1P2HA

H61m mutant of flavocytochrome c3
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASMFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histidine 61: An Important Heme Ligand in the Soluble Fumarate Reductase from Shewanella frigidimarina
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords flavocytochrome c3
total genus 198
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1p2hA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1p2hA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1p2hA01
3BNHA 2WHDA 2E81A 2JKCA 3DJDA 1LV0A 3GSIA 2EQ7A 1DODA 5CKUA 1F8RA 1AOGA 3ICTA 2B7SA 1B5QA 2V60A 2ZZCA 3NGCX 2GH5A 3P4QA 4OPUA 4ZN0A 2V6OA 4J36A 4X4JA 4IA6A 4K8DA 1H81A 1M6IA 2VRMA 3C4AA 3RKHA 1OJTA 2JB3A 3QSMA 2A8XA 2FJEA 2PHHA 4K5SA 4GUVA 2GMJA 3AE2A 4BV6A 1N4WA 3SGLA 4WCTA 2WS3A 3KKJA 4CY8A 4CY6A 3MMOA 3NTDA 2YLZA 3DK8A 3Q6JA 4USQA 4EM4A 4HA6A 3UKFA 1LQTA 4Z2TA 1SP3A 1KDGA 3LOVA 4DSGA 5L46A 4BK1A 4D03A 1EBDA 1K4QA 4GCMA 4JDRA 1PXAA 2Q0LA 3GMCA 2E4GA 1B37A 4I58A 4U8PA 1VG9A 4EMJA 2OALA 4FX9A 1O95A 5JCKA 4H4SA 1K0JA 4YTMA 3VR9A 3DGZA 2EQ6A 1GOSA 2BXRA 3AYIA 3FG2P 1CJ4A 1TYPA 1PBBA 3PVCA 4U2TA 2Q6UA 4X9NA 2WP5A 3AE4A 1FCDA 3OC4A 4A99A 1DOBA 5EB5A 1OJ9A 4Y4LA 3AE6A 3S61A 3DJGX 2VOUA 2EQ9A 3CGCA 3NYEA 2GMHA 1EL9A 4XWZA 5BVAA 2WPCA 1CHUA 1E1NA 3KPFA 1M1PA 3AE7A 3F8RA 3QSEA 4FK1A 3RP7A 1JNZA 1D7LA 3AECA 4L38A 4IA5A 4B63A 1E6EA 1MO9A 4H4RA 1DJNA 1CBOA 4H4YA 4O5QA 4A6NB 4EQRA 5DBJA 1E7PA 2R46A 5FS9A 1NG3A 1Z6LA 4O5UA 4C77A 4L3YA 2RGJA 1FT5A 3CPHG 3TORA 3GDPA 3UKAA 1LQUA 1M1QA 5FMHA 3OZ2A 3UKLA 5BULA 3LZWA 3AE8A 4KPRA 2WDVA 1ZOYA 3VRAA 5M10A 4WX1A 1F3PA 4H4TA 1CF3A 2GAGB 2Z5XA 4H2NA 3IHGA 1FEBA 1TDNA 3V3OA 4DNAA 3SM8A 3P4RA 2B9YA 4K5RA 4N9XA 1JRXA 2C76A 3GWDA 1RSGA 1FEAA 3M0OA 4JNQA 4LA1A 4L3ZA 2WBAA 3F29A 3BNGA 2TPRA 4D04A 3CNSA 1BGNA 3QSSA 4KX6A 3CNPA 2WESA 4J31A 4Q17A 2VVMA 3UOVA 2V3AA 2AAQA 2R4EA 1H6VA 4AT2A 1MXTA 4ZCCA 1L9EA 1DXLA 4B1BA 4Z24A 4U8JA 1CL0A 5BRTA 5HXIA 2OLOA 5HYMA 2AQJA 5KVIA 3AEAA 2WP6A 1IUVA 2XFUA 4P9SA 2JB1A 4H4ZA 4YSHA 1KF6A 3II4A 4H4QA 4OPIA 2HQMA 2WPEA 2DKHA 2OA1A 3GYJA 2BS2A 3M12A 2WU2A 5KRQA 2V61A 3I6DA 3ZYXA 2C73A 1DOEA 1EL5A 1ZKQA 3AE5A 1EL7A 5FS8A 4Q4UA 4EM3A 1GTHA 4EQWA 3RHAA 2XLTA 2BACA 3QVPA 2C65A 1NDAA 3NN0X 3G5QA 4ICYA 1NHSA 1ZMDA 3T37A 2QA1A 3FBSA 4BJYA 3Q9TA 4M52A 4A7AA 2R0PA 4EIPA 3DJEA 4YXDA 2QCUA 2B76A 5HHFA 2YLXA 2NVKX 1GALA 1D4DA 2GR2A 3NLCA 2APGA 3PS9A 3S5WA 2ZZ0A 3P1WA 1P2HA 4WJYA 4GR1A 1TDEA 3AE9A 2B7RA 1COYA 2X50A 2X99A 3BNJA 3BHKA 3GRTA 4LU6A 4J33A 3AEBA 2OT4A 2BC1A 2GAHB 2TMDA 3TTBA 2EQ8A 1M1RA 1BVBA 3DK9A 3JSKA 1CJ2A 3CGDA 4APNA 2IIDA 4I59A 2YVGA 3SFEA 4BJZA 4TM3A 2GR1A 3LB8A 1H7XA 2WDRA 1QJDA 1BZLA 2Q7VA 1K0IA 4B67A 3CGBA 3F8PA 3UOXA 1PJ5A 1Q1RA 5U1OA 4J2WA 1S2QA 2WP9A 4AP1A 4LIIA 2OAMA 3ATQA 3B6DA 3QFAA 4PABA 3FPZA 4TLZA 3COXA 1N1PA 1SEZA 1JU2A 2YR5A 3S7WA 1S3BA 3DMEA 2X8CA 2PYXA 1GRHA 2YG6A 4E0VA 2C3DA 1KSSA 1VDCA 4RSLA 1PBDA 1LPFA 4OPCA 3NYFA 3AYJA 2GB0A 2XFQA 1MOKA 4FDCB 1VRQB 1GRTA 1GU6A 2JBVA 4NTCA 4Z44A 1BKWA 2GV8A 5BUKA 2WOWA 3SCEA 1O94A 2YVJA 2B9WA 3UTHA 4EMWA 4OVIA 2H88A 1PXBA 2R45A 1ELIA 4B64A 2YR6A 4H4WA 3K7MX 4YT0A 2WOIA 3AE3A 1PXCA 4A5LA 4BURA 5EOWA 3NG7X 2YLSA 4REKA 2QAEA 4CCQA 4TM1A 5KOXA 2BK3A 2OLNA 1PBFA 3CGEA 1FOHA 3CIRA 4BK2A 1GNDA 1JNIA 5M0ZA 4NTEA 5GSNA 2XLPA 3URHA 3DH9A 2BABA 4UP3A 2GRTA 1HYUA 2V5ZA 1DNCA 4OPDA 3SQPA 4AOXA 4YTNA 5KOWA 1Q9IA 2XVFA 4IVMB 1QDBA 1PHHA 1TYTA 2R0GA 1GV4A 3C96A 4OPLA 1NG4A 3UTFA 1Q1WA 2BXSA 4H4VA 3E1TA 1JRZA 3L1TA 1RP0A 4J34A 3NH3X 3QFBA 3AWIA 5KVHA 4YKGA 3KA7A 4Q0TA 3RP8A 4MJWA 1CJCA 2O9ZA 1GERA 1ZP0A 2YG4A 2JB2A 2XYOA 1L9DA 2C67A 2UZZA 4CBQA 2A87A 3IC9A 4YSZA 4U8NA 5LV9A 4JN9A 2VRLA 3KU9A 3UTGA 3P9UA 1CJ3A 1H84A 3BI5A 3DGHA 4K22A 4U8IA 4NTDA 4TM0A 3NK0X 3AYLA 1GRGA 2BK5A 2X8HA 1XDIA 3GRSA 1PBCA 3K7TA 2NPXA 3IWAA 3ALJA 1IUWA 3I3LA 1OJDA 4ECHA 1GRAA 3UBRA 4B69A 1VG0A 4PAAA 2WEUA 3CNTA 4Z25A 4IVOB 3AXBA 2RGHA 2XLRA 4JQ9A 4Y4NA 4JNAA 4J56A 2WPFA 4AP3A 4H2QA 2YAUA 1KNPA 2VZ2A 3REDA 3ATRA 4JY2A 2CVJA 3GD4A 4K7ZA 3GMBA 4B65A 1ZMCA 4Q5CA 3LJPA 2XFOA 3WE0A 1ONFA 1NHQA 1KNRA 4EQSA 5EBKA 3AB1A 1JRYA 5JCMA 1NHPA 4AOSA 2W0HA 3BNMA 4NEVA 4U8KA 1S3EA 1TDOA 3K7QX 3VRDB 4XWRA 4UDRA 1VQWA 2BCGG 3LZXA 1TRBA 3ABVA 3CPIG 4OCGA 2K3VA 1FL2A 1GXFA 3UKPA 4B66A 2BYBA 2C66A 3AD8B 2YLWA 2WU5A 2YG3A 4GRTA 3AD7B 1NPXA 1TDFA 4NZHA 3O0HA 3CTYA 2XLSA 3ALLA 4C3YA 4EIQA 4IV9A 2VVLG 3LXDA 1XPQA 4H4XA 3UKQA 3FMWA 1DOCA 2YM2A 5C3JA 1ZOVA 2VQBA 2WETA 3H4KA 3D1IA 1O5WA 4RG3A 2YLRA 3IF9A 1F8SA 3BHFA 2RABA 2VVLA 1UKVG 1XHCA 1QO8A 1D7YA 4Q1OA 3DJJA 3UP4A 2BK4A 2BC0A 2XVHA 1LVLA 5FS7A 2C72A 3H8IA 3LGQA 2C70A 2GF3A 1ZDLA 2GR3A 3BNUA 3LADA 5U25A 3L8KA 3QJ4A 4CCRA 5HY5A 3K30A 3UU9A 1P2EA 4X9MA 3UTEA 1E1MA 2GR0A 1PDHA 3KD9A 1N4VA 2ARDA 2YVFA 2H89A 4C5OA 2X3NA 3NRNA 1IUXA 4FK1C 3HZLA 5IQ1A 1JEHA 2E5VA 1BWCA 2FBWA 4UDQA 1E1LA 3L1RA 1D4EA 2XFPA 1IUTA 3AE1A 2RGOA 4Y4MA 3NN6X 2YG7A 1D5TA 2YG5A 1B8SA 1FECA 3SFDA 1E1KA 3NK2X 4XXGA 5FS6A 2WOVA 5EB4A 4A79A 4AT0A 4GDEA 2C7GA 5JCLA 2A89A 4GF7A 3VQRA 1IUUA 3EPTA 4U8OA 4YWOA 3SXQA 1X31B 2FJAA 1FS8A 2XFNA 3NIXA 4OPGA 4TM4A 4B68A 4K2XA 1YQ4A 2XVJA 1CC6A 2BS4A 3AD9B 3UOZA 1IJHA 3KVEA 4A9WA 3V76A 2GEWA 1GT8A 1H83A 3ICRA 1YKJA 3BI2A 3C4NA 4JY3A 5KWFA 4EMIA 2GQFA 2JK6A 2ZZBA 1CC4A 1GREA 1H7WA 2IVEA 3GYIA 4YTPA 3GYXA 4H2PA 2GQWA 2Z5YA 1IUSA 4J57A 3NK1X 1PS9A 4H2RA 1PN0A 3RNMA 2QA2A 1PJ6A 4EQXA 1V59A 2ZBWA 3QVRA 2LFCA 1Y0PA 5J7XA 1JNRA 1GRBA 3P4SA 4H50A 4NEWA 4CRTA 1YQ3A 2YR4A 4YSYA 2Q0KA 2CULA 2XVEA 1ZX9A 2YQUA 2E80A 1REOA 2E1MA 2I0ZA 5IQ4A 1E39A 3LG1A 1H86A 1KFYA 3EANA 3DA1A 3D8XA 4DGKA 4H7UA 1BGJA 1OJCA 3ALMA 4HB9A 4U2SA 3ITJA 4Z2RA 4DSHA 4RG4A 4USRA 2B9XA 3AEDA 4C3XA 4ZCDA 1FT6A 5U63A 2R4JA 1L0VA 1FS9A 4A6NA 2ZO5A 2GVCA 2WDQA 4L3XA 2YLTA 3M13A 1ZY8A 1LJ1A 1EL8A 3V3NA 4A65A 1B4VA 2XCGA 3NT6A 3FIMB 2J3NA 3NKSA 1GEUA 4TLXA 3UCLA 2C3CA 1H82A 2X8GA 1OJAA 3GD3A 5ER0A 3VR8A 3VRBA 3H8LA 1RYIA 1PBEA 3AEFA 4Q5BA 1N4UA 1NENA 2ACZA 1CC2A 1GPEA 2FJDA 2JAEA 3G5RA 4UDPA 2AR8A 2XDOA 3CPJG 4YKFA 3EF6A 2V3BA 1YQZA 1F8WA 3UP5A 3R9UA 3IHMA 3B3RA 1ZK7A 1TDKA 1GSNA 3P4PA 4OPTA 4H4UA 2Y6QA 1YY5A 3RP6A 1KSUA 2XVIA 3UOYA 5JCNA 1BF3A 2XLUA 1PJ7A 1S2YA 4BK3A 4YSXA 2YWLA 1XANA 2VQ7A 3NTAA 2BCPA 3PO7A 4CNKA 3CNJA 1GRFA 2C75A 3GWFA 3CN8A 2R0CA 3NNEA 2C64A 1DJQA 4Z2UA 4CNJA 4Z26A 3UKHA 3EAOA 2CDUA 2RF7A 3BNFA 3F8DA 3UKKA 2J7AA 4C74A 3AEEA 2RDZA 1JOAA 1OAHA 1K0LA 2WQYA 5J60A 5JCIA 2F5ZA 1NAAA 1Y56B 2DKIA 3ISHA 1GESA 1NEKA 2VR0A 1QLBA 3CNDA 1GETA 2R9ZA 3DK4A 5CQFA 3AEGA 4ADWA 2IVDA 1W4XA 3ICSA 5GRTA 1D4CA 2BA9A 1NHRA 3BI4A 3ADAB 3NYCA 4U8MA 4U8LA 2CFYA 3FO3A 1L9CA 2Y6RA 3D1CA 1FS7A 5IPYA 3G5SA 1LTXR 4H4PA 3KLJA 3OWMA 1Y56A 2YM1A 3GM6A 2FJBA 1GTEA 4GDPA 5C2TA 5KXJA 4Z43A 1M64A 5TR3A 4U2LA 2BS3A 3ZDNA 3NHOX 3GDNA 1F6MA
chains in the Genus database with same CATH superfamily
3BNHA 2WHDA 2E81A 2JKCA 3DJDA 1LV0A 3GSIA 2EQ7A 1DODA 5CKUA 1F8RA 1AOGA 3ICTA 2B7SA 1B5QA 2V60A 2ZZCA 3NGCX 2GH5A 3P4QA 4OPUA 4ZN0A 2V6OA 4J36A 2CZSA 4X4JA 4IA6A 4K8DA 1H81A 1M6IA 3HYWA 2VRMA 3C4AA 3RKHA 1OJTA 2JB3A 3QSMA 2A8XA 2FJEA 2PHHA 4K5SA 3T31A 4GUVA 2GMJA 3AE2A 4BV6A 1N4WA 3SGLA 4WCTA 2WS3A 3KKJA 4CY8A 4CY6A 3MMOA 3NTDA 2YLZA 3DK8A 3Q6JA 4USQA 4EM4A 4HA6A 3UKFA 1LQTA 4Z2TA 1SP3A 1KDGA 3LOVA 4DSGA 5L46A 4BK1A 4D03A 1EBDA 1K4QA 4GCMA 4JDRA 1PXAA 2Q0LA 3GMCA 2E4GA 1B37A 4I58A 4U8PA 1VG9A 4EMJA 2OALA 4FX9A 1O95A 5JCKA 4H4SA 1K0JA 4YTMA 3VR9A 3DGZA 2EQ6A 1GOSA 2BXRA 3AYIA 3FG2P 1CJ4A 1TYPA 1PBBA 3PVCA 4U2TA 2Q6UA 4X9NA 2WP5A 3AE4A 1FCDA 3OC4A 4A99A 1DOBA 5EB5A 1OJ9A 4Y4LA 3AE6A 3S61A 3DJGX 2VOUA 2EQ9A 3CGCA 3NYEA 2GMHA 1EL9A 4XWZA 5BVAA 2WPCA 1CHUA 1E1NA 3KPFA 1M1PA 3AE7A 3F8RA 3QSEA 4FK1A 3RP7A 1JNZA 1D7LA 3AECA 4L38A 4IA5A 4B63A 1E6EA 1MO9A 4H4RA 1DJNA 1CBOA 4H4YA 4O5QA 4A6NB 4EQRA 5DBJA 1E7PA 2R46A 5FS9A 1NG3A 1Z6LA 4O5UA 4C77A 4L3YA 2RGJA 4G9KA 1FT5A 3CPHG 3TORA 3GDPA 3UKAA 1LQUA 1M1QA 5FMHA 3OZ2A 3UKLA 5BULA 3LZWA 3AE8A 4KPRA 2WDVA 1ZOYA 3VRAA 5M10A 4WX1A 1F3PA 4H4TA 3T2KA 1CF3A 2GAGB 2Z5XA 4H2NA 3IHGA 1FEBA 1TDNA 3V3OA 4DNAA 3SM8A 3P4RA 2B9YA 4K5RA 4N9XA 1JRXA 2C76A 3GWDA 1RSGA 1FEAA 3M0OA 4JNQA 4LA1A 4L3ZA 2WBAA 3F29A 3BNGA 2TPRA 4D04A 3CNSA 1BGNA 3QSSA 4KX6A 3CNPA 2WESA 4GAPA 4Q17A 2VVMA 4J31A 3UOVA 2V3AA 2AAQA 2R4EA 1H6VA 4AT2A 1MXTA 4ZCCA 1L9EA 1DXLA 4B1BA 4Z24A 4U8JA 1CL0A 5BRTA 5HXIA 2OLOA 5HYMA 2AQJA 5KVIA 4G6HA 3AEAA 2WP6A 1IUVA 2XFUA 4P9SA 2JB1A 4H4ZA 4YSHA 1KF6A 3II4A 4H4QA 4OPIA 2HQMA 2WPEA 2DKHA 2OA1A 3GYJA 2BS2A 3M12A 2WU2A 5KRQA 2V61A 3I6DA 3ZYXA 2C73A 1DOEA 1EL5A 1ZKQA 3AE5A 1EL7A 5FS8A 4Q4UA 4EM3A 1GTHA 4EQWA 3RHAA 2XLTA 2BACA 3QVPA 2C65A 1NDAA 3NN0X 3G5QA 4ICYA 1NHSA 1ZMDA 3T37A 2QA1A 3FBSA 4BJYA 3Q9TA 4M52A 4A7AA 2R0PA 4EIPA 3DJEA 4YXDA 2QCUA 2B76A 5HHFA 2YLXA 2NVKX 1GALA 1D4DA 2GR2A 3NLCA 2APGA 3PS9A 3S5WA 5KNLA 2ZZ0A 3P1WA 1P2HA 4WJYA 4GR1A 1TDEA 3AE9A 3SY4A 2B7RA 5KMSA 4G6GA 1COYA 2X50A 2X99A 3BNJA 3BHKA 3GRTA 4LU6A 4J33A 3AEBA 2OT4A 2BC1A 2GAHB 2TMDA 3TTBA 2EQ8A 1M1RA 1BVBA 3DK9A 3JSKA 1CJ2A 3CGDA 4APNA 2IIDA 4I59A 2YVGA 3SFEA 4BJZA 3SX6A 4TM3A 2GR1A 3LB8A 1H7XA 2WDRA 1QJDA 1BZLA 2Q7VA 1K0IA 4B67A 3CGBA 3F8PA 3UOXA 1PJ5A 1Q1RA 2BRAA 5U1OA 4J2WA 1S2QA 2WP9A 4AP1A 4LIIA 2OAMA 3ATQA 3B6DA 3QFAA 4PABA 3SZWA 3FPZA 4TLZA 3COXA 1N1PA 1SEZA 1JU2A 2YR5A 3S7WA 1S3BA 3DMEA 2X8CA 2PYXA 1GRHA 2YG6A 4E0VA 2C3DA 1KSSA 1VDCA 4RSLA 1PBDA 1LPFA 4OPCA 3NYFA 3AYJA 2GB0A 2XFQA 1MOKA 4FDCB 1VRQB 1GRTA 1GU6A 2JBVA 4NTCA 4Z44A 1BKWA 2GV8A 5BUKA 2WOWA 3SCEA 1O94A 2YVJA 2B9WA 3UTHA 4EMWA 4OVIA 2H88A 1PXBA 2R45A 1ELIA 4B64A 2YR6A 4H4WA 3K7MX 4YT0A 2WOIA 3AE3A 1PXCA 4A5LA 4BURA 5EOWA 3NG7X 2YLSA 4REKA 2QAEA 4CCQA 4TM1A 5KOXA 2BK3A 3SXIA 2OLNA 1PBFA 3CGEA 1FOHA 3CIRA 4BK2A 1GNDA 1JNIA 5M0ZA 4NTEA 5GSNA 2XLPA 3URHA 3DH9A 2BABA 4UP3A 2GRTA 1HYUA 2V5ZA 1DNCA 4OPDA 3SQPA 4AOXA 4YTNA 5KOWA 1Q9IA 2XVFA 4IVMB 1QDBA 1PHHA 1TYTA 2R0GA 1GV4A 3C96A 4OPLA 1NG4A 3UTFA 1Q1WA 2BXSA 4H4VA 3E1TA 1JRZA 3L1TA 1RP0A 4J34A 3NH3X 3QFBA 3AWIA 5KVHA 4YKGA 3KA7A 4Q0TA 3RP8A 4MJWA 4GAVA 1CJCA 2O9ZA 1GERA 1ZP0A 2YG4A 2JB2A 2XYOA 1L9DA 2C67A 2UZZA 3T0KA 4CBQA 2A87A 3IC9A 4YSZA 4U8NA 5LV9A 4JN9A 2VRLA 3KU9A 3UTGA 5KMQA 3P9UA 1CJ3A 1H84A 3BI5A 3DGHA 4K22A 4U8IA 4NTDA 4TM0A 3NK0X 3AYLA 1GRGA 2BK5A 2X8HA 1XDIA 3GRSA 1PBCA 3K7TA 2NPXA 3IWAA 3ALJA 1IUWA 3I3LA 1OJDA 4ECHA 1GRAA 3UBRA 4B69A 1VG0A 3CMMA 4PAAA 2WEUA 3CNTA 4Z25A 4IVOB 3AXBA 2RGHA 2XLRA 4JQ9A 4Y4NA 4JNAA 4J56A 2WPFA 4AP3A 4H2QA 2YAUA 1KNPA 2VZ2A 3REDA 3ATRA 4JY2A 2CVJA 3GD4A 4K7ZA 3GMBA 4B65A 1ZMCA 4Q5CA 3LJPA 2XFOA 3WE0A 1ONFA 1NHQA 1KNRA 4NWZA 4EQSA 5EBKA 3AB1A 1JRYA 5JCMA 1NHPA 4AOSA 2W0HA 3BNMA 4NEVA 4U8KA 1S3EA 1TDOA 3K7QX 3VRDB 4XWRA 2C4CA 4UDRA 1VQWA 2BCGG 3LZXA 1TRBA 3ABVA 3CPIG 4OCGA 2K3VA 1FL2A 1GXFA 3UKPA 4B66A 2BYBA 2C66A 3AD8B 2YLWA 2WU5A 2YG3A 4GRTA 3AD7B 1NPXA 1TDFA 4NZHA 3O0HA 3T2YA 3CTYA 2XLSA 4II3A 3ALLA 4C3YA 4EIQA 4IV9A 2VVLG 3LXDA 1XPQA 4H4XA 3UKQA 3FMWA 1DOCA 2YM2A 5C3JA 1ZOVA 2VQBA 2WETA 4II2A 3H4KA 3D1IA 1O5WA 4RG3A 2YLRA 3IF9A 1F8SA 3BHFA 2RABA 2VVLA 1UKVG 1XHCA 1QO8A 1D7YA 4Q1OA 3DJJA 3UP4A 2BK4A 2BC0A 2XVHA 1LVLA 5FS7A 2C72A 3H8IA 3LGQA 2C70A 2GF3A 1ZDLA 2GR3A 3BNUA 3LADA 5U25A 3L8KA 3QJ4A 4CCRA 5HY5A 3K30A 3UU9A 1P2EA 4X9MA 3UTEA 1E1MA 2GR0A 1PDHA 3KD9A 1N4VA 2ARDA 2YVFA 2H89A 3T14A 4C5OA 2X3NA 3NRNA 1IUXA 4FK1C 3HZLA 5IQ1A 1JEHA 2E5VA 1BWCA 2FBWA 4UDQA 1E1LA 3L1RA 1D4EA 2XFPA 4NNJA 1IUTA 3AE1A 2RGOA 4Y4MA 3NN6X 2YG7A 1D5TA 2YG5A 1B8SA 1FECA 3SFDA 1E1KA 3NK2X 4XXGA 5FS6A 2WOVA 5EB4A 4A79A 4AT0A 4GDEA 2C7GA 5JCLA 2A89A 4GF7A 3VQRA 1IUUA 3EPTA 4U8OA 4YWOA 3SXQA 1X31B 2FJAA 1FS8A 2XFNA 3NIXA 4OPGA 4TM4A 4B68A 4K2XA 1YQ4A 2XVJA 1CC6A 2BS4A 3AD9B 3UOZA 1IJHA 3KVEA 4A9WA 3V76A 2GEWA 1GT8A 1H83A 3ICRA 1YKJA 3BI2A 3C4NA 3SZFA 4JY3A 5KWFA 4EMIA 2GQFA 2JK6A 2ZZBA 1CC4A 1GREA 1H7WA 2IVEA 3GYIA 3GYXA 4G73A 4YTPA 4H2PA 2GQWA 3SZ0A 2Z5YA 1IUSA 4J57A 3NK1X 1PS9A 4H2RA 1PN0A 3RNMA 2QA2A 1PJ6A 4EQXA 1V59A 2ZBWA 3QVRA 2LFCA 1Y0PA 5J7XA 1JNRA 1GRBA 3P4SA 4H50A 4NEWA 4CRTA 1YQ3A 2YR4A 4YSYA 2Q0KA 3HYXA 2CULA 2XVEA 1ZX9A 2YQUA 2E80A 1REOA 2E1MA 2I0ZA 2BRYA 5IQ4A 1E39A 3LG1A 1H86A 1KFYA 3EANA 3DA1A 3D8XA 3SYIA 4DGKA 4H7UA 1BGJA 1OJCA 3ALMA 4HB9A 4U2SA 3ITJA 4Z2RA 4DSHA 4RG4A 4USRA 2B9XA 3AEDA 4C3XA 4ZCDA 1FT6A 5U63A 2R4JA 1L0VA 1FS9A 3SZCA 4A6NA 2ZO5A 2GVCA 2WDQA 4L3XA 2YLTA 3M13A 1ZY8A 1LJ1A 1EL8A 3V3NA 4A65A 1B4VA 2XCGA 3NT6A 3FIMB 2J3NA 3NKSA 1GEUA 4TLXA 3UCLA 2C3CA 1H82A 2X8GA 1OJAA 3GD3A 5ER0A 3VR8A 3VRBA 3H8LA 1RYIA 1PBEA 3AEFA 4Q5BA 1N4UA 1NENA 2ACZA 1CC2A 1GPEA 2FJDA 2JAEA 3G5RA 4UDPA 2AR8A 2XDOA 3CPJG 4YKFA 3EF6A 2V3BA 1YQZA 1F8WA 3UP5A 3R9UA 3IHMA 3B3RA 1ZK7A 1TDKA 1GSNA 3P4PA 4OPTA 4H4UA 2Y6QA 1YY5A 3KPKA 3RP6A 1KSUA 2XVIA 3UOYA 5JCNA 1BF3A 2XLUA 1PJ7A 1S2YA 4BK3A 4YSXA 2YWLA 1XANA 2VQ7A 3NTAA 2BCPA 3PO7A 4CNKA 3CNJA 1GRFA 2C75A 3GWFA 3CN8A 2R0CA 3NNEA 2C64A 1DJQA 4Z2UA 4CNJA 4Z26A 3UKHA 3EAOA 2CDUA 2RF7A 3BNFA 3F8DA 3UKKA 2J7AA 4C74A 3AEEA 2RDZA 1JOAA 1OAHA 1K0LA 2WQYA 5J60A 5JCIA 2F5ZA 1NAAA 1Y56B 2DKIA 3ISHA 1GESA 1NEKA 2VR0A 1QLBA 3T2ZA 3CNDA 1GETA 2R9ZA 3DK4A 3HYVA 5CQFA 3AEGA 4ADWA 2IVDA 1W4XA 3ICSA 5GRTA 5KMPA 1D4CA 2BA9A 1NHRA 3BI4A 3ADAB 3NYCA 4U8MA 4U8LA 2CFYA 3FO3A 1L9CA 4G74A 2Y6RA 3D1CA 1FS7A 5IPYA 3G5SA 1LTXR 4H4PA 3KLJA 3OWMA 1Y56A 2YM1A 3GM6A 2FJBA 1GTEA 4GDPA 5C2TA 5KXJA 5KMRA 4Z43A 1M64A 5TR3A 4U2LA 2BS3A 3ZDNA 3NHOX 3GDNA 1F6MA
chains in the Genus database with same CATH topology
3BNHA 2WHDA 2E81A 2JKCA 3DJDA 1LV0A 3GSIA 2EQ7A 1DODA 5CKUA 1F8RA 1AOGA 3ICTA 2B7SA 1B5QA 2V60A 2ZZCA 3NGCX 2GH5A 3P4QA 4OPUA 4ZN0A 2V6OA 4J36A 4X4JA 4IA6A 4K8DA 1H81A 1M6IA 3HYWA 2VRMA 3C4AA 3RKHA 1OJTA 2JB3A 3QSMA 2A8XA 2FJEA 2PHHA 4K5SA 3T31A 4GUVA 2GMJA 3AE2A 4BV6A 1N4WA 3SGLA 4WCTA 2WS3A 3KKJA 4CY8A 4CY6A 3MMOA 3NTDA 2YLZA 3DK8A 3Q6JA 4USQA 4EM4A 4HA6A 3UKFA 1LQTA 4Z2TA 1SP3A 1KDGA 3LOVA 4DSGA 5L46A 4BK1A 4D03A 1EBDA 1K4QA 4GCMA 4JDRA 1PXAA 2Q0LA 3GMCA 2E4GA 1B37A 4I58A 4U8PA 1VG9A 4EMJA 2OALA 4FX9A 1O95A 5JCKA 4H4SA 1K0JA 4YTMA 3VR9A 3DGZA 2EQ6A 1GOSA 2BXRA 3AYIA 3FG2P 1CJ4A 1TYPA 1PBBA 3PVCA 4U2TA 2Q6UA 4X9NA 2WP5A 3AE4A 1FCDA 3OC4A 4A99A 1DOBA 5EB5A 1OJ9A 4Y4LA 3AE6A 3S61A 3DJGX 2VOUA 2EQ9A 3CGCA 3NYEA 2GMHA 1EL9A 4XWZA 5BVAA 2WPCA 1CHUA 1E1NA 3KPFA 1M1PA 3AE7A 3F8RA 3QSEA 4FK1A 3RP7A 1JNZA 1D7LA 3AECA 4L38A 4IA5A 4B63A 1E6EA 1MO9A 4H4RA 1DJNA 1CBOA 4H4YA 4O5QA 4A6NB 4EQRA 5DBJA 1E7PA 2R46A 5FS9A 1NG3A 1Z6LA 4O5UA 4C77A 4L3YA 2RGJA 4G9KA 1FT5A 3CPHG 3TORA 3GDPA 3UKAA 1LQUA 1M1QA 5FMHA 3OZ2A 3UKLA 5BULA 3LZWA 3AE8A 4KPRA 2WDVA 1ZOYA 3VRAA 5M10A 4WX1A 1F3PA 4H4TA 3T2KA 1CF3A 2GAGB 2Z5XA 4H2NA 3IHGA 1FEBA 1TDNA 3V3OA 4DNAA 3SM8A 3P4RA 2B9YA 4K5RA 4N9XA 1JRXA 2C76A 3GWDA 1RSGA 1FEAA 3M0OA 4JNQA 4LA1A 4L3ZA 2WBAA 3F29A 3BNGA 2TPRA 4D04A 3CNSA 1BGNA 3QSSA 4KX6A 3CNPA 2WESA 4GAPA 4Q17A 2VVMA 4J31A 3UOVA 2V3AA 2AAQA 2R4EA 1H6VA 4AT2A 1MXTA 4ZCCA 1L9EA 1DXLA 4B1BA 4Z24A 4U8JA 1CL0A 5BRTA 5HXIA 2OLOA 5HYMA 2AQJA 5KVIA 4G6HA 3AEAA 2WP6A 1IUVA 2XFUA 4P9SA 2JB1A 4H4ZA 4YSHA 1KF6A 3II4A 4H4QA 4OPIA 2HQMA 2WPEA 2DKHA 2OA1A 3GYJA 2BS2A 3M12A 2WU2A 5KRQA 2V61A 3I6DA 3ZYXA 2C73A 1DOEA 1EL5A 1ZKQA 3AE5A 1EL7A 5FS8A 4Q4UA 4EM3A 1GTHA 4EQWA 3RHAA 2XLTA 2BACA 3QVPA 2C65A 1NDAA 3NN0X 3G5QA 4ICYA 1NHSA 1ZMDA 3T37A 2QA1A 3FBSA 4BJYA 3Q9TA 4M52A 4A7AA 2R0PA 4EIPA 3DJEA 4YXDA 2QCUA 2B76A 5HHFA 2YLXA 2NVKX 1GALA 1D4DA 2GR2A 3NLCA 2APGA 3PS9A 3S5WA 5KNLA 2ZZ0A 3P1WA 1P2HA 4WJYA 4GR1A 1TDEA 3AE9A 3SY4A 2B7RA 5KMSA 4G6GA 1COYA 2X50A 2X99A 3BNJA 3BHKA 3GRTA 4LU6A 4J33A 3AEBA 2OT4A 2BC1A 2GAHB 2TMDA 3TTBA 2EQ8A 1M1RA 1BVBA 3DK9A 3JSKA 1CJ2A 3CGDA 4APNA 2IIDA 4I59A 2YVGA 3SFEA 4BJZA 3SX6A 4TM3A 2GR1A 3LB8A 1H7XA 2WDRA 1QJDA 1BZLA 2Q7VA 1K0IA 4B67A 3CGBA 3F8PA 3UOXA 1PJ5A 1Q1RA 2BRAA 5U1OA 4J2WA 1S2QA 2WP9A 4AP1A 4LIIA 2OAMA 3ATQA 3B6DA 3QFAA 4PABA 3SZWA 3FPZA 4TLZA 3COXA 1N1PA 1SEZA 1JU2A 2YR5A 3S7WA 1S3BA 3DMEA 2X8CA 2PYXA 1GRHA 2YG6A 4E0VA 2C3DA 1KSSA 1VDCA 4RSLA 1PBDA 1LPFA 4OPCA 3NYFA 3AYJA 2GB0A 2XFQA 1MOKA 4FDCB 1VRQB 1GRTA 1GU6A 2JBVA 4NTCA 4Z44A 1BKWA 2GV8A 5BUKA 2WOWA 3SCEA 1O94A 2YVJA 2B9WA 3UTHA 4EMWA 4OVIA 2H88A 1PXBA 2R45A 1ELIA 4B64A 2YR6A 4H4WA 3K7MX 4YT0A 2WOIA 3AE3A 1PXCA 4A5LA 4BURA 5EOWA 3NG7X 2YLSA 4REKA 2QAEA 4CCQA 4TM1A 5KOXA 2BK3A 3SXIA 2OLNA 1PBFA 3CGEA 1FOHA 3CIRA 4BK2A 1GNDA 1JNIA 5M0ZA 4NTEA 5GSNA 2XLPA 3URHA 3DH9A 2BABA 4UP3A 2GRTA 1HYUA 2V5ZA 1DNCA 4OPDA 3SQPA 4AOXA 4YTNA 5KOWA 1Q9IA 2XVFA 4IVMB 1QDBA 1PHHA 1TYTA 2R0GA 1GV4A 3C96A 4OPLA 1NG4A 3UTFA 1Q1WA 2BXSA 4H4VA 3E1TA 1JRZA 3L1TA 1RP0A 4J34A 3NH3X 3QFBA 3AWIA 5KVHA 4YKGA 3KA7A 4Q0TA 3RP8A 4MJWA 4GAVA 1CJCA 2O9ZA 1GERA 1ZP0A 2YG4A 2JB2A 2XYOA 1L9DA 2C67A 2UZZA 3T0KA 4CBQA 2A87A 3IC9A 4YSZA 4U8NA 5LV9A 4JN9A 2VRLA 3KU9A 3UTGA 5KMQA 3P9UA 1CJ3A 1H84A 3BI5A 3DGHA 4K22A 4U8IA 4NTDA 4TM0A 3NK0X 3AYLA 1GRGA 2BK5A 2X8HA 1XDIA 3GRSA 1PBCA 3K7TA 2NPXA 3IWAA 3ALJA 1IUWA 3I3LA 1OJDA 4ECHA 1GRAA 3UBRA 4B69A 1VG0A 3CMMA 4PAAA 2WEUA 3CNTA 4Z25A 4IVOB 3AXBA 2RGHA 2XLRA 4JQ9A 4Y4NA 4JNAA 4J56A 2WPFA 4AP3A 4H2QA 2YAUA 1KNPA 2VZ2A 3REDA 3ATRA 4JY2A 2CVJA 3GD4A 4K7ZA 3GMBA 4B65A 1ZMCA 4Q5CA 3LJPA 2XFOA 3WE0A 1ONFA 1NHQA 1KNRA 4NWZA 4EQSA 5EBKA 3AB1A 1JRYA 5JCMA 1NHPA 4AOSA 2W0HA 3BNMA 4NEVA 4U8KA 1S3EA 1TDOA 3K7QX 3VRDB 4XWRA 2C4CA 4UDRA 1VQWA 2BCGG 3LZXA 1TRBA 3ABVA 3CPIG 4OCGA 2K3VA 1FL2A 1GXFA 3UKPA 4B66A 2BYBA 2C66A 3AD8B 2YLWA 2WU5A 2YG3A 4GRTA 3AD7B 1NPXA 1TDFA 4NZHA 3O0HA 3T2YA 3CTYA 2XLSA 4II3A 3ALLA 4C3YA 4EIQA 4IV9A 2VVLG 3LXDA 1XPQA 4H4XA 3UKQA 3FMWA 1DOCA 2YM2A 5C3JA 1ZOVA 2VQBA 2WETA 4II2A 3H4KA 3D1IA 1O5WA 4RG3A 2YLRA 3IF9A 1F8SA 3BHFA 2RABA 2VVLA 1UKVG 1XHCA 1QO8A 1D7YA 4Q1OA 3DJJA 3UP4A 2BK4A 2BC0A 2XVHA 1LVLA 5FS7A 2C72A 3H8IA 3LGQA 2C70A 2GF3A 1ZDLA 2GR3A 3BNUA 3LADA 5U25A 3L8KA 3QJ4A 4CCRA 5HY5A 3K30A 3UU9A 1P2EA 4X9MA 3UTEA 1E1MA 2GR0A 1PDHA 3KD9A 1N4VA 2ARDA 2YVFA 2H89A 3T14A 4C5OA 2X3NA 3NRNA 1IUXA 4FK1C 3HZLA 5IQ1A 1JEHA 2E5VA 1BWCA 2FBWA 4UDQA 1E1LA 3L1RA 1D4EA 2XFPA 4NNJA 1IUTA 3AE1A 2RGOA 4Y4MA 3NN6X 2YG7A 1D5TA 2YG5A 1B8SA 1FECA 3SFDA 1E1KA 3NK2X 4XXGA 5FS6A 2WOVA 5EB4A 4A79A 4AT0A 4GDEA 2C7GA 5JCLA 2A89A 4GF7A 3VQRA 1IUUA 3EPTA 4U8OA 4YWOA 3SXQA 1X31B 2FJAA 1FS8A 2XFNA 3NIXA 4OPGA 4TM4A 4B68A 4K2XA 1YQ4A 2XVJA 1CC6A 2BS4A 3AD9B 3UOZA 1IJHA 3KVEA 4A9WA 3V76A 2GEWA 1GT8A 1H83A 3ICRA 1YKJA 3BI2A 3C4NA 3SZFA 4JY3A 5KWFA 4EMIA 2GQFA 2JK6A 2ZZBA 1CC4A 1GREA 1H7WA 2IVEA 3GYIA 3GYXA 4G73A 4YTPA 4H2PA 2GQWA 3SZ0A 2Z5YA 1IUSA 4J57A 3NK1X 1PS9A 4H2RA 1PN0A 3RNMA 2QA2A 1PJ6A 4EQXA 1V59A 2ZBWA 3QVRA 2LFCA 1Y0PA 5J7XA 1JNRA 1GRBA 3P4SA 4H50A 4NEWA 4CRTA 1YQ3A 2YR4A 4YSYA 2Q0KA 3HYXA 2CULA 2XVEA 1ZX9A 2YQUA 2E80A 1REOA 2E1MA 2I0ZA 2BRYA 5IQ4A 1E39A 3LG1A 1H86A 1KFYA 3EANA 3DA1A 3D8XA 3SYIA 4DGKA 4H7UA 1BGJA 1OJCA 3ALMA 4HB9A 4U2SA 3ITJA 4Z2RA 4DSHA 4RG4A 4USRA 2B9XA 3AEDA 4C3XA 4ZCDA 1FT6A 5U63A 2R4JA 1L0VA 1FS9A 3SZCA 4A6NA 2ZO5A 2GVCA 2WDQA 4L3XA 2YLTA 3M13A 1ZY8A 1LJ1A 1EL8A 3V3NA 4A65A 1B4VA 2XCGA 3NT6A 3FIMB 2J3NA 3NKSA 1GEUA 4TLXA 3UCLA 2C3CA 1H82A 2X8GA 1OJAA 3GD3A 5ER0A 3VR8A 3VRBA 3H8LA 1RYIA 1PBEA 3AEFA 4Q5BA 1N4UA 1NENA 2ACZA 1CC2A 1GPEA 2FJDA 2JAEA 3G5RA 4UDPA 2AR8A 2XDOA 3CPJG 4YKFA 3EF6A 2V3BA 1YQZA 1F8WA 3UP5A 3R9UA 3IHMA 3B3RA 1ZK7A 1TDKA 1GSNA 3P4PA 4OPTA 4H4UA 2Y6QA 1YY5A 3KPKA 3RP6A 1KSUA 2XVIA 3UOYA 5JCNA 1BF3A 2XLUA 1PJ7A 1S2YA 4BK3A 4YSXA 2YWLA 1XANA 2VQ7A 3NTAA 2BCPA 3PO7A 4CNKA 3CNJA 1GRFA 2C75A 3GWFA 3CN8A 2R0CA 3NNEA 2C64A 1DJQA 4Z2UA 4CNJA 4Z26A 3UKHA 3EAOA 2CDUA 2RF7A 3BNFA 3F8DA 3UKKA 2J7AA 4C74A 3AEEA 2RDZA 1JOAA 1OAHA 1K0LA 2WQYA 5J60A 5JCIA 2F5ZA 1NAAA 1Y56B 2DKIA 3ISHA 1GESA 1NEKA 2VR0A 1QLBA 3T2ZA 3CNDA 1GETA 2R9ZA 3DK4A 3HYVA 5CQFA 3AEGA 4ADWA 2IVDA 1W4XA 3ICSA 5GRTA 5KMPA 1D4CA 2BA9A 1NHRA 3BI4A 3ADAB 3NYCA 4U8MA 4U8LA 2CFYA 3FO3A 1L9CA 4G74A 2Y6RA 3D1CA 1FS7A 5IPYA 3G5SA 1LTXR 4H4PA 3KLJA 3OWMA 1Y56A 2YM1A 3GM6A 2FJBA 1GTEA 4GDPA 5C2TA 5KXJA 5KMRA 4Z43A 1M64A 5TR3A 4U2LA 2BS3A 3ZDNA 3NHOX 3GDNA 1F6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BNH A;  2WHD A;  2E81 A;  2JKC A;  3DJD A;  1LV0 A;  3GSI A;  2EQ7 A;  1DOD A;  5CKU A;  1F8R A;  1AOG A;  3ICT A;  2B7S A;  1B5Q A;  2V60 A;  2ZZC A;  3NGC X;  2GH5 A;  3P4Q A;  4OPU A;  4ZN0 A;  2V6O A;  4J36 A;  4X4J A;  4IA6 A;  4K8D A;  1H81 A;  1M6I A;  2VRM A;  3C4A A;  3RKH A;  1OJT A;  2JB3 A;  3QSM A;  2A8X A;  2FJE A;  2PHH A;  4K5S A;  4GUV A;  2GMJ A;  3AE2 A;  4BV6 A;  1N4W A;  3SGL A;  4WCT A;  2WS3 A;  3KKJ A;  4CY8 A;  4CY6 A;  3MMO A;  3NTD A;  2YLZ A;  3DK8 A;  3Q6J A;  4USQ A;  4EM4 A;  4HA6 A;  3UKF A;  1LQT A;  4Z2T A;  1SP3 A;  1KDG A;  3LOV A;  4DSG A;  5L46 A;  4BK1 A;  4D03 A;  1EBD A;  1K4Q A;  4GCM A;  4JDR A;  1PXA A;  2Q0L A;  3GMC A;  2E4G A;  1B37 A;  4I58 A;  4U8P A;  1VG9 A;  4EMJ A;  2OAL A;  4FX9 A;  1O95 A;  5JCK A;  4H4S A;  1K0J A;  4YTM A;  3VR9 A;  3DGZ A;  2EQ6 A;  1GOS A;  2BXR A;  3AYI A;  3FG2 P;  1CJ4 A;  1TYP A;  1PBB A;  3PVC A;  4U2T A;  2Q6U A;  4X9N A;  2WP5 A;  3AE4 A;  1FCD A;  3OC4 A;  4A99 A;  1DOB A;  5EB5 A;  1OJ9 A;  4Y4L A;  3AE6 A;  3S61 A;  3DJG X;  2VOU A;  2EQ9 A;  3CGC A;  3NYE A;  2GMH A;  1EL9 A;  4XWZ A;  5BVA A;  2WPC A;  1CHU A;  1E1N A;  3KPF A;  1M1P A;  3AE7 A;  3F8R A;  3QSE A;  4FK1 A;  3RP7 A;  1JNZ A;  1D7L A;  3AEC A;  4L38 A;  4IA5 A;  4B63 A;  1E6E A;  1MO9 A;  4H4R A;  1DJN A;  1CBO A;  4H4Y A;  4O5Q A;  4A6N B;  4EQR A;  5DBJ A;  1E7P A;  2R46 A;  5FS9 A;  1NG3 A;  1Z6L A;  4O5U A;  4C77 A;  4L3Y A;  2RGJ A;  1FT5 A;  3CPH G;  3TOR A;  3GDP A;  3UKA A;  1LQU A;  1M1Q A;  5FMH A;  3OZ2 A;  3UKL A;  5BUL A;  3LZW A;  3AE8 A;  4KPR A;  2WDV A;  1ZOY A;  3VRA A;  5M10 A;  4WX1 A;  1F3P A;  4H4T A;  1CF3 A;  2GAG B;  2Z5X A;  4H2N A;  3IHG A;  1FEB A;  1TDN A;  3V3O A;  4DNA A;  3SM8 A;  3P4R A;  2B9Y A;  4K5R A;  4N9X A;  1JRX A;  2C76 A;  3GWD A;  1RSG A;  1FEA A;  3M0O A;  4JNQ A;  4LA1 A;  4L3Z A;  2WBA A;  3F29 A;  3BNG A;  2TPR A;  4D04 A;  3CNS A;  1BGN A;  3QSS A;  4KX6 A;  3CNP A;  2WES A;  4J31 A;  4Q17 A;  2VVM A;  3UOV A;  2V3A A;  2AAQ A;  2R4E A;  1H6V A;  4AT2 A;  1MXT A;  4ZCC A;  1L9E A;  1DXL A;  4B1B A;  4Z24 A;  4U8J A;  1CL0 A;  5BRT A;  5HXI A;  2OLO A;  5HYM A;  2AQJ A;  5KVI A;  3AEA A;  2WP6 A;  1IUV A;  2XFU A;  4P9S A;  2JB1 A;  4H4Z A;  4YSH A;  1KF6 A;  3II4 A;  4H4Q A;  4OPI A;  2HQM A;  2WPE A;  2DKH A;  2OA1 A;  3GYJ A;  2BS2 A;  3M12 A;  2WU2 A;  5KRQ A;  2V61 A;  3I6D A;  3ZYX A;  2C73 A;  1DOE A;  1EL5 A;  1ZKQ A;  3AE5 A;  1EL7 A;  5FS8 A;  4Q4U A;  4EM3 A;  1GTH A;  4EQW A;  3RHA A;  2XLT A;  2BAC A;  3QVP A;  2C65 A;  1NDA A;  3NN0 X;  3G5Q A;  4ICY A;  1NHS A;  1ZMD A;  3T37 A;  2QA1 A;  3FBS A;  4BJY A;  3Q9T A;  4M52 A;  4A7A A;  2R0P A;  4EIP A;  3DJE A;  4YXD A;  2QCU A;  2B76 A;  5HHF A;  2YLX A;  2NVK X;  1GAL A;  1D4D A;  2GR2 A;  3NLC A;  2APG A;  3PS9 A;  3S5W A;  2ZZ0 A;  3P1W A;  1P2H A;  4WJY A;  4GR1 A;  1TDE A;  3AE9 A;  2B7R A;  1COY A;  2X50 A;  2X99 A;  3BNJ A;  3BHK A;  3GRT A;  4LU6 A;  4J33 A;  3AEB A;  2OT4 A;  2BC1 A;  2GAH B;  2TMD A;  3TTB A;  2EQ8 A;  1M1R A;  1BVB A;  3DK9 A;  3JSK A;  1CJ2 A;  3CGD A;  4APN A;  2IID A;  4I59 A;  2YVG A;  3SFE A;  4BJZ A;  4TM3 A;  2GR1 A;  3LB8 A;  1H7X A;  2WDR A;  1QJD A;  1BZL A;  2Q7V A;  1K0I A;  4B67 A;  3CGB A;  3F8P A;  3UOX A;  1PJ5 A;  1Q1R A;  5U1O A;  4J2W A;  1S2Q A;  2WP9 A;  4AP1 A;  4LII A;  2OAM A;  3ATQ A;  3B6D A;  3QFA A;  4PAB A;  3FPZ A;  4TLZ A;  3COX A;  1N1P A;  1SEZ A;  1JU2 A;  2YR5 A;  3S7W A;  1S3B A;  3DME A;  2X8C A;  2PYX A;  1GRH A;  2YG6 A;  4E0V A;  2C3D A;  1KSS A;  1VDC A;  4RSL A;  1PBD A;  1LPF A;  4OPC A;  3NYF A;  3AYJ A;  2GB0 A;  2XFQ A;  1MOK A;  4FDC B;  1VRQ B;  1GRT A;  1GU6 A;  2JBV A;  4NTC A;  4Z44 A;  1BKW A;  2GV8 A;  5BUK A;  2WOW A;  3SCE A;  1O94 A;  2YVJ A;  2B9W A;  3UTH A;  4EMW A;  4OVI A;  2H88 A;  1PXB A;  2R45 A;  1ELI A;  4B64 A;  2YR6 A;  4H4W A;  3K7M X;  4YT0 A;  2WOI A;  3AE3 A;  1PXC A;  4A5L A;  4BUR A;  5EOW A;  3NG7 X;  2YLS A;  4REK A;  2QAE A;  4CCQ A;  4TM1 A;  5KOX A;  2BK3 A;  2OLN A;  1PBF A;  3CGE A;  1FOH A;  3CIR A;  4BK2 A;  1GND A;  1JNI A;  5M0Z A;  4NTE A;  5GSN A;  2XLP A;  3URH A;  3DH9 A;  2BAB A;  4UP3 A;  2GRT A;  1HYU A;  2V5Z A;  1DNC A;  4OPD A;  3SQP A;  4AOX A;  4YTN A;  5KOW A;  1Q9I A;  2XVF A;  4IVM B;  1QDB A;  1PHH A;  1TYT A;  2R0G A;  1GV4 A;  3C96 A;  4OPL A;  1NG4 A;  3UTF A;  1Q1W A;  2BXS A;  4H4V A;  3E1T A;  1JRZ A;  3L1T A;  1RP0 A;  4J34 A;  3NH3 X;  3QFB A;  3AWI A;  5KVH A;  4YKG A;  3KA7 A;  4Q0T A;  3RP8 A;  4MJW A;  1CJC A;  2O9Z A;  1GER A;  1ZP0 A;  2YG4 A;  2JB2 A;  2XYO A;  1L9D A;  2C67 A;  2UZZ A;  4CBQ A;  2A87 A;  3IC9 A;  4YSZ A;  4U8N A;  5LV9 A;  4JN9 A;  2VRL A;  3KU9 A;  3UTG A;  3P9U A;  1CJ3 A;  1H84 A;  3BI5 A;  3DGH A;  4K22 A;  4U8I A;  4NTD A;  4TM0 A;  3NK0 X;  3AYL A;  1GRG A;  2BK5 A;  2X8H A;  1XDI A;  3GRS A;  1PBC A;  3K7T A;  2NPX A;  3IWA A;  3ALJ A;  1IUW A;  3I3L A;  1OJD A;  4ECH A;  1GRA A;  3UBR A;  4B69 A;  1VG0 A;  4PAA A;  2WEU A;  3CNT A;  4Z25 A;  4IVO B;  3AXB A;  2RGH A;  2XLR A;  4JQ9 A;  4Y4N A;  4JNA A;  4J56 A;  2WPF A;  4AP3 A;  4H2Q A;  2YAU A;  1KNP A;  2VZ2 A;  3RED A;  3ATR A;  4JY2 A;  2CVJ A;  3GD4 A;  4K7Z A;  3GMB A;  4B65 A;  1ZMC A;  4Q5C A;  3LJP A;  2XFO A;  3WE0 A;  1ONF A;  1NHQ A;  1KNR A;  4EQS A;  5EBK A;  3AB1 A;  1JRY A;  5JCM A;  1NHP A;  4AOS A;  2W0H A;  3BNM A;  4NEV A;  4U8K A;  1S3E A;  1TDO A;  3K7Q X;  3VRD B;  4XWR A;  4UDR A;  1VQW A;  2BCG G;  3LZX A;  1TRB A;  3ABV A;  3CPI G;  4OCG A;  2K3V A;  1FL2 A;  1GXF A;  3UKP A;  4B66 A;  2BYB A;  2C66 A;  3AD8 B;  2YLW A;  2WU5 A;  2YG3 A;  4GRT A;  3AD7 B;  1NPX A;  1TDF A;  4NZH A;  3O0H A;  3CTY A;  2XLS A;  3ALL A;  4C3Y A;  4EIQ A;  4IV9 A;  2VVL G;  3LXD A;  1XPQ A;  4H4X A;  3UKQ A;  3FMW A;  1DOC A;  2YM2 A;  5C3J A;  1ZOV A;  2VQB A;  2WET A;  3H4K A;  3D1I A;  1O5W A;  4RG3 A;  2YLR A;  3IF9 A;  1F8S A;  3BHF A;  2RAB A;  2VVL A;  1UKV G;  1XHC A;  1QO8 A;  1D7Y A;  4Q1O A;  3DJJ A;  3UP4 A;  2BK4 A;  2BC0 A;  2XVH A;  1LVL A;  5FS7 A;  2C72 A;  3H8I A;  3LGQ A;  2C70 A;  2GF3 A;  1ZDL A;  2GR3 A;  3BNU A;  3LAD A;  5U25 A;  3L8K A;  3QJ4 A;  4CCR A;  5HY5 A;  3K30 A;  3UU9 A;  1P2E A;  4X9M A;  3UTE A;  1E1M A;  2GR0 A;  1PDH A;  3KD9 A;  1N4V A;  2ARD A;  2YVF A;  2H89 A;  4C5O A;  2X3N A;  3NRN A;  1IUX A;  4FK1 C;  3HZL A;  5IQ1 A;  1JEH A;  2E5V A;  1BWC A;  2FBW A;  4UDQ A;  1E1L A;  3L1R A;  1D4E A;  2XFP A;  1IUT A;  3AE1 A;  2RGO A;  4Y4M A;  3NN6 X;  2YG7 A;  1D5T A;  2YG5 A;  1B8S A;  1FEC A;  3SFD A;  1E1K A;  3NK2 X;  4XXG A;  5FS6 A;  2WOV A;  5EB4 A;  4A79 A;  4AT0 A;  4GDE A;  2C7G A;  5JCL A;  2A89 A;  4GF7 A;  3VQR A;  1IUU A;  3EPT A;  4U8O A;  4YWO A;  3SXQ A;  1X31 B;  2FJA A;  1FS8 A;  2XFN A;  3NIX A;  4OPG A;  4TM4 A;  4B68 A;  4K2X A;  1YQ4 A;  2XVJ A;  1CC6 A;  2BS4 A;  3AD9 B;  3UOZ A;  1IJH A;  3KVE A;  4A9W A;  3V76 A;  2GEW A;  1GT8 A;  1H83 A;  3ICR A;  1YKJ A;  3BI2 A;  3C4N A;  4JY3 A;  5KWF A;  4EMI A;  2GQF A;  2JK6 A;  2ZZB A;  1CC4 A;  1GRE A;  1H7W A;  2IVE A;  3GYI A;  4YTP A;  3GYX A;  4H2P A;  2GQW A;  2Z5Y A;  1IUS A;  4J57 A;  3NK1 X;  1PS9 A;  4H2R A;  1PN0 A;  3RNM A;  2QA2 A;  1PJ6 A;  4EQX A;  1V59 A;  2ZBW A;  3QVR A;  2LFC A;  1Y0P A;  5J7X A;  1JNR A;  1GRB A;  3P4S A;  4H50 A;  4NEW A;  4CRT A;  1YQ3 A;  2YR4 A;  4YSY A;  2Q0K A;  2CUL A;  2XVE A;  1ZX9 A;  2YQU A;  2E80 A;  1REO A;  2E1M A;  2I0Z A;  5IQ4 A;  1E39 A;  3LG1 A;  1H86 A;  1KFY A;  3EAN A;  3DA1 A;  3D8X A;  4DGK A;  4H7U A;  1BGJ A;  1OJC A;  3ALM A;  4HB9 A;  4U2S A;  3ITJ A;  4Z2R A;  4DSH A;  4RG4 A;  4USR A;  2B9X A;  3AED A;  4C3X A;  4ZCD A;  1FT6 A;  5U63 A;  2R4J A;  1L0V A;  1FS9 A;  4A6N A;  2ZO5 A;  2GVC A;  2WDQ A;  4L3X A;  2YLT A;  3M13 A;  1ZY8 A;  1LJ1 A;  1EL8 A;  3V3N A;  4A65 A;  1B4V A;  2XCG A;  3NT6 A;  3FIM B;  2J3N A;  3NKS A;  1GEU A;  4TLX A;  3UCL A;  2C3C A;  1H82 A;  2X8G A;  1OJA A;  3GD3 A;  5ER0 A;  3VR8 A;  3VRB A;  3H8L A;  1RYI A;  1PBE A;  3AEF A;  4Q5B A;  1N4U A;  1NEN A;  2ACZ A;  1CC2 A;  1GPE A;  2FJD A;  2JAE A;  3G5R A;  4UDP A;  2AR8 A;  2XDO A;  3CPJ G;  4YKF A;  3EF6 A;  2V3B A;  1YQZ A;  1F8W A;  3UP5 A;  3R9U A;  3IHM A;  3B3R A;  1ZK7 A;  1TDK A;  1GSN A;  3P4P A;  4OPT A;  4H4U A;  2Y6Q A;  1YY5 A;  3RP6 A;  1KSU A;  2XVI A;  3UOY A;  5JCN A;  1BF3 A;  2XLU A;  1PJ7 A;  1S2Y A;  4BK3 A;  4YSX A;  2YWL A;  1XAN A;  2VQ7 A;  3NTA A;  2BCP A;  3PO7 A;  4CNK A;  3CNJ A;  1GRF A;  2C75 A;  3GWF A;  3CN8 A;  2R0C A;  3NNE A;  2C64 A;  1DJQ A;  4Z2U A;  4CNJ A;  4Z26 A;  3UKH A;  3EAO A;  2CDU A;  2RF7 A;  3BNF A;  3F8D A;  3UKK A;  2J7A A;  4C74 A;  3AEE A;  2RDZ A;  1JOA A;  1OAH A;  1K0L A;  2WQY A;  5J60 A;  5JCI A;  2F5Z A;  1NAA A;  1Y56 B;  2DKI A;  3ISH A;  1GES A;  1NEK A;  2VR0 A;  1QLB A;  3CND A;  1GET A;  2R9Z A;  3DK4 A;  5CQF A;  3AEG A;  4ADW A;  2IVD A;  1W4X A;  3ICS A;  5GRT A;  1D4C A;  2BA9 A;  1NHR A;  3BI4 A;  3ADA B;  3NYC A;  4U8M A;  4U8L A;  2CFY A;  3FO3 A;  1L9C A;  2Y6R A;  3D1C A;  1FS7 A;  5IPY A;  3G5S A;  1LTX R;  4H4P A;  3KLJ A;  3OWM A;  1Y56 A;  2YM1 A;  3GM6 A;  2FJB A;  1GTE A;  4GDP A;  5C2T A;  5KXJ A;  4Z43 A;  1M64 A;  5TR3 A;  4U2L A;  2BS3 A;  3ZDN A;  3NHO X;  3GDN A;  1F6M A; 
#chains in the Genus database with same CATH topology
 3BNH A;  2WHD A;  2E81 A;  2JKC A;  3DJD A;  1LV0 A;  3GSI A;  2EQ7 A;  1DOD A;  5CKU A;  1F8R A;  1AOG A;  3ICT A;  2B7S A;  1B5Q A;  2V60 A;  2ZZC A;  3NGC X;  2GH5 A;  3P4Q A;  4OPU A;  4ZN0 A;  2V6O A;  4J36 A;  2CZS A;  4X4J A;  4IA6 A;  4K8D A;  1H81 A;  1M6I A;  3HYW A;  2VRM A;  3C4A A;  3RKH A;  1OJT A;  2JB3 A;  3QSM A;  2A8X A;  2FJE A;  2PHH A;  4K5S A;  3T31 A;  4GUV A;  2GMJ A;  3AE2 A;  4BV6 A;  1N4W A;  3SGL A;  4WCT A;  2WS3 A;  3KKJ A;  4CY8 A;  4CY6 A;  3MMO A;  3NTD A;  2YLZ A;  3DK8 A;  3Q6J A;  4USQ A;  4EM4 A;  4HA6 A;  3UKF A;  1LQT A;  4Z2T A;  1SP3 A;  1KDG A;  3LOV A;  4DSG A;  5L46 A;  4BK1 A;  4D03 A;  1EBD A;  1K4Q A;  4GCM A;  4JDR A;  1PXA A;  2Q0L A;  3GMC A;  2E4G A;  1B37 A;  4I58 A;  4U8P A;  1VG9 A;  4EMJ A;  2OAL A;  4FX9 A;  1O95 A;  5JCK A;  4H4S A;  1K0J A;  4YTM A;  3VR9 A;  3DGZ A;  2EQ6 A;  1GOS A;  2BXR A;  3AYI A;  3FG2 P;  1CJ4 A;  1TYP A;  1PBB A;  3PVC A;  4U2T A;  2Q6U A;  4X9N A;  2WP5 A;  3AE4 A;  1FCD A;  3OC4 A;  4A99 A;  1DOB A;  5EB5 A;  1OJ9 A;  4Y4L A;  3AE6 A;  3S61 A;  3DJG X;  2VOU A;  2EQ9 A;  3CGC A;  3NYE A;  2GMH A;  1EL9 A;  4XWZ A;  5BVA A;  2WPC A;  1CHU A;  1E1N A;  3KPF A;  1M1P A;  3AE7 A;  3F8R A;  3QSE A;  4FK1 A;  3RP7 A;  1JNZ A;  1D7L A;  3AEC A;  4L38 A;  4IA5 A;  4B63 A;  1E6E A;  1MO9 A;  4H4R A;  1DJN A;  1CBO A;  4H4Y A;  4O5Q A;  4A6N B;  4EQR A;  5DBJ A;  1E7P A;  2R46 A;  5FS9 A;  1NG3 A;  1Z6L A;  4O5U A;  4C77 A;  4L3Y A;  2RGJ A;  4G9K A;  1FT5 A;  3CPH G;  3TOR A;  3GDP A;  3UKA A;  1LQU A;  1M1Q A;  5FMH A;  3OZ2 A;  3UKL A;  5BUL A;  3LZW A;  3AE8 A;  4KPR A;  2WDV A;  1ZOY A;  3VRA A;  5M10 A;  4WX1 A;  1F3P A;  4H4T A;  3T2K A;  1CF3 A;  2GAG B;  2Z5X A;  4H2N A;  3IHG A;  1FEB A;  1TDN A;  3V3O A;  4DNA A;  3SM8 A;  3P4R A;  2B9Y A;  4K5R A;  4N9X A;  1JRX A;  2C76 A;  3GWD A;  1RSG A;  1FEA A;  3M0O A;  4JNQ A;  4LA1 A;  4L3Z A;  2WBA A;  3F29 A;  3BNG A;  2TPR A;  4D04 A;  3CNS A;  1BGN A;  3QSS A;  4KX6 A;  3CNP A;  2WES A;  4GAP A;  4Q17 A;  2VVM A;  4J31 A;  3UOV A;  2V3A A;  2AAQ A;  2R4E A;  1H6V A;  4AT2 A;  1MXT A;  4ZCC A;  1L9E A;  1DXL A;  4B1B A;  4Z24 A;  4U8J A;  1CL0 A;  5BRT A;  5HXI A;  2OLO A;  5HYM A;  2AQJ A;  5KVI A;  4G6H A;  3AEA A;  2WP6 A;  1IUV A;  2XFU A;  4P9S A;  2JB1 A;  4H4Z A;  4YSH A;  1KF6 A;  3II4 A;  4H4Q A;  4OPI A;  2HQM A;  2WPE A;  2DKH A;  2OA1 A;  3GYJ A;  2BS2 A;  3M12 A;  2WU2 A;  5KRQ A;  2V61 A;  3I6D A;  3ZYX A;  2C73 A;  1DOE A;  1EL5 A;  1ZKQ A;  3AE5 A;  1EL7 A;  5FS8 A;  4Q4U A;  4EM3 A;  1GTH A;  4EQW A;  3RHA A;  2XLT A;  2BAC A;  3QVP A;  2C65 A;  1NDA A;  3NN0 X;  3G5Q A;  4ICY A;  1NHS A;  1ZMD A;  3T37 A;  2QA1 A;  3FBS A;  4BJY A;  3Q9T A;  4M52 A;  4A7A A;  2R0P A;  4EIP A;  3DJE A;  4YXD A;  2QCU A;  2B76 A;  5HHF A;  2YLX A;  2NVK X;  1GAL A;  1D4D A;  2GR2 A;  3NLC A;  2APG A;  3PS9 A;  3S5W A;  5KNL A;  2ZZ0 A;  3P1W A;  1P2H A;  4WJY A;  4GR1 A;  1TDE A;  3AE9 A;  3SY4 A;  2B7R A;  5KMS A;  4G6G A;  1COY A;  2X50 A;  2X99 A;  3BNJ A;  3BHK A;  3GRT A;  4LU6 A;  4J33 A;  3AEB A;  2OT4 A;  2BC1 A;  2GAH B;  2TMD A;  3TTB A;  2EQ8 A;  1M1R A;  1BVB A;  3DK9 A;  3JSK A;  1CJ2 A;  3CGD A;  4APN A;  2IID A;  4I59 A;  2YVG A;  3SFE A;  4BJZ A;  3SX6 A;  4TM3 A;  2GR1 A;  3LB8 A;  1H7X A;  2WDR A;  1QJD A;  1BZL A;  2Q7V A;  1K0I A;  4B67 A;  3CGB A;  3F8P A;  3UOX A;  1PJ5 A;  1Q1R A;  2BRA A;  5U1O A;  4J2W A;  1S2Q A;  2WP9 A;  4AP1 A;  4LII A;  2OAM A;  3ATQ A;  3B6D A;  3QFA A;  4PAB A;  3SZW A;  3FPZ A;  4TLZ A;  3COX A;  1N1P A;  1SEZ A;  1JU2 A;  2YR5 A;  3S7W A;  1S3B A;  3DME A;  2X8C A;  2PYX A;  1GRH A;  2YG6 A;  4E0V A;  2C3D A;  1KSS A;  1VDC A;  4RSL A;  1PBD A;  1LPF A;  4OPC A;  3NYF A;  3AYJ A;  2GB0 A;  2XFQ A;  1MOK A;  4FDC B;  1VRQ B;  1GRT A;  1GU6 A;  2JBV A;  4NTC A;  4Z44 A;  1BKW A;  2GV8 A;  5BUK A;  2WOW A;  3SCE A;  1O94 A;  2YVJ A;  2B9W A;  3UTH A;  4EMW A;  4OVI A;  2H88 A;  1PXB A;  2R45 A;  1ELI A;  4B64 A;  2YR6 A;  4H4W A;  3K7M X;  4YT0 A;  2WOI A;  3AE3 A;  1PXC A;  4A5L A;  4BUR A;  5EOW A;  3NG7 X;  2YLS A;  4REK A;  2QAE A;  4CCQ A;  4TM1 A;  5KOX A;  2BK3 A;  3SXI A;  2OLN A;  1PBF A;  3CGE A;  1FOH A;  3CIR A;  4BK2 A;  1GND A;  1JNI A;  5M0Z A;  4NTE A;  5GSN A;  2XLP A;  3URH A;  3DH9 A;  2BAB A;  4UP3 A;  2GRT A;  1HYU A;  2V5Z A;  1DNC A;  4OPD A;  3SQP A;  4AOX A;  4YTN A;  5KOW A;  1Q9I A;  2XVF A;  4IVM B;  1QDB A;  1PHH A;  1TYT A;  2R0G A;  1GV4 A;  3C96 A;  4OPL A;  1NG4 A;  3UTF A;  1Q1W A;  2BXS A;  4H4V A;  3E1T A;  1JRZ A;  3L1T A;  1RP0 A;  4J34 A;  3NH3 X;  3QFB A;  3AWI A;  5KVH A;  4YKG A;  3KA7 A;  4Q0T A;  3RP8 A;  4MJW A;  4GAV A;  1CJC A;  2O9Z A;  1GER A;  1ZP0 A;  2YG4 A;  2JB2 A;  2XYO A;  1L9D A;  2C67 A;  2UZZ A;  3T0K A;  4CBQ A;  2A87 A;  3IC9 A;  4YSZ A;  4U8N A;  5LV9 A;  4JN9 A;  2VRL A;  3KU9 A;  3UTG A;  5KMQ A;  3P9U A;  1CJ3 A;  1H84 A;  3BI5 A;  3DGH A;  4K22 A;  4U8I A;  4NTD A;  4TM0 A;  3NK0 X;  3AYL A;  1GRG A;  2BK5 A;  2X8H A;  1XDI A;  3GRS A;  1PBC A;  3K7T A;  2NPX A;  3IWA A;  3ALJ A;  1IUW A;  3I3L A;  1OJD A;  4ECH A;  1GRA A;  3UBR A;  4B69 A;  1VG0 A;  3CMM A;  4PAA A;  2WEU A;  3CNT A;  4Z25 A;  4IVO B;  3AXB A;  2RGH A;  2XLR A;  4JQ9 A;  4Y4N A;  4JNA A;  4J56 A;  2WPF A;  4AP3 A;  4H2Q A;  2YAU A;  1KNP A;  2VZ2 A;  3RED A;  3ATR A;  4JY2 A;  2CVJ A;  3GD4 A;  4K7Z A;  3GMB A;  4B65 A;  1ZMC A;  4Q5C A;  3LJP A;  2XFO A;  3WE0 A;  1ONF A;  1NHQ A;  1KNR A;  4NWZ A;  4EQS A;  5EBK A;  3AB1 A;  1JRY A;  5JCM A;  1NHP A;  4AOS A;  2W0H A;  3BNM A;  4NEV A;  4U8K A;  1S3E A;  1TDO A;  3K7Q X;  3VRD B;  4XWR A;  2C4C A;  4UDR A;  1VQW A;  2BCG G;  3LZX A;  1TRB A;  3ABV A;  3CPI G;  4OCG A;  2K3V A;  1FL2 A;  1GXF A;  3UKP A;  4B66 A;  2BYB A;  2C66 A;  3AD8 B;  2YLW A;  2WU5 A;  2YG3 A;  4GRT A;  3AD7 B;  1NPX A;  1TDF A;  4NZH A;  3O0H A;  3T2Y A;  3CTY A;  2XLS A;  4II3 A;  3ALL A;  4C3Y A;  4EIQ A;  4IV9 A;  2VVL G;  3LXD A;  1XPQ A;  4H4X A;  3UKQ A;  3FMW A;  1DOC A;  2YM2 A;  5C3J A;  1ZOV A;  2VQB A;  2WET A;  4II2 A;  3H4K A;  3D1I A;  1O5W A;  4RG3 A;  2YLR A;  3IF9 A;  1F8S A;  3BHF A;  2RAB A;  2VVL A;  1UKV G;  1XHC A;  1QO8 A;  1D7Y A;  4Q1O A;  3DJJ A;  3UP4 A;  2BK4 A;  2BC0 A;  2XVH A;  1LVL A;  5FS7 A;  2C72 A;  3H8I A;  3LGQ A;  2C70 A;  2GF3 A;  1ZDL A;  2GR3 A;  3BNU A;  3LAD A;  5U25 A;  3L8K A;  3QJ4 A;  4CCR A;  5HY5 A;  3K30 A;  3UU9 A;  1P2E A;  4X9M A;  3UTE A;  1E1M A;  2GR0 A;  1PDH A;  3KD9 A;  1N4V A;  2ARD A;  2YVF A;  2H89 A;  3T14 A;  4C5O A;  2X3N A;  3NRN A;  1IUX A;  4FK1 C;  3HZL A;  5IQ1 A;  1JEH A;  2E5V A;  1BWC A;  2FBW A;  4UDQ A;  1E1L A;  3L1R A;  1D4E A;  2XFP A;  4NNJ A;  1IUT A;  3AE1 A;  2RGO A;  4Y4M A;  3NN6 X;  2YG7 A;  1D5T A;  2YG5 A;  1B8S A;  1FEC A;  3SFD A;  1E1K A;  3NK2 X;  4XXG A;  5FS6 A;  2WOV A;  5EB4 A;  4A79 A;  4AT0 A;  4GDE A;  2C7G A;  5JCL A;  2A89 A;  4GF7 A;  3VQR A;  1IUU A;  3EPT A;  4U8O A;  4YWO A;  3SXQ A;  1X31 B;  2FJA A;  1FS8 A;  2XFN A;  3NIX A;  4OPG A;  4TM4 A;  4B68 A;  4K2X A;  1YQ4 A;  2XVJ A;  1CC6 A;  2BS4 A;  3AD9 B;  3UOZ A;  1IJH A;  3KVE A;  4A9W A;  3V76 A;  2GEW A;  1GT8 A;  1H83 A;  3ICR A;  1YKJ A;  3BI2 A;  3C4N A;  3SZF A;  4JY3 A;  5KWF A;  4EMI A;  2GQF A;  2JK6 A;  2ZZB A;  1CC4 A;  1GRE A;  1H7W A;  2IVE A;  3GYI A;  3GYX A;  4G73 A;  4YTP A;  4H2P A;  2GQW A;  3SZ0 A;  2Z5Y A;  1IUS A;  4J57 A;  3NK1 X;  1PS9 A;  4H2R A;  1PN0 A;  3RNM A;  2QA2 A;  1PJ6 A;  4EQX A;  1V59 A;  2ZBW A;  3QVR A;  2LFC A;  1Y0P A;  5J7X A;  1JNR A;  1GRB A;  3P4S A;  4H50 A;  4NEW A;  4CRT A;  1YQ3 A;  2YR4 A;  4YSY A;  2Q0K A;  3HYX A;  2CUL A;  2XVE A;  1ZX9 A;  2YQU A;  2E80 A;  1REO A;  2E1M A;  2I0Z A;  2BRY A;  5IQ4 A;  1E39 A;  3LG1 A;  1H86 A;  1KFY A;  3EAN A;  3DA1 A;  3D8X A;  3SYI A;  4DGK A;  4H7U A;  1BGJ A;  1OJC A;  3ALM A;  4HB9 A;  4U2S A;  3ITJ A;  4Z2R A;  4DSH A;  4RG4 A;  4USR A;  2B9X A;  3AED A;  4C3X A;  4ZCD A;  1FT6 A;  5U63 A;  2R4J A;  1L0V A;  1FS9 A;  3SZC A;  4A6N A;  2ZO5 A;  2GVC A;  2WDQ A;  4L3X A;  2YLT A;  3M13 A;  1ZY8 A;  1LJ1 A;  1EL8 A;  3V3N A;  4A65 A;  1B4V A;  2XCG A;  3NT6 A;  3FIM B;  2J3N A;  3NKS A;  1GEU A;  4TLX A;  3UCL A;  2C3C A;  1H82 A;  2X8G A;  1OJA A;  3GD3 A;  5ER0 A;  3VR8 A;  3VRB A;  3H8L A;  1RYI A;  1PBE A;  3AEF A;  4Q5B A;  1N4U A;  1NEN A;  2ACZ A;  1CC2 A;  1GPE A;  2FJD A;  2JAE A;  3G5R A;  4UDP A;  2AR8 A;  2XDO A;  3CPJ G;  4YKF A;  3EF6 A;  2V3B A;  1YQZ A;  1F8W A;  3UP5 A;  3R9U A;  3IHM A;  3B3R A;  1ZK7 A;  1TDK A;  1GSN A;  3P4P A;  4OPT A;  4H4U A;  2Y6Q A;  1YY5 A;  3KPK A;  3RP6 A;  1KSU A;  2XVI A;  3UOY A;  5JCN A;  1BF3 A;  2XLU A;  1PJ7 A;  1S2Y A;  4BK3 A;  4YSX A;  2YWL A;  1XAN A;  2VQ7 A;  3NTA A;  2BCP A;  3PO7 A;  4CNK A;  3CNJ A;  1GRF A;  2C75 A;  3GWF A;  3CN8 A;  2R0C A;  3NNE A;  2C64 A;  1DJQ A;  4Z2U A;  4CNJ A;  4Z26 A;  3UKH A;  3EAO A;  2CDU A;  2RF7 A;  3BNF A;  3F8D A;  3UKK A;  2J7A A;  4C74 A;  3AEE A;  2RDZ A;  1JOA A;  1OAH A;  1K0L A;  2WQY A;  5J60 A;  5JCI A;  2F5Z A;  1NAA A;  1Y56 B;  2DKI A;  3ISH A;  1GES A;  1NEK A;  2VR0 A;  1QLB A;  3T2Z A;  3CND A;  1GET A;  2R9Z A;  3DK4 A;  3HYV A;  5CQF A;  3AEG A;  4ADW A;  2IVD A;  1W4X A;  3ICS A;  5GRT A;  5KMP A;  1D4C A;  2BA9 A;  1NHR A;  3BI4 A;  3ADA B;  3NYC A;  4U8M A;  4U8L A;  2CFY A;  3FO3 A;  1L9C A;  4G74 A;  2Y6R A;  3D1C A;  1FS7 A;  5IPY A;  3G5S A;  1LTX R;  4H4P A;  3KLJ A;  3OWM A;  1Y56 A;  2YM1 A;  3GM6 A;  2FJB A;  1GTE A;  4GDP A;  5C2T A;  5KXJ A;  5KMR A;  4Z43 A;  1M64 A;  5TR3 A;  4U2L A;  2BS3 A;  3ZDN A;  3NHO X;  3GDN A;  1F6M A; 
#chains in the Genus database with same CATH homology
 3BNH A;  2WHD A;  2E81 A;  2JKC A;  3DJD A;  1LV0 A;  3GSI A;  2EQ7 A;  1DOD A;  5CKU A;  1F8R A;  1AOG A;  3ICT A;  2B7S A;  1B5Q A;  2V60 A;  2ZZC A;  3NGC X;  2GH5 A;  3P4Q A;  4OPU A;  4ZN0 A;  2V6O A;  4J36 A;  4X4J A;  4IA6 A;  4K8D A;  1H81 A;  1M6I A;  3HYW A;  2VRM A;  3C4A A;  3RKH A;  1OJT A;  2JB3 A;  3QSM A;  2A8X A;  2FJE A;  2PHH A;  4K5S A;  3T31 A;  4GUV A;  2GMJ A;  3AE2 A;  4BV6 A;  1N4W A;  3SGL A;  4WCT A;  2WS3 A;  3KKJ A;  4CY8 A;  4CY6 A;  3MMO A;  3NTD A;  2YLZ A;  3DK8 A;  3Q6J A;  4USQ A;  4EM4 A;  4HA6 A;  3UKF A;  1LQT A;  4Z2T A;  1SP3 A;  1KDG A;  3LOV A;  4DSG A;  5L46 A;  4BK1 A;  4D03 A;  1EBD A;  1K4Q A;  4GCM A;  4JDR A;  1PXA A;  2Q0L A;  3GMC A;  2E4G A;  1B37 A;  4I58 A;  4U8P A;  1VG9 A;  4EMJ A;  2OAL A;  4FX9 A;  1O95 A;  5JCK A;  4H4S A;  1K0J A;  4YTM A;  3VR9 A;  3DGZ A;  2EQ6 A;  1GOS A;  2BXR A;  3AYI A;  3FG2 P;  1CJ4 A;  1TYP A;  1PBB A;  3PVC A;  4U2T A;  2Q6U A;  4X9N A;  2WP5 A;  3AE4 A;  1FCD A;  3OC4 A;  4A99 A;  1DOB A;  5EB5 A;  1OJ9 A;  4Y4L A;  3AE6 A;  3S61 A;  3DJG X;  2VOU A;  2EQ9 A;  3CGC A;  3NYE A;  2GMH A;  1EL9 A;  4XWZ A;  5BVA A;  2WPC A;  1CHU A;  1E1N A;  3KPF A;  1M1P A;  3AE7 A;  3F8R A;  3QSE A;  4FK1 A;  3RP7 A;  1JNZ A;  1D7L A;  3AEC A;  4L38 A;  4IA5 A;  4B63 A;  1E6E A;  1MO9 A;  4H4R A;  1DJN A;  1CBO A;  4H4Y A;  4O5Q A;  4A6N B;  4EQR A;  5DBJ A;  1E7P A;  2R46 A;  5FS9 A;  1NG3 A;  1Z6L A;  4O5U A;  4C77 A;  4L3Y A;  2RGJ A;  4G9K A;  1FT5 A;  3CPH G;  3TOR A;  3GDP A;  3UKA A;  1LQU A;  1M1Q A;  5FMH A;  3OZ2 A;  3UKL A;  5BUL A;  3LZW A;  3AE8 A;  4KPR A;  2WDV A;  1ZOY A;  3VRA A;  5M10 A;  4WX1 A;  1F3P A;  4H4T A;  3T2K A;  1CF3 A;  2GAG B;  2Z5X A;  4H2N A;  3IHG A;  1FEB A;  1TDN A;  3V3O A;  4DNA A;  3SM8 A;  3P4R A;  2B9Y A;  4K5R A;  4N9X A;  1JRX A;  2C76 A;  3GWD A;  1RSG A;  1FEA A;  3M0O A;  4JNQ A;  4LA1 A;  4L3Z A;  2WBA A;  3F29 A;  3BNG A;  2TPR A;  4D04 A;  3CNS A;  1BGN A;  3QSS A;  4KX6 A;  3CNP A;  2WES A;  4GAP A;  4Q17 A;  2VVM A;  4J31 A;  3UOV A;  2V3A A;  2AAQ A;  2R4E A;  1H6V A;  4AT2 A;  1MXT A;  4ZCC A;  1L9E A;  1DXL A;  4B1B A;  4Z24 A;  4U8J A;  1CL0 A;  5BRT A;  5HXI A;  2OLO A;  5HYM A;  2AQJ A;  5KVI A;  4G6H A;  3AEA A;  2WP6 A;  1IUV A;  2XFU A;  4P9S A;  2JB1 A;  4H4Z A;  4YSH A;  1KF6 A;  3II4 A;  4H4Q A;  4OPI A;  2HQM A;  2WPE A;  2DKH A;  2OA1 A;  3GYJ A;  2BS2 A;  3M12 A;  2WU2 A;  5KRQ A;  2V61 A;  3I6D A;  3ZYX A;  2C73 A;  1DOE A;  1EL5 A;  1ZKQ A;  3AE5 A;  1EL7 A;  5FS8 A;  4Q4U A;  4EM3 A;  1GTH A;  4EQW A;  3RHA A;  2XLT A;  2BAC A;  3QVP A;  2C65 A;  1NDA A;  3NN0 X;  3G5Q A;  4ICY A;  1NHS A;  1ZMD A;  3T37 A;  2QA1 A;  3FBS A;  4BJY A;  3Q9T A;  4M52 A;  4A7A A;  2R0P A;  4EIP A;  3DJE A;  4YXD A;  2QCU A;  2B76 A;  5HHF A;  2YLX A;  2NVK X;  1GAL A;  1D4D A;  2GR2 A;  3NLC A;  2APG A;  3PS9 A;  3S5W A;  5KNL A;  2ZZ0 A;  3P1W A;  1P2H A;  4WJY A;  4GR1 A;  1TDE A;  3AE9 A;  3SY4 A;  2B7R A;  5KMS A;  4G6G A;  1COY A;  2X50 A;  2X99 A;  3BNJ A;  3BHK A;  3GRT A;  4LU6 A;  4J33 A;  3AEB A;  2OT4 A;  2BC1 A;  2GAH B;  2TMD A;  3TTB A;  2EQ8 A;  1M1R A;  1BVB A;  3DK9 A;  3JSK A;  1CJ2 A;  3CGD A;  4APN A;  2IID A;  4I59 A;  2YVG A;  3SFE A;  4BJZ A;  3SX6 A;  4TM3 A;  2GR1 A;  3LB8 A;  1H7X A;  2WDR A;  1QJD A;  1BZL A;  2Q7V A;  1K0I A;  4B67 A;  3CGB A;  3F8P A;  3UOX A;  1PJ5 A;  1Q1R A;  2BRA A;  5U1O A;  4J2W A;  1S2Q A;  2WP9 A;  4AP1 A;  4LII A;  2OAM A;  3ATQ A;  3B6D A;  3QFA A;  4PAB A;  3SZW A;  3FPZ A;  4TLZ A;  3COX A;  1N1P A;  1SEZ A;  1JU2 A;  2YR5 A;  3S7W A;  1S3B A;  3DME A;  2X8C A;  2PYX A;  1GRH A;  2YG6 A;  4E0V A;  2C3D A;  1KSS A;  1VDC A;  4RSL A;  1PBD A;  1LPF A;  4OPC A;  3NYF A;  3AYJ A;  2GB0 A;  2XFQ A;  1MOK A;  4FDC B;  1VRQ B;  1GRT A;  1GU6 A;  2JBV A;  4NTC A;  4Z44 A;  1BKW A;  2GV8 A;  5BUK A;  2WOW A;  3SCE A;  1O94 A;  2YVJ A;  2B9W A;  3UTH A;  4EMW A;  4OVI A;  2H88 A;  1PXB A;  2R45 A;  1ELI A;  4B64 A;  2YR6 A;  4H4W A;  3K7M X;  4YT0 A;  2WOI A;  3AE3 A;  1PXC A;  4A5L A;  4BUR A;  5EOW A;  3NG7 X;  2YLS A;  4REK A;  2QAE A;  4CCQ A;  4TM1 A;  5KOX A;  2BK3 A;  3SXI A;  2OLN A;  1PBF A;  3CGE A;  1FOH A;  3CIR A;  4BK2 A;  1GND A;  1JNI A;  5M0Z A;  4NTE A;  5GSN A;  2XLP A;  3URH A;  3DH9 A;  2BAB A;  4UP3 A;  2GRT A;  1HYU A;  2V5Z A;  1DNC A;  4OPD A;  3SQP A;  4AOX A;  4YTN A;  5KOW A;  1Q9I A;  2XVF A;  4IVM B;  1QDB A;  1PHH A;  1TYT A;  2R0G A;  1GV4 A;  3C96 A;  4OPL A;  1NG4 A;  3UTF A;  1Q1W A;  2BXS A;  4H4V A;  3E1T A;  1JRZ A;  3L1T A;  1RP0 A;  4J34 A;  3NH3 X;  3QFB A;  3AWI A;  5KVH A;  4YKG A;  3KA7 A;  4Q0T A;  3RP8 A;  4MJW A;  4GAV A;  1CJC A;  2O9Z A;  1GER A;  1ZP0 A;  2YG4 A;  2JB2 A;  2XYO A;  1L9D A;  2C67 A;  2UZZ A;  3T0K A;  4CBQ A;  2A87 A;  3IC9 A;  4YSZ A;  4U8N A;  5LV9 A;  4JN9 A;  2VRL A;  3KU9 A;  3UTG A;  5KMQ A;  3P9U A;  1CJ3 A;  1H84 A;  3BI5 A;  3DGH A;  4K22 A;  4U8I A;  4NTD A;  4TM0 A;  3NK0 X;  3AYL A;  1GRG A;  2BK5 A;  2X8H A;  1XDI A;  3GRS A;  1PBC A;  3K7T A;  2NPX A;  3IWA A;  3ALJ A;  1IUW A;  3I3L A;  1OJD A;  4ECH A;  1GRA A;  3UBR A;  4B69 A;  1VG0 A;  3CMM A;  4PAA A;  2WEU A;  3CNT A;  4Z25 A;  4IVO B;  3AXB A;  2RGH A;  2XLR A;  4JQ9 A;  4Y4N A;  4JNA A;  4J56 A;  2WPF A;  4AP3 A;  4H2Q A;  2YAU A;  1KNP A;  2VZ2 A;  3RED A;  3ATR A;  4JY2 A;  2CVJ A;  3GD4 A;  4K7Z A;  3GMB A;  4B65 A;  1ZMC A;  4Q5C A;  3LJP A;  2XFO A;  3WE0 A;  1ONF A;  1NHQ A;  1KNR A;  4NWZ A;  4EQS A;  5EBK A;  3AB1 A;  1JRY A;  5JCM A;  1NHP A;  4AOS A;  2W0H A;  3BNM A;  4NEV A;  4U8K A;  1S3E A;  1TDO A;  3K7Q X;  3VRD B;  4XWR A;  2C4C A;  4UDR A;  1VQW A;  2BCG G;  3LZX A;  1TRB A;  3ABV A;  3CPI G;  4OCG A;  2K3V A;  1FL2 A;  1GXF A;  3UKP A;  4B66 A;  2BYB A;  2C66 A;  3AD8 B;  2YLW A;  2WU5 A;  2YG3 A;  4GRT A;  3AD7 B;  1NPX A;  1TDF A;  4NZH A;  3O0H A;  3T2Y A;  3CTY A;  2XLS A;  4II3 A;  3ALL A;  4C3Y A;  4EIQ A;  4IV9 A;  2VVL G;  3LXD A;  1XPQ A;  4H4X A;  3UKQ A;  3FMW A;  1DOC A;  2YM2 A;  5C3J A;  1ZOV A;  2VQB A;  2WET A;  4II2 A;  3H4K A;  3D1I A;  1O5W A;  4RG3 A;  2YLR A;  3IF9 A;  1F8S A;  3BHF A;  2RAB A;  2VVL A;  1UKV G;  1XHC A;  1QO8 A;  1D7Y A;  4Q1O A;  3DJJ A;  3UP4 A;  2BK4 A;  2BC0 A;  2XVH A;  1LVL A;  5FS7 A;  2C72 A;  3H8I A;  3LGQ A;  2C70 A;  2GF3 A;  1ZDL A;  2GR3 A;  3BNU A;  3LAD A;  5U25 A;  3L8K A;  3QJ4 A;  4CCR A;  5HY5 A;  3K30 A;  3UU9 A;  1P2E A;  4X9M A;  3UTE A;  1E1M A;  2GR0 A;  1PDH A;  3KD9 A;  1N4V A;  2ARD A;  2YVF A;  2H89 A;  3T14 A;  4C5O A;  2X3N A;  3NRN A;  1IUX A;  4FK1 C;  3HZL A;  5IQ1 A;  1JEH A;  2E5V A;  1BWC A;  2FBW A;  4UDQ A;  1E1L A;  3L1R A;  1D4E A;  2XFP A;  4NNJ A;  1IUT A;  3AE1 A;  2RGO A;  4Y4M A;  3NN6 X;  2YG7 A;  1D5T A;  2YG5 A;  1B8S A;  1FEC A;  3SFD A;  1E1K A;  3NK2 X;  4XXG A;  5FS6 A;  2WOV A;  5EB4 A;  4A79 A;  4AT0 A;  4GDE A;  2C7G A;  5JCL A;  2A89 A;  4GF7 A;  3VQR A;  1IUU A;  3EPT A;  4U8O A;  4YWO A;  3SXQ A;  1X31 B;  2FJA A;  1FS8 A;  2XFN A;  3NIX A;  4OPG A;  4TM4 A;  4B68 A;  4K2X A;  1YQ4 A;  2XVJ A;  1CC6 A;  2BS4 A;  3AD9 B;  3UOZ A;  1IJH A;  3KVE A;  4A9W A;  3V76 A;  2GEW A;  1GT8 A;  1H83 A;  3ICR A;  1YKJ A;  3BI2 A;  3C4N A;  3SZF A;  4JY3 A;  5KWF A;  4EMI A;  2GQF A;  2JK6 A;  2ZZB A;  1CC4 A;  1GRE A;  1H7W A;  2IVE A;  3GYI A;  3GYX A;  4G73 A;  4YTP A;  4H2P A;  2GQW A;  3SZ0 A;  2Z5Y A;  1IUS A;  4J57 A;  3NK1 X;  1PS9 A;  4H2R A;  1PN0 A;  3RNM A;  2QA2 A;  1PJ6 A;  4EQX A;  1V59 A;  2ZBW A;  3QVR A;  2LFC A;  1Y0P A;  5J7X A;  1JNR A;  1GRB A;  3P4S A;  4H50 A;  4NEW A;  4CRT A;  1YQ3 A;  2YR4 A;  4YSY A;  2Q0K A;  3HYX A;  2CUL A;  2XVE A;  1ZX9 A;  2YQU A;  2E80 A;  1REO A;  2E1M A;  2I0Z A;  2BRY A;  5IQ4 A;  1E39 A;  3LG1 A;  1H86 A;  1KFY A;  3EAN A;  3DA1 A;  3D8X A;  3SYI A;  4DGK A;  4H7U A;  1BGJ A;  1OJC A;  3ALM A;  4HB9 A;  4U2S A;  3ITJ A;  4Z2R A;  4DSH A;  4RG4 A;  4USR A;  2B9X A;  3AED A;  4C3X A;  4ZCD A;  1FT6 A;  5U63 A;  2R4J A;  1L0V A;  1FS9 A;  3SZC A;  4A6N A;  2ZO5 A;  2GVC A;  2WDQ A;  4L3X A;  2YLT A;  3M13 A;  1ZY8 A;  1LJ1 A;  1EL8 A;  3V3N A;  4A65 A;  1B4V A;  2XCG A;  3NT6 A;  3FIM B;  2J3N A;  3NKS A;  1GEU A;  4TLX A;  3UCL A;  2C3C A;  1H82 A;  2X8G A;  1OJA A;  3GD3 A;  5ER0 A;  3VR8 A;  3VRB A;  3H8L A;  1RYI A;  1PBE A;  3AEF A;  4Q5B A;  1N4U A;  1NEN A;  2ACZ A;  1CC2 A;  1GPE A;  2FJD A;  2JAE A;  3G5R A;  4UDP A;  2AR8 A;  2XDO A;  3CPJ G;  4YKF A;  3EF6 A;  2V3B A;  1YQZ A;  1F8W A;  3UP5 A;  3R9U A;  3IHM A;  3B3R A;  1ZK7 A;  1TDK A;  1GSN A;  3P4P A;  4OPT A;  4H4U A;  2Y6Q A;  1YY5 A;  3KPK A;  3RP6 A;  1KSU A;  2XVI A;  3UOY A;  5JCN A;  1BF3 A;  2XLU A;  1PJ7 A;  1S2Y A;  4BK3 A;  4YSX A;  2YWL A;  1XAN A;  2VQ7 A;  3NTA A;  2BCP A;  3PO7 A;  4CNK A;  3CNJ A;  1GRF A;  2C75 A;  3GWF A;  3CN8 A;  2R0C A;  3NNE A;  2C64 A;  1DJQ A;  4Z2U A;  4CNJ A;  4Z26 A;  3UKH A;  3EAO A;  2CDU A;  2RF7 A;  3BNF A;  3F8D A;  3UKK A;  2J7A A;  4C74 A;  3AEE A;  2RDZ A;  1JOA A;  1OAH A;  1K0L A;  2WQY A;  5J60 A;  5JCI A;  2F5Z A;  1NAA A;  1Y56 B;  2DKI A;  3ISH A;  1GES A;  1NEK A;  2VR0 A;  1QLB A;  3T2Z A;  3CND A;  1GET A;  2R9Z A;  3DK4 A;  3HYV A;  5CQF A;  3AEG A;  4ADW A;  2IVD A;  1W4X A;  3ICS A;  5GRT A;  5KMP A;  1D4C A;  2BA9 A;  1NHR A;  3BI4 A;  3ADA B;  3NYC A;  4U8M A;  4U8L A;  2CFY A;  3FO3 A;  1L9C A;  4G74 A;  2Y6R A;  3D1C A;  1FS7 A;  5IPY A;  3G5S A;  1LTX R;  4H4P A;  3KLJ A;  3OWM A;  1Y56 A;  2YM1 A;  3GM6 A;  2FJB A;  1GTE A;  4GDP A;  5C2T A;  5KXJ A;  5KMR A;  4Z43 A;  1M64 A;  5TR3 A;  4U2L A;  2BS3 A;  3ZDN A;  3NHO X;  3GDN A;  1F6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...