  1H7W A;  3SYI A;  1Q1W A;  4EM4 A;  4JN9 A;  1M1Q A;  3IWA A;  3OZ2 A;  5U25 A;  1Y56 A;  1VRQ B;  2XFN A;  3T2K A;  1FEA A;  2TPR A;  1CL0 A;  2A87 A;  2VQB A;  2YLX A;  4GUV A;  2HQM A;  1Z6L A;  3CNT A;  3FBS A;  3RP6 A;  2YVF A;  2YWL A;  2YR4 A;  2JB3 A;  3GMC A;  4G6G A;  4O5Q A;  4U2T A;  1KNP A;  4GAP A;  3UP4 A;  2GR1 A;  3ICT A;  2UZZ A;  2FJD A;  2EQ9 A;  2OAL A;  1PBE A;  3M0O A;  1GRF A;  1N1P A;  2V3B A;  3AEE A;  3ICR A;  3UOY A;  1H81 A;  1W4X A;  2Q0L A;  3P9U A;  5KNL A;  5JCN A;  1E1M A;  1GRA A;  3DGH A;  4HB9 A;  4NTE A;  3AE5 A;  1FEB A;  2XFU A;  3G5S A;  1VG0 A;  3HYX A;  4K2X A;  1GTE A;  1GER A;  5CKU A;  1EL7 A;  1Q1R A;  1GAL A;  4N9X A;  1P2E A;  1JRX A;  1H82 A;  2WOI A;  3B6D A;  4M52 A;  1IUU A;  3D1C A;  1D5T A;  2DKI A;  2R0C A;  3BHF A;  1DOD A;  3CMM A;  4U8O A;  3S7W A;  4X9M A;  2LFC A;  1IUS A;  3UOZ A;  4D03 A;  1LV0 A;  2XVE A;  1H84 A;  3ISH A;  3SFD A;  2WDR A;  4J57 A;  4TLZ A;  1IUT A;  1GRT A;  4USR A;  5DBJ A;  3BNU A;  3LZW A;  4RG3 A;  3DJE A;  3HZL A;  4IVM B;  4FDC B;  3AE7 A;  4UDR A;  2NVK X;  1H86 A;  5GSN A;  2WDV A;  3V3N A;  2BK5 A;  1GRB A;  1VDC A;  3AEG A;  3AEB A;  3AEF A;  1OJA A;  3AE3 A;  1ZY8 A;  2XFO A;  5KVH A;  4IVO B;  3AE6 A;  5L46 A;  2WPE A;  3FPZ A;  3SXI A;  2C66 A;  3KLJ A;  4JY3 A;  4NEW A;  3LAD A;  1OJC A;  3AE9 A;  1M6I A;  2QCU A;  4GDE A;  1S3B A;  2I0Z A;  1OJT A;  4GAV A;  2R46 A;  2RF7 A;  1CC2 A;  4Z2R A;  2YM1 A;  3K30 A;  4BK3 A;  3VR9 A;  4BV6 A;  2A89 A;  2R4E A;  1RSG A;  1FL2 A;  3R9U A;  1TDE A;  2X50 A;  1NPX A;  2XVH A;  4KPR A;  1YY5 A;  2VVM A;  4G9K A;  5CQF A;  4H2N A;  1K4Q A;  4CBQ A;  2B9Y A;  2GR3 A;  5IQ1 A;  2Y6R A;  1BWC A;  2YG7 A;  2Y6Q A;  5BUL A;  4Q5C A;  1PS9 A;  1HYU A;  2WU5 A;  1XHC A;  2XYO A;  3E1T A;  1PHH A;  4FX9 A;  3SM8 A;  2C65 A;  5FS8 A;  1K0J A;  2C3C A;  3UKH A;  1BVB A;  2B7S A;  2RDZ A;  2R45 A;  3BI5 A;  3KPK A;  4I59 A;  3T2Y A;  3NG7 X;  3UTG A;  1EL5 A;  2V61 A;  1L9E A;  2H89 A;  1GSN A;  1FT5 A;  4OPD A;  2C7G A;  3H4K A;  3NRN A;  5ER0 A;  1JU2 A;  2X8H A;  3AWI A;  4H4W A;  2ARD A;  2GR0 A;  3KVE A;  3CPJ G;  4L3Z A;  3CNS A;  3GMB A;  5BVA A;  2VQ7 A;  3CTY A;  1ZX9 A;  3II4 A;  3L8K A;  3H8L A;  4A79 A;  1FEC A;  1QJD A;  3F8D A;  2DKH A;  1F3P A;  1YKJ A;  3SZ0 A;  3AYI A;  4TM4 A;  3LZX A;  3NNE A;  3CIR A;  4LII A;  1PBD A;  3DK8 A;  2CFY A;  4PAA A;  4USQ A;  4D04 A;  5IQ4 A;  1F8S A;  2IID A;  4A65 A;  4Z26 A;  1PDH A;  3ZDN A;  2JAE A;  1NAA A;  4DGK A;  2GV8 A;  3IF9 A;  1P2H A;  2E81 A;  5FMH A;  2E5V A;  3BNJ A;  4Z2U A;  1O94 A;  3AD9 B;  3NLC A;  1JRY A;  1NHR A;  4U8N A;  4ZCD A;  2C70 A;  4B63 A;  2J7A A;  2YG3 A;  2EQ6 A;  2XFQ A;  4GF7 A;  4I58 A;  3T14 A;  3FG2 P;  2AAQ A;  1QDB A;  3DJD A;  3DGZ A;  4Y4N A;  1LTX R;  2YG5 A;  4Q0T A;  1DJN A;  5LV9 A;  3DME A;  2C75 A;  1OAH A;  2V5Z A;  5J7X A;  4BJZ A;  4E0V A;  1UKV G;  4H2P A;  5BRT A;  4YSZ A;  3C96 A;  4ZN0 A;  2BCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...