1P2HA

H61m mutant of flavocytochrome c3
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASMFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histidine 61: An Important Heme Ligand in the Soluble Fumarate Reductase from Shewanella frigidimarina
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords flavocytochrome c3
total genus 198
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1p2hA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1p2hA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1p2hA01
1GRBA 3UKHA 2BCGG 2BK4A 4DSGA 2VRLA 3BI5A 2R0CA 4OVIA 5KRQA 1PJ5A 3AEBA 1PN0A 2WPEA 2Y6RA 1EL9A 3ALLA 3KLJA 4U8IA 3M13A 3RHAA 3FO3A 2C7GA 1FCDA 3M0OA 5FS6A 3IHMA 3G5RA 1JOAA 4Z24A 2VQ7A 5IQ4A 4P9SA 4AT0A 2XCGA 3QVPA 4K5SA 1ZMDA 3K7MX 2XVIA 1Y56B 4U8LA 3FIMB 3QSEA 3DMEA 3NYFA 4YSHA 1IJHA 4UDQA 4H4YA 2BA9A 3EAOA 3I3LA 1XANA 3RNMA 1CC2A 2A8XA 3UOVA 1BVBA 3F8RA 3FPZA 2XFQA 3O0HA 4E0VA 4HA6A 3QSMA 1NHSA 4WCTA 3NTAA 4AOSA 1VDCA 5KXJA 1H82A 2CVJA 2Z5YA 2BK3A 3ICTA 1COYA 4X4JA 3MMOA 1K0LA 3NH3X 3AECA 3JSKA 4X9MA 1CJCA 4YSZA 2X99A 1CF3A 2FJDA 1FT6A 2C3CA 3H8IA 4EQSA 3ICSA 1DOCA 1F8SA 1CJ2A 2B9XA 4WJYA 4A6NB 1YY5A 3AE4A 4H4RA 4Y4LA 2Q0LA 3NHOX 3RKHA 1S3EA 2XFUA 3H4KA 3QSSA 2C73A 3GRTA 4BJYA 3V76A 3CTYA 2WOVA 3NGCX 2IVDA 3AE9A 3VR9A 4K22A 1Q9IA 1DOBA 3SM8A 3DJEA 3AYIA 4A79A 3CPJG 4A65A 1DOEA 4YKFA 3QVRA 4XXGA 4AOXA 5BVAA 1GRAA 3IWAA 5U63A 2R0GA 2YLRA 5GSNA 5KWFA 2WHDA 1JEHA 1L0VA 1M6IA 3V3NA 3RP8A 3CIRA 2WU2A 2XVFA 4B66A 3KU9A 3LZXA 4GRTA 1ELIA 3CN8A 1N1PA 2JB2A 3NRNA 5HHFA 2YG5A 2IIDA 3BNFA 1BGNA 1FECA 2RABA 3DH9A 3LADA 3NK0X 2C64A 2XLSA 2Z5XA 3LOVA 3KD9A 3ATQA 5U1OA 2R4EA 1M1QA 3GWFA 2E80A 4NZHA 3P4RA 3AE8A 3EANA 2YLZA 2RGJA 1D4CA 4U8PA 3UP5A 5KOXA 4Q0TA 1D4DA 4IA6A 3UKFA 2VRMA 4JQ9A 3LB8A 3NK1X 1ZOYA 1KSSA 4OPTA 4BK2A 5EB5A 1ONFA 4ZCDA 3P1WA 4AT2A 5JCNA 1LPFA 2FJEA 4J34A 4JN9A 4GF7A 4ECHA 2UZZA 1PDHA 2OLOA 1KSUA 3PO7A 4H2QA 2XVHA 4A9WA 2C66A 2PHHA 3AE5A 4U2LA 4CNKA 4Q4UA 4LU6A 4YWOA 3T37A 2YWLA 3UOYA 3NK2X 2GH5A 2BC0A 3QJ4A 4EMJA 3BNGA 1DNCA 1PBDA 2C3DA 4KX6A 3GDNA 4NTEA 4D03A 4FX9A 1CJ4A 1ZX9A 4RSLA 1GRGA 4M52A 4GUVA 4YXDA 3ABVA 3P9UA 3DJGX 1FS9A 4A7AA 2OAMA 1QJDA 3OZ2A 4PABA 1OJDA 4J36A 4CY6A 1GNDA 1O95A 4CRTA 4K2XA 2WP6A 1ZK7A 4GR1A 5EOWA 3RP6A 3LG1A 2B9WA 1REOA 2C72A 3AE1A 1E7PA 2WP5A 3CGDA 3FBSA 2WDRA 3F8PA 3GMCA 3GDPA 4DSHA 4U8MA 1SP3A 2XLRA 2QA2A 3SFEA 3UTFA 4EMIA 2R0PA 1LV0A 4APNA 5JCKA 2BS3A 4UDRA 1GALA 4I58A 2GF3A 2R46A 1N4UA 2X8CA 1GERA 1PXBA 4O5QA 2WQYA 2NPXA 1XDIA 3GD3A 4EMWA 1H6VA 2ZO5A 3CPHG 3ZDNA 1GRFA 2R4JA 4EM3A 5JCMA 3FMWA 3S7WA 1GTEA 3KKJA 3SFDA 2Q0KA 3UTHA 1IUWA 4OPDA 5IPYA 2BK5A 3IF9A 4H4VA 4J2WA 3AEEA 3BNHA 4ADWA 2EQ7A 1GT8A 1KNPA 1H84A 1KNRA 1PJ6A 1NAAA 4H50A 5U25A 2YLWA 2GR3A 2WOIA 4B68A 3BNUA 2C76A 1ZP0A 1TDKA 3UBRA 4UP3A 2EQ9A 4H4TA 4B1BA 2W0HA 4Q1OA 3Q9TA 3ZYXA 5EB4A 3SQPA 2B9YA 4CNJA 4L3ZA 4USRA 2WETA 3SGLA 5BULA 4H4PA 2F5ZA 1E39A 4YTMA 3UTEA 1MXTA 2BYBA 4AP3A 3NIXA 3D1IA 2Y6QA 2Q7VA 4LA1A 4Z26A 1JRYA 3OC4A 4OCGA 2WS3A 1F8RA 1NEKA 3AD7B 4IVOB 1PBEA 3AYLA 2A87A 1BWCA 3DGZA 4J31A 4U8NA 2VOUA 4C77A 1OJ9A 2YVFA 1PHHA 3P4SA 1AOGA 1PXAA 2LFCA 1JU2A 1GESA 1CC6A 2X3NA 3ALMA 1PBFA 3BI4A 2AAQA 1Q1WA 3ISHA 4A5LA 4TM3A 4Z2TA 1CL0A 3C4AA 5JCIA 3AEAA 3DK8A 3F29A 4EIQA 1LTXR 4I59A 3UKLA 3GYJA 4H4ZA 2FJBA 4MJWA 4C5OA 3TORA 2ARDA 1F6MA 2AQJA 1FL2A 1EL5A 1CHUA 1EL7A 1NHRA 2A89A 2VVLA 4JNAA 4OPUA 1RSGA 2OA1A 2XLUA 5TR3A 3UKQA 4OPCA 2VZ2A 4JY3A 1YQ4A 2GAHB 3L8KA 4HB9A 4EQWA 3L1TA 1TDEA 2V3BA 3GD4A 2BACA 2XYOA 4YTPA 3LGQA 2ZZCA 4EM4A 2GR0A 3QFBA 4J56A 4Q5CA 1H7XA 1CJ3A 3S61A 2XDOA 5BUKA 4H4QA 3UOXA 2JAEA 1IUVA 3G5QA 2BCPA 3EPTA 4JY2A 3KPFA 5FS8A 1H81A 1K0JA 2YAUA 4C3YA 4C74A 4N9XA 2QA1A 1DJQA 2XVJA 1ZDLA 3DK9A 2BC1A 3SXQA 2B76A 5CQFA 3CNTA 4YTNA 1W4XA 3AD8B 3G5SA 4CCRA 2V5ZA 1IUSA 3CNDA 1GV4A 5EBKA 4H2RA 2RDZA 4CBQA 2YQUA 4L3XA 1PXCA 1GRTA 2X50A 1E6EA 4XWZA 1ZOVA 3AXBA 4BV6A 2CULA 1GETA 1D7YA 2BS4A 3NYEA 3KVEA 1GU6A 1MO9A 1CC4A 3CNSA 4GDEA 4Y4MA 1B5QA 1BGJA 4CY8A 4XWRA 3QFAA 2ZZBA 3VRDB 4BURA 4K5RA 1IUTA 2WPFA 3F8DA 4ZN0A 2H89A 4DNAA 5KOWA 2JBVA 5BRTA 2JK6A 1XHCA 3DJJA 1XPQA 3REDA 2OT4A 2E1MA 1FS8A 3CGEA 1MOKA 1X31B 4ICYA 2JB3A 3LJPA 2XFNA 3UP4A 4Z25A 4BK1A 1Z6LA 2GRTA 2GEWA 3EF6A 4GDPA 1NG4A 1QLBA 5C2TA 4A6NA 1Y56A 1VG9A 3AE3A 5L46A 2HQMA 1E1LA 1H83A 3Q6JA 3VRAA 4IVMB 3K7QX 2TPRA 2GQWA 1SEZA 4REKA 3H8LA 1NHQA 3UU9A 2JKCA 2RGHA 2XFPA 1B8SA 1F3PA 1N4WA 4PAAA 1M1PA 3AE6A 3AB1A 3LXDA 3AEDA 1H86A 2YLTA 3FG2P 4Y4NA 3UKAA 4Q17A 4KPRA 2V61A 3NN6X 4GCMA 3ITJA 3E1TA 2RGOA 3GM6A 2JB1A 1DODA 2YR6A 4WX1A 4C3XA 3II4A 2Q6UA 1D5TA 2R45A 3UTGA 5C3JA 4U2TA 1E1KA 2DKIA 1FT5A 2EQ8A 4L3YA 1Y0PA 4OPGA 2YG4A 4B67A 1LVLA 1UKVG 1KFYA 4NEWA 4YSYA 3AEFA 2YR5A 2J7AA 1VQWA 4B69A 5KVHA 4YT0A 4TLXA 5GRTA 2H88A 4Z44A 2ZZ0A 3BHFA 4U8JA 1B4VA 1RYIA 4YSXA 2WDQA 1TDNA 1EL8A 2V6OA 4K8DA 1B37A 4AP1A 3IHGA 5HY5A 3P4QA 1RP0A 4BJZA 2QAEA 2X8HA 2X8GA 2FBWA 1V59A 3ICRA 4K7ZA 3I6DA 3BI2A 3OWMA 4D04A 3AE7A 3NT6A 5LV9A 1D7LA 1YQZA 4O5UA 2GMHA 2RF7A 3M12A 2PYXA 1JRXA 4H2NA 3NLCA 1TYPA 3RP7A 3KA7A 1GEUA 2ZBWA 1OJCA 3P4PA 2E81A 2WOWA 3V3OA 4UDPA 5JCLA 3D8XA 4B65A 1H7WA 2GV8A 2C67A 3DGHA 4JDRA 3DA1A 3TTBA 1NG3A 1TYTA 4H4WA 4H4UA 2R9ZA 3C96A 1LQUA 4EIPA 1BKWA 3K30A 3VQRA 3ADAB 3NN0X 2ACZA 4B64A 2B7SA 4OPIA 2GR2A 2BABA 3D1CA 1Q1RA 5IQ1A 3NTDA 5M10A 4H2PA 2YLSA 2VVMA 4Q5BA 1ZY8A 1HYUA 1L9DA 1NDAA 1GPEA 2CFYA 2QCUA 1NHPA 3B3RA 3CPIG 1KF6A 4H7UA 2NVKX 1JNIA 2VR0A 1QO8A 1S2YA 3NG7X 4U2SA 1E1NA 5FMHA 2GAGB 1O94A 1ZKQA 3UKPA 4EQRA 2WP9A 2YG7A 1S3BA 3GMBA 1DJNA 4RG3A 3NYCA 4OPLA 2YG6A 1FEAA 4H4SA 4U8OA 1CBOA 1VRQB 2TMDA 5M0ZA 4L38A 2EQ6A 3NKSA 4RG4A 2AR8A 3GRSA 2BXRA 4BK3A 3B6DA 2YM2A 5FS9A 4FK1C 3S5WA 4FDCB 4B63A 4Z2RA 2YVJA 2YLXA 2VVLG 1TDFA 1PJ7A 4Z43A 1BZLA 2APGA 1YQ3A 1LJ1A 3GSIA 4USQA 2C75A 1YKJA 4EQXA 2XLTA 3GYXA 1GREA 2OALA 1FS7A 1PS9A 3PVCA 4J57A 3BNMA 1FEBA 1K0IA 3NNEA 2BXSA 4NEVA 4Z2UA 1M64A 3VRBA 3AD9B 1JRZA 3IC9A 3VR8A 3AYJA 2WU5A 1GSNA 3UOZA 4YKGA 3AEGA 3ATRA 1GRHA 2WEUA 2E5VA 4A99A 5J60A 2K3VA 1EBDA 2WDVA 3GYIA 3COXA 1S2QA 4IV9A 4U8KA 5CKUA 3C4NA 4TM1A 2IVEA 3K7TA 3R9UA 2I0ZA 3CGBA 3BHKA 1E1MA 1OJTA 1P2EA 2B7RA 1LQTA 2WESA 1BF3A 4TLZA 1GXFA 1OAHA 3GWDA 5KVIA 2V60A 1D4EA 1QDBA 1N4VA 1VG0A 1DXLA 4TM4A 3L1RA 1JNRA 3HZLA 4X9NA 4ZCCA 1TDOA 2CDUA 2XLPA 5FS7A 3AWIA 2WBAA 2GR1A 3ALJA 2O9ZA 3DK4A 1L9CA 2BS2A 3CNPA 4NTDA 1NENA 1IUXA 2C65A 3BNJA 1JNZA 5ER0A 3UCLA 4TM0A 3LZWA 2VQBA 2YVGA 4J33A 1GOSA 2J3NA 3URHA 3CGCA 1IUUA 2GMJA 2YR4A 2GB0A 3UKKA 1P2HA 2WPCA 2XFOA 3CNJA 5J7XA 2XVEA 1F8WA 2OLNA 2GQFA 4H4XA 1L9EA 2GVCA 5DBJA 1TRBA 2E4GA 2V3AA 3WE0A 1PBCA 1NPXA 2YG3A 5HYMA 4IA5A 1FOHA 3AE2A 2FJAA 4DGKA 3PS9A 1GTHA 1KDGA 2YM1A 3DJDA 4FK1A 1K4QA 4LIIA 2C70A 1O5WA 1M1RA 4NTCA 1PBBA 4CCQA 2DKHA 1ZMCA 3SCEA 1OJAA 5HXIA 4JNQA
chains in the Genus database with same CATH superfamily
1GRBA 3UKHA 2BCGG 2BK4A 4DSGA 2VRLA 3BI5A 2R0CA 4OVIA 5KRQA 1PJ5A 3AEBA 1PN0A 2WPEA 2Y6RA 1EL9A 3ALLA 3KLJA 4U8IA 3M13A 3RHAA 3FO3A 2C7GA 1FCDA 3M0OA 5FS6A 3IHMA 3G5RA 1JOAA 4Z24A 2VQ7A 5IQ4A 4P9SA 4AT0A 2XCGA 3QVPA 4K5SA 1ZMDA 3K7MX 2XVIA 1Y56B 4U8LA 3FIMB 3QSEA 3DMEA 3NYFA 4YSHA 1IJHA 4UDQA 4H4YA 2BA9A 3EAOA 3I3LA 1XANA 3RNMA 1CC2A 2A8XA 4II3A 3UOVA 1BVBA 3F8RA 3FPZA 2XFQA 3O0HA 4E0VA 4HA6A 3QSMA 1NHSA 4WCTA 3NTAA 4AOSA 1VDCA 5KXJA 1H82A 2CVJA 2Z5YA 2BK3A 3ICTA 1COYA 4X4JA 3MMOA 1K0LA 3NH3X 3AECA 3JSKA 4X9MA 1CJCA 4YSZA 2X99A 1CF3A 2FJDA 1FT6A 2C3CA 3H8IA 4EQSA 3ICSA 1DOCA 1F8SA 1CJ2A 2B9XA 4WJYA 4A6NB 1YY5A 3AE4A 4H4RA 4Y4LA 2Q0LA 5KMQA 3NHOX 3RKHA 1S3EA 2XFUA 3H4KA 3QSSA 2C73A 3GRTA 4BJYA 3V76A 3CTYA 2WOVA 3NGCX 2IVDA 3AE9A 3VR9A 4K22A 1Q9IA 1DOBA 3SM8A 3DJEA 3AYIA 4A79A 3CPJG 4A65A 1DOEA 4YKFA 3QVRA 4XXGA 3T2KA 4AOXA 4G9KA 5BVAA 1GRAA 3IWAA 5U63A 2R0GA 2YLRA 5GSNA 5KWFA 2WHDA 1JEHA 1L0VA 1M6IA 3V3NA 3RP8A 3CIRA 2WU2A 2XVFA 4B66A 4G6GA 3KU9A 3LZXA 4GRTA 1ELIA 3CN8A 1N1PA 4GAVA 2JB2A 3KPKA 3T14A 3NRNA 5HHFA 2YG5A 2IIDA 3BNFA 1BGNA 1FECA 2RABA 3DH9A 3LADA 3NK0X 2C64A 2XLSA 2Z5XA 3LOVA 3KD9A 3ATQA 5U1OA 2R4EA 1M1QA 3GWFA 5KMPA 2E80A 3SZWA 4G73A 4NZHA 3P4RA 3AE8A 3T0KA 3EANA 2YLZA 2RGJA 1D4CA 4U8PA 3UP5A 5KOXA 4Q0TA 1D4DA 4IA6A 3UKFA 2VRMA 4JQ9A 3LB8A 3NK1X 3T2YA 1ZOYA 1KSSA 4OPTA 4BK2A 5EB5A 1ONFA 4ZCDA 3SZ0A 3P1WA 4AT2A 5JCNA 1LPFA 2FJEA 4J34A 4JN9A 4GF7A 4ECHA 2UZZA 1PDHA 2OLOA 1KSUA 3PO7A 4H2QA 2XVHA 4A9WA 2C66A 2PHHA 3AE5A 4U2LA 4CNKA 4Q4UA 4LU6A 4YWOA 3T37A 2YWLA 3UOYA 3NK2X 2GH5A 2BC0A 3QJ4A 4EMJA 3BNGA 1DNCA 1PBDA 2C3DA 4KX6A 3GDNA 4NTEA 4D03A 4FX9A 1CJ4A 1ZX9A 4RSLA 1GRGA 4M52A 4GUVA 4YXDA 3ABVA 3P9UA 3DJGX 1FS9A 4A7AA 2OAMA 1QJDA 3OZ2A 4PABA 1OJDA 4J36A 4CY6A 1GNDA 1O95A 4CRTA 4K2XA 2WP6A 1ZK7A 4GR1A 5EOWA 3RP6A 3LG1A 2B9WA 1REOA 2C72A 3HYWA 3AE1A 1E7PA 2WP5A 3CGDA 3FBSA 2WDRA 3F8PA 3GMCA 3GDPA 4DSHA 4U8MA 1SP3A 4NNJA 2XLRA 2QA2A 3SFEA 3UTFA 4EMIA 2R0PA 1LV0A 4APNA 5JCKA 2BS3A 4UDRA 1GALA 4I58A 2GF3A 2R46A 1N4UA 2X8CA 3SY4A 1GERA 1PXBA 4O5QA 2WQYA 2NPXA 1XDIA 3GD3A 4EMWA 1H6VA 2ZO5A 3CPHG 3ZDNA 1GRFA 2R4JA 4EM3A 5JCMA 3FMWA 3S7WA 1GTEA 3KKJA 3SFDA 2Q0KA 3UTHA 1IUWA 4OPDA 5IPYA 2BK5A 3IF9A 4H4VA 4J2WA 3AEEA 3BNHA 4ADWA 2EQ7A 1GT8A 1KNPA 1H84A 1KNRA 1PJ6A 1NAAA 4H50A 5U25A 2YLWA 2GR3A 2WOIA 4B68A 3BNUA 2C76A 1ZP0A 1TDKA 3UBRA 4UP3A 2EQ9A 4H4TA 4B1BA 2W0HA 2BRAA 4Q1OA 3Q9TA 3ZYXA 5EB4A 3SQPA 2B9YA 4CNJA 4L3ZA 4USRA 2WETA 3SGLA 5BULA 4H4PA 2F5ZA 4G74A 1E39A 4YTMA 2C4CA 1MXTA 3UTEA 2BYBA 4AP3A 3NIXA 3D1IA 2Y6QA 2Q7VA 4LA1A 5KNLA 4Z26A 1JRYA 3OC4A 4OCGA 2WS3A 1F8RA 1NEKA 3AD7B 4IVOB 1PBEA 3AYLA 2A87A 1BWCA 3DGZA 4J31A 4U8NA 2VOUA 4C77A 1OJ9A 2YVFA 1PHHA 3P4SA 1AOGA 1PXAA 2LFCA 1JU2A 1GESA 1CC6A 2X3NA 3ALMA 1PBFA 3BI4A 2AAQA 1Q1WA 3ISHA 4A5LA 4TM3A 4Z2TA 1CL0A 3C4AA 5JCIA 2BRYA 3AEAA 3F29A 3DK8A 3HYXA 3SZCA 4EIQA 3T31A 1LTXR 4I59A 3UKLA 3GYJA 4H4ZA 2FJBA 4MJWA 4C5OA 3TORA 2ARDA 1F6MA 5KMRA 2AQJA 1FL2A 1EL5A 1CHUA 1EL7A 1NHRA 2A89A 2VVLA 4JNAA 4OPUA 1RSGA 2OA1A 2XLUA 5TR3A 3UKQA 4OPCA 2VZ2A 4JY3A 1YQ4A 2GAHB 3L8KA 4HB9A 4EQWA 3L1TA 1TDEA 2V3BA 3GD4A 2BACA 2XYOA 4YTPA 3LGQA 2ZZCA 4EM4A 2GR0A 3QFBA 4J56A 4Q5CA 1H7XA 1CJ3A 3S61A 2XDOA 5BUKA 4H4QA 3UOXA 2JAEA 1IUVA 3G5QA 2BCPA 3EPTA 4JY2A 3KPFA 5FS8A 1H81A 1K0JA 2YAUA 4C3YA 4C74A 4N9XA 2QA1A 1DJQA 2XVJA 1ZDLA 3DK9A 4GAPA 2BC1A 3SXQA 2B76A 5CQFA 3CNTA 4YTNA 1W4XA 3AD8B 3G5SA 4CCRA 2V5ZA 1IUSA 3CNDA 1GV4A 5EBKA 4H2RA 2RDZA 4CBQA 2YQUA 4L3XA 1PXCA 1GRTA 2X50A 1E6EA 4XWZA 1ZOVA 3AXBA 4BV6A 2CULA 1GETA 1D7YA 2BS4A 3NYEA 3KVEA 1GU6A 1MO9A 1CC4A 3CNSA 4GDEA 4Y4MA 1B5QA 1BGJA 4CY8A 4XWRA 3QFAA 2ZZBA 3VRDB 4BURA 4K5RA 1IUTA 2WPFA 3F8DA 4ZN0A 2H89A 3T2ZA 4DNAA 5KOWA 2JBVA 5BRTA 2JK6A 1XHCA 3DJJA 1XPQA 3REDA 2OT4A 2E1MA 1FS8A 3CGEA 1MOKA 1X31B 4ICYA 2JB3A 3LJPA 2XFNA 3UP4A 4Z25A 4BK1A 1Z6LA 2GRTA 2GEWA 3EF6A 4GDPA 1NG4A 1QLBA 5C2TA 4A6NA 1Y56A 1VG9A 3AE3A 5L46A 2HQMA 1E1LA 1H83A 3Q6JA 3VRAA 4IVMB 3K7QX 2TPRA 2GQWA 1SEZA 4REKA 3H8LA 1NHQA 3UU9A 2JKCA 2RGHA 2XFPA 1B8SA 1F3PA 1N4WA 4PAAA 1M1PA 3AE6A 3AB1A 3LXDA 3AEDA 1H86A 2YLTA 3FG2P 4Y4NA 3UKAA 4Q17A 4KPRA 2V61A 3NN6X 4GCMA 3ITJA 3E1TA 2RGOA 3GM6A 2JB1A 1DODA 2YR6A 4WX1A 4C3XA 3II4A 4NWZA 2CZSA 2Q6UA 1D5TA 2R45A 3UTGA 5C3JA 4U2TA 1E1KA 2DKIA 1FT5A 2EQ8A 4L3YA 1Y0PA 4OPGA 2YG4A 4B67A 1LVLA 1UKVG 1KFYA 4NEWA 4YSYA 3AEFA 2YR5A 2J7AA 1VQWA 4B69A 5KVHA 4YT0A 4TLXA 5GRTA 2H88A 4Z44A 2ZZ0A 3BHFA 4U8JA 1B4VA 1RYIA 4YSXA 2WDQA 1TDNA 1EL8A 2V6OA 4K8DA 1B37A 4AP1A 3IHGA 5HY5A 3HYVA 3P4QA 1RP0A 4BJZA 2QAEA 2X8HA 2X8GA 2FBWA 1V59A 3ICRA 4K7ZA 3I6DA 3BI2A 3SYIA 3OWMA 4D04A 3AE7A 3NT6A 5LV9A 1D7LA 1YQZA 4O5UA 2GMHA 2RF7A 3M12A 2PYXA 1JRXA 4H2NA 3NLCA 1TYPA 4G6HA 3RP7A 3KA7A 1GEUA 2ZBWA 1OJCA 3P4PA 2E81A 2WOWA 3V3OA 4UDPA 5JCLA 3D8XA 4B65A 1H7WA 2GV8A 2C67A 3DGHA 4JDRA 3DA1A 3TTBA 1NG3A 1TYTA 4H4WA 4H4UA 2R9ZA 3C96A 1LQUA 4EIPA 1BKWA 3K30A 3VQRA 3ADAB 3NN0X 2ACZA 3SX6A 4B64A 2B7SA 4OPIA 2GR2A 2BABA 3D1CA 1Q1RA 5IQ1A 3NTDA 5M10A 4H2PA 2YLSA 2VVMA 4Q5BA 1ZY8A 1HYUA 1L9DA 1NDAA 1GPEA 2CFYA 2QCUA 1NHPA 3B3RA 3CPIG 1KF6A 4H7UA 2NVKX 1JNIA 2VR0A 1QO8A 1S2YA 3NG7X 4U2SA 1E1NA 5FMHA 2GAGB 1O94A 1ZKQA 3UKPA 4EQRA 2WP9A 2YG7A 1S3BA 3GMBA 1DJNA 4RG3A 3NYCA 5KMSA 4OPLA 2YG6A 1FEAA 4H4SA 4U8OA 1CBOA 1VRQB 2TMDA 5M0ZA 4L38A 2EQ6A 3NKSA 4RG4A 2AR8A 3GRSA 2BXRA 4BK3A 3B6DA 2YM2A 5FS9A 4FK1C 3S5WA 4FDCB 4B63A 4Z2RA 2YVJA 2YLXA 2VVLG 3SXIA 1TDFA 1PJ7A 4Z43A 1BZLA 2APGA 1YQ3A 1LJ1A 3GSIA 4USQA 2C75A 1YKJA 4EQXA 2XLTA 3GYXA 1GREA 2OALA 1FS7A 1PS9A 3PVCA 4J57A 3BNMA 1FEBA 1K0IA 3NNEA 2BXSA 4NEVA 3SZFA 1M64A 4Z2UA 3VRBA 3AD9B 1JRZA 3IC9A 3VR8A 3AYJA 2WU5A 1GSNA 3UOZA 4YKGA 3AEGA 3ATRA 1GRHA 2WEUA 2E5VA 4A99A 5J60A 2K3VA 1EBDA 2WDVA 3GYIA 3COXA 1S2QA 4IV9A 4U8KA 5CKUA 3C4NA 4TM1A 2IVEA 3K7TA 3R9UA 2I0ZA 3CGBA 3BHKA 1E1MA 1OJTA 1P2EA 2B7RA 1LQTA 2WESA 1BF3A 4TLZA 1GXFA 1OAHA 3GWDA 5KVIA 2V60A 1D4EA 1QDBA 1N4VA 1VG0A 1DXLA 4TM4A 3L1RA 1JNRA 3HZLA 4X9NA 4ZCCA 1TDOA 2CDUA 2XLPA 5FS7A 3AWIA 2WBAA 2GR1A 3ALJA 2O9ZA 3DK4A 1L9CA 2BS2A 3CNPA 4NTDA 4II2A 1NENA 1IUXA 2C65A 3BNJA 1JNZA 5ER0A 3UCLA 4TM0A 3LZWA 3CMMA 2VQBA 2YVGA 4J33A 1GOSA 2J3NA 3URHA 3CGCA 1IUUA 2GMJA 2YR4A 2GB0A 3UKKA 1P2HA 2WPCA 2XFOA 3CNJA 5J7XA 2XVEA 1F8WA 2OLNA 2GQFA 4H4XA 1L9EA 2GVCA 5DBJA 1TRBA 2E4GA 2V3AA 3WE0A 1PBCA 1NPXA 2YG3A 5HYMA 4IA5A 1FOHA 3AE2A 2FJAA 4DGKA 3PS9A 1GTHA 1KDGA 2YM1A 3DJDA 4FK1A 1K4QA 4LIIA 2C70A 1O5WA 1M1RA 4NTCA 1PBBA 4CCQA 2DKHA 1ZMCA 3SCEA 1OJAA 5HXIA 4JNQA
chains in the Genus database with same CATH topology
1GRBA 3UKHA 2BCGG 2BK4A 4DSGA 2VRLA 3BI5A 2R0CA 4OVIA 5KRQA 1PJ5A 3AEBA 1PN0A 2WPEA 2Y6RA 1EL9A 3ALLA 3KLJA 4U8IA 3M13A 3RHAA 3FO3A 2C7GA 1FCDA 3M0OA 5FS6A 3IHMA 3G5RA 1JOAA 4Z24A 2VQ7A 5IQ4A 4P9SA 4AT0A 2XCGA 3QVPA 4K5SA 1ZMDA 3K7MX 2XVIA 1Y56B 4U8LA 3FIMB 3QSEA 3DMEA 3NYFA 4YSHA 1IJHA 4UDQA 4H4YA 2BA9A 3EAOA 3I3LA 1XANA 3RNMA 1CC2A 2A8XA 4II3A 3UOVA 1BVBA 3F8RA 3FPZA 2XFQA 3O0HA 4E0VA 4HA6A 3QSMA 1NHSA 4WCTA 3NTAA 4AOSA 1VDCA 5KXJA 1H82A 2CVJA 2Z5YA 2BK3A 3ICTA 1COYA 4X4JA 3MMOA 1K0LA 3NH3X 3AECA 3JSKA 4X9MA 1CJCA 4YSZA 2X99A 1CF3A 2FJDA 1FT6A 2C3CA 3H8IA 4EQSA 3ICSA 1DOCA 1F8SA 1CJ2A 2B9XA 4WJYA 4A6NB 1YY5A 3AE4A 4H4RA 4Y4LA 2Q0LA 5KMQA 3NHOX 3RKHA 1S3EA 2XFUA 3H4KA 3QSSA 2C73A 3GRTA 4BJYA 3V76A 3CTYA 2WOVA 3NGCX 2IVDA 3AE9A 3VR9A 4K22A 1Q9IA 1DOBA 3SM8A 3DJEA 3AYIA 4A79A 3CPJG 4A65A 1DOEA 4YKFA 3QVRA 4XXGA 3T2KA 4AOXA 4G9KA 5BVAA 1GRAA 3IWAA 5U63A 2R0GA 2YLRA 5GSNA 5KWFA 2WHDA 1JEHA 1L0VA 1M6IA 3V3NA 3RP8A 3CIRA 2WU2A 2XVFA 4B66A 4G6GA 3KU9A 3LZXA 4GRTA 1ELIA 3CN8A 1N1PA 4GAVA 2JB2A 3KPKA 3T14A 3NRNA 5HHFA 2YG5A 2IIDA 3BNFA 1BGNA 1FECA 2RABA 3DH9A 3LADA 3NK0X 2C64A 2XLSA 2Z5XA 3LOVA 3KD9A 3ATQA 5U1OA 2R4EA 1M1QA 3GWFA 5KMPA 2E80A 3SZWA 4G73A 4NZHA 3P4RA 3AE8A 3T0KA 3EANA 2YLZA 2RGJA 1D4CA 4U8PA 3UP5A 5KOXA 4Q0TA 1D4DA 4IA6A 3UKFA 2VRMA 4JQ9A 3LB8A 3NK1X 3T2YA 1ZOYA 1KSSA 4OPTA 4BK2A 5EB5A 1ONFA 4ZCDA 3SZ0A 3P1WA 4AT2A 5JCNA 1LPFA 2FJEA 4J34A 4JN9A 4GF7A 4ECHA 2UZZA 1PDHA 2OLOA 1KSUA 3PO7A 4H2QA 2XVHA 4A9WA 2C66A 2PHHA 3AE5A 4U2LA 4CNKA 4Q4UA 4LU6A 4YWOA 3T37A 2YWLA 3UOYA 3NK2X 2GH5A 2BC0A 3QJ4A 4EMJA 3BNGA 1DNCA 1PBDA 2C3DA 4KX6A 3GDNA 4NTEA 4D03A 4FX9A 1CJ4A 1ZX9A 4RSLA 1GRGA 4M52A 4GUVA 4YXDA 3ABVA 3P9UA 3DJGX 1FS9A 4A7AA 2OAMA 1QJDA 3OZ2A 4PABA 1OJDA 4J36A 4CY6A 1GNDA 1O95A 4CRTA 4K2XA 2WP6A 1ZK7A 4GR1A 5EOWA 3RP6A 3LG1A 2B9WA 1REOA 2C72A 3HYWA 3AE1A 1E7PA 2WP5A 3CGDA 3FBSA 2WDRA 3F8PA 3GMCA 3GDPA 4DSHA 4U8MA 1SP3A 4NNJA 2XLRA 2QA2A 3SFEA 3UTFA 4EMIA 2R0PA 1LV0A 4APNA 5JCKA 2BS3A 4UDRA 1GALA 4I58A 2GF3A 2R46A 1N4UA 2X8CA 3SY4A 1GERA 1PXBA 4O5QA 2WQYA 2NPXA 1XDIA 3GD3A 4EMWA 1H6VA 2ZO5A 3CPHG 3ZDNA 1GRFA 2R4JA 4EM3A 5JCMA 3FMWA 3S7WA 1GTEA 3KKJA 3SFDA 2Q0KA 3UTHA 1IUWA 4OPDA 5IPYA 2BK5A 3IF9A 4H4VA 4J2WA 3AEEA 3BNHA 4ADWA 2EQ7A 1GT8A 1KNPA 1H84A 1KNRA 1PJ6A 1NAAA 4H50A 5U25A 2YLWA 2GR3A 2WOIA 4B68A 3BNUA 2C76A 1ZP0A 1TDKA 3UBRA 4UP3A 2EQ9A 4H4TA 4B1BA 2W0HA 2BRAA 4Q1OA 3Q9TA 3ZYXA 5EB4A 3SQPA 2B9YA 4CNJA 4L3ZA 4USRA 2WETA 3SGLA 5BULA 4H4PA 2F5ZA 4G74A 1E39A 4YTMA 2C4CA 1MXTA 3UTEA 2BYBA 4AP3A 3NIXA 3D1IA 2Y6QA 2Q7VA 4LA1A 5KNLA 4Z26A 1JRYA 3OC4A 4OCGA 2WS3A 1F8RA 1NEKA 3AD7B 4IVOB 1PBEA 3AYLA 2A87A 1BWCA 3DGZA 4J31A 4U8NA 2VOUA 4C77A 1OJ9A 2YVFA 1PHHA 3P4SA 1AOGA 1PXAA 2LFCA 1JU2A 1GESA 1CC6A 2X3NA 3ALMA 1PBFA 3BI4A 2AAQA 1Q1WA 3ISHA 4A5LA 4TM3A 4Z2TA 1CL0A 3C4AA 5JCIA 2BRYA 3AEAA 3F29A 3DK8A 3HYXA 3SZCA 4EIQA 3T31A 1LTXR 4I59A 3UKLA 3GYJA 4H4ZA 2FJBA 4MJWA 4C5OA 3TORA 2ARDA 1F6MA 5KMRA 2AQJA 1FL2A 1EL5A 1CHUA 1EL7A 1NHRA 2A89A 2VVLA 4JNAA 4OPUA 1RSGA 2OA1A 2XLUA 5TR3A 3UKQA 4OPCA 2VZ2A 4JY3A 1YQ4A 2GAHB 3L8KA 4HB9A 4EQWA 3L1TA 1TDEA 2V3BA 3GD4A 2BACA 2XYOA 4YTPA 3LGQA 2ZZCA 4EM4A 2GR0A 3QFBA 4J56A 4Q5CA 1H7XA 1CJ3A 3S61A 2XDOA 5BUKA 4H4QA 3UOXA 2JAEA 1IUVA 3G5QA 2BCPA 3EPTA 4JY2A 3KPFA 5FS8A 1H81A 1K0JA 2YAUA 4C3YA 4C74A 4N9XA 2QA1A 1DJQA 2XVJA 1ZDLA 3DK9A 4GAPA 2BC1A 3SXQA 2B76A 5CQFA 3CNTA 4YTNA 1W4XA 3AD8B 3G5SA 4CCRA 2V5ZA 1IUSA 3CNDA 1GV4A 5EBKA 4H2RA 2RDZA 4CBQA 2YQUA 4L3XA 1PXCA 1GRTA 2X50A 1E6EA 4XWZA 1ZOVA 3AXBA 4BV6A 2CULA 1GETA 1D7YA 2BS4A 3NYEA 3KVEA 1GU6A 1MO9A 1CC4A 3CNSA 4GDEA 4Y4MA 1B5QA 1BGJA 4CY8A 4XWRA 3QFAA 2ZZBA 3VRDB 4BURA 4K5RA 1IUTA 2WPFA 3F8DA 4ZN0A 2H89A 3T2ZA 4DNAA 5KOWA 2JBVA 5BRTA 2JK6A 1XHCA 3DJJA 1XPQA 3REDA 2OT4A 2E1MA 1FS8A 3CGEA 1MOKA 1X31B 4ICYA 2JB3A 3LJPA 2XFNA 3UP4A 4Z25A 4BK1A 1Z6LA 2GRTA 2GEWA 3EF6A 4GDPA 1NG4A 1QLBA 5C2TA 4A6NA 1Y56A 1VG9A 3AE3A 5L46A 2HQMA 1E1LA 1H83A 3Q6JA 3VRAA 4IVMB 3K7QX 2TPRA 2GQWA 1SEZA 4REKA 3H8LA 1NHQA 3UU9A 2JKCA 2RGHA 2XFPA 1B8SA 1F3PA 1N4WA 4PAAA 1M1PA 3AE6A 3AB1A 3LXDA 3AEDA 1H86A 2YLTA 3FG2P 4Y4NA 3UKAA 4Q17A 4KPRA 2V61A 3NN6X 4GCMA 3ITJA 3E1TA 2RGOA 3GM6A 2JB1A 1DODA 2YR6A 4WX1A 4C3XA 3II4A 4NWZA 2Q6UA 1D5TA 2R45A 3UTGA 5C3JA 4U2TA 1E1KA 2DKIA 1FT5A 2EQ8A 4L3YA 1Y0PA 4OPGA 2YG4A 4B67A 1LVLA 1UKVG 1KFYA 4NEWA 4YSYA 3AEFA 2YR5A 2J7AA 1VQWA 4B69A 5KVHA 4YT0A 4TLXA 5GRTA 2H88A 4Z44A 2ZZ0A 3BHFA 4U8JA 1B4VA 1RYIA 4YSXA 2WDQA 1TDNA 1EL8A 2V6OA 4K8DA 1B37A 4AP1A 3IHGA 5HY5A 3HYVA 3P4QA 1RP0A 4BJZA 2QAEA 2X8HA 2X8GA 2FBWA 1V59A 3ICRA 4K7ZA 3I6DA 3BI2A 3SYIA 3OWMA 4D04A 3AE7A 3NT6A 5LV9A 1D7LA 1YQZA 4O5UA 2GMHA 2RF7A 3M12A 2PYXA 1JRXA 4H2NA 3NLCA 1TYPA 4G6HA 3RP7A 3KA7A 1GEUA 2ZBWA 1OJCA 3P4PA 2E81A 2WOWA 3V3OA 4UDPA 5JCLA 3D8XA 4B65A 1H7WA 2GV8A 2C67A 3DGHA 4JDRA 3DA1A 3TTBA 1NG3A 1TYTA 4H4WA 4H4UA 2R9ZA 3C96A 1LQUA 4EIPA 1BKWA 3K30A 3VQRA 3ADAB 3NN0X 2ACZA 3SX6A 4B64A 2B7SA 4OPIA 2GR2A 2BABA 3D1CA 1Q1RA 5IQ1A 3NTDA 5M10A 4H2PA 2YLSA 2VVMA 4Q5BA 1ZY8A 1HYUA 1L9DA 1NDAA 1GPEA 2CFYA 2QCUA 1NHPA 3B3RA 3CPIG 1KF6A 4H7UA 2NVKX 1JNIA 2VR0A 1QO8A 1S2YA 3NG7X 4U2SA 1E1NA 5FMHA 2GAGB 1O94A 1ZKQA 3UKPA 4EQRA 2WP9A 2YG7A 1S3BA 3GMBA 1DJNA 4RG3A 3NYCA 5KMSA 4OPLA 2YG6A 1FEAA 4H4SA 4U8OA 1CBOA 1VRQB 2TMDA 5M0ZA 4L38A 2EQ6A 3NKSA 4RG4A 2AR8A 3GRSA 2BXRA 4BK3A 3B6DA 2YM2A 5FS9A 4FK1C 3S5WA 4FDCB 4B63A 4Z2RA 2YVJA 2YLXA 2VVLG 3SXIA 1TDFA 1PJ7A 4Z43A 1BZLA 2APGA 1YQ3A 1LJ1A 3GSIA 4USQA 2C75A 1YKJA 4EQXA 2XLTA 3GYXA 1GREA 2OALA 1FS7A 1PS9A 3PVCA 4J57A 3BNMA 1FEBA 1K0IA 3NNEA 2BXSA 4NEVA 3SZFA 1M64A 4Z2UA 3VRBA 3AD9B 1JRZA 3IC9A 3VR8A 3AYJA 2WU5A 1GSNA 3UOZA 4YKGA 3AEGA 3ATRA 1GRHA 2WEUA 2E5VA 4A99A 5J60A 2K3VA 1EBDA 2WDVA 3GYIA 3COXA 1S2QA 4IV9A 4U8KA 5CKUA 3C4NA 4TM1A 2IVEA 3K7TA 3R9UA 2I0ZA 3CGBA 3BHKA 1E1MA 1OJTA 1P2EA 2B7RA 1LQTA 2WESA 1BF3A 4TLZA 1GXFA 1OAHA 3GWDA 5KVIA 2V60A 1D4EA 1QDBA 1N4VA 1VG0A 1DXLA 4TM4A 3L1RA 1JNRA 3HZLA 4X9NA 4ZCCA 1TDOA 2CDUA 2XLPA 5FS7A 3AWIA 2WBAA 2GR1A 3ALJA 2O9ZA 3DK4A 1L9CA 2BS2A 3CNPA 4NTDA 4II2A 1NENA 1IUXA 2C65A 3BNJA 1JNZA 5ER0A 3UCLA 4TM0A 3LZWA 3CMMA 2VQBA 2YVGA 4J33A 1GOSA 2J3NA 3URHA 3CGCA 1IUUA 2GMJA 2YR4A 2GB0A 3UKKA 1P2HA 2WPCA 2XFOA 3CNJA 5J7XA 2XVEA 1F8WA 2OLNA 2GQFA 4H4XA 1L9EA 2GVCA 5DBJA 1TRBA 2E4GA 2V3AA 3WE0A 1PBCA 1NPXA 2YG3A 5HYMA 4IA5A 1FOHA 3AE2A 2FJAA 4DGKA 3PS9A 1GTHA 1KDGA 2YM1A 3DJDA 4FK1A 1K4QA 4LIIA 2C70A 1O5WA 1M1RA 4NTCA 1PBBA 4CCQA 2DKHA 1ZMCA 3SCEA 1OJAA 5HXIA 4JNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRB A;  3UKH A;  2BCG G;  2BK4 A;  4DSG A;  2VRL A;  3BI5 A;  2R0C A;  4OVI A;  5KRQ A;  1PJ5 A;  3AEB A;  1PN0 A;  2WPE A;  2Y6R A;  1EL9 A;  3ALL A;  3KLJ A;  4U8I A;  3M13 A;  3RHA A;  3FO3 A;  2C7G A;  1FCD A;  3M0O A;  5FS6 A;  3IHM A;  3G5R A;  1JOA A;  4Z24 A;  2VQ7 A;  5IQ4 A;  4P9S A;  4AT0 A;  2XCG A;  3QVP A;  4K5S A;  1ZMD A;  3K7M X;  2XVI A;  1Y56 B;  4U8L A;  3FIM B;  3QSE A;  3DME A;  3NYF A;  4YSH A;  1IJH A;  4UDQ A;  4H4Y A;  2BA9 A;  3EAO A;  3I3L A;  1XAN A;  3RNM A;  1CC2 A;  2A8X A;  3UOV A;  1BVB A;  3F8R A;  3FPZ A;  2XFQ A;  3O0H A;  4E0V A;  4HA6 A;  3QSM A;  1NHS A;  4WCT A;  3NTA A;  4AOS A;  1VDC A;  5KXJ A;  1H82 A;  2CVJ A;  2Z5Y A;  2BK3 A;  3ICT A;  1COY A;  4X4J A;  3MMO A;  1K0L A;  3NH3 X;  3AEC A;  3JSK A;  4X9M A;  1CJC A;  4YSZ A;  2X99 A;  1CF3 A;  2FJD A;  1FT6 A;  2C3C A;  3H8I A;  4EQS A;  3ICS A;  1DOC A;  1F8S A;  1CJ2 A;  2B9X A;  4WJY A;  4A6N B;  1YY5 A;  3AE4 A;  4H4R A;  4Y4L A;  2Q0L A;  3NHO X;  3RKH A;  1S3E A;  2XFU A;  3H4K A;  3QSS A;  2C73 A;  3GRT A;  4BJY A;  3V76 A;  3CTY A;  2WOV A;  3NGC X;  2IVD A;  3AE9 A;  3VR9 A;  4K22 A;  1Q9I A;  1DOB A;  3SM8 A;  3DJE A;  3AYI A;  4A79 A;  3CPJ G;  4A65 A;  1DOE A;  4YKF A;  3QVR A;  4XXG A;  4AOX A;  5BVA A;  1GRA A;  3IWA A;  5U63 A;  2R0G A;  2YLR A;  5GSN A;  5KWF A;  2WHD A;  1JEH A;  1L0V A;  1M6I A;  3V3N A;  3RP8 A;  3CIR A;  2WU2 A;  2XVF A;  4B66 A;  3KU9 A;  3LZX A;  4GRT A;  1ELI A;  3CN8 A;  1N1P A;  2JB2 A;  3NRN A;  5HHF A;  2YG5 A;  2IID A;  3BNF A;  1BGN A;  1FEC A;  2RAB A;  3DH9 A;  3LAD A;  3NK0 X;  2C64 A;  2XLS A;  2Z5X A;  3LOV A;  3KD9 A;  3ATQ A;  5U1O A;  2R4E A;  1M1Q A;  3GWF A;  2E80 A;  4NZH A;  3P4R A;  3AE8 A;  3EAN A;  2YLZ A;  2RGJ A;  1D4C A;  4U8P A;  3UP5 A;  5KOX A;  4Q0T A;  1D4D A;  4IA6 A;  3UKF A;  2VRM A;  4JQ9 A;  3LB8 A;  3NK1 X;  1ZOY A;  1KSS A;  4OPT A;  4BK2 A;  5EB5 A;  1ONF A;  4ZCD A;  3P1W A;  4AT2 A;  5JCN A;  1LPF A;  2FJE A;  4J34 A;  4JN9 A;  4GF7 A;  4ECH A;  2UZZ A;  1PDH A;  2OLO A;  1KSU A;  3PO7 A;  4H2Q A;  2XVH A;  4A9W A;  2C66 A;  2PHH A;  3AE5 A;  4U2L A;  4CNK A;  4Q4U A;  4LU6 A;  4YWO A;  3T37 A;  2YWL A;  3UOY A;  3NK2 X;  2GH5 A;  2BC0 A;  3QJ4 A;  4EMJ A;  3BNG A;  1DNC A;  1PBD A;  2C3D A;  4KX6 A;  3GDN A;  4NTE A;  4D03 A;  4FX9 A;  1CJ4 A;  1ZX9 A;  4RSL A;  1GRG A;  4M52 A;  4GUV A;  4YXD A;  3ABV A;  3P9U A;  3DJG X;  1FS9 A;  4A7A A;  2OAM A;  1QJD A;  3OZ2 A;  4PAB A;  1OJD A;  4J36 A;  4CY6 A;  1GND A;  1O95 A;  4CRT A;  4K2X A;  2WP6 A;  1ZK7 A;  4GR1 A;  5EOW A;  3RP6 A;  3LG1 A;  2B9W A;  1REO A;  2C72 A;  3AE1 A;  1E7P A;  2WP5 A;  3CGD A;  3FBS A;  2WDR A;  3F8P A;  3GMC A;  3GDP A;  4DSH A;  4U8M A;  1SP3 A;  2XLR A;  2QA2 A;  3SFE A;  3UTF A;  4EMI A;  2R0P A;  1LV0 A;  4APN A;  5JCK A;  2BS3 A;  4UDR A;  1GAL A;  4I58 A;  2GF3 A;  2R46 A;  1N4U A;  2X8C A;  1GER A;  1PXB A;  4O5Q A;  2WQY A;  2NPX A;  1XDI A;  3GD3 A;  4EMW A;  1H6V A;  2ZO5 A;  3CPH G;  3ZDN A;  1GRF A;  2R4J A;  4EM3 A;  5JCM A;  3FMW A;  3S7W A;  1GTE A;  3KKJ A;  3SFD A;  2Q0K A;  3UTH A;  1IUW A;  4OPD A;  5IPY A;  2BK5 A;  3IF9 A;  4H4V A;  4J2W A;  3AEE A;  3BNH A;  4ADW A;  2EQ7 A;  1GT8 A;  1KNP A;  1H84 A;  1KNR A;  1PJ6 A;  1NAA A;  4H50 A;  5U25 A;  2YLW A;  2GR3 A;  2WOI A;  4B68 A;  3BNU A;  2C76 A;  1ZP0 A;  1TDK A;  3UBR A;  4UP3 A;  2EQ9 A;  4H4T A;  4B1B A;  2W0H A;  4Q1O A;  3Q9T A;  3ZYX A;  5EB4 A;  3SQP A;  2B9Y A;  4CNJ A;  4L3Z A;  4USR A;  2WET A;  3SGL A;  5BUL A;  4H4P A;  2F5Z A;  1E39 A;  4YTM A;  3UTE A;  1MXT A;  2BYB A;  4AP3 A;  3NIX A;  3D1I A;  2Y6Q A;  2Q7V A;  4LA1 A;  4Z26 A;  1JRY A;  3OC4 A;  4OCG A;  2WS3 A;  1F8R A;  1NEK A;  3AD7 B;  4IVO B;  1PBE A;  3AYL A;  2A87 A;  1BWC A;  3DGZ A;  4J31 A;  4U8N A;  2VOU A;  4C77 A;  1OJ9 A;  2YVF A;  1PHH A;  3P4S A;  1AOG A;  1PXA A;  2LFC A;  1JU2 A;  1GES A;  1CC6 A;  2X3N A;  3ALM A;  1PBF A;  3BI4 A;  2AAQ A;  1Q1W A;  3ISH A;  4A5L A;  4TM3 A;  4Z2T A;  1CL0 A;  3C4A A;  5JCI A;  3AEA A;  3DK8 A;  3F29 A;  4EIQ A;  1LTX R;  4I59 A;  3UKL A;  3GYJ A;  4H4Z A;  2FJB A;  4MJW A;  4C5O A;  3TOR A;  2ARD A;  1F6M A;  2AQJ A;  1FL2 A;  1EL5 A;  1CHU A;  1EL7 A;  1NHR A;  2A89 A;  2VVL A;  4JNA A;  4OPU A;  1RSG A;  2OA1 A;  2XLU A;  5TR3 A;  3UKQ A;  4OPC A;  2VZ2 A;  4JY3 A;  1YQ4 A;  2GAH B;  3L8K A;  4HB9 A;  4EQW A;  3L1T A;  1TDE A;  2V3B A;  3GD4 A;  2BAC A;  2XYO A;  4YTP A;  3LGQ A;  2ZZC A;  4EM4 A;  2GR0 A;  3QFB A;  4J56 A;  4Q5C A;  1H7X A;  1CJ3 A;  3S61 A;  2XDO A;  5BUK A;  4H4Q A;  3UOX A;  2JAE A;  1IUV A;  3G5Q A;  2BCP A;  3EPT A;  4JY2 A;  3KPF A;  5FS8 A;  1H81 A;  1K0J A;  2YAU A;  4C3Y A;  4C74 A;  4N9X A;  2QA1 A;  1DJQ A;  2XVJ A;  1ZDL A;  3DK9 A;  2BC1 A;  3SXQ A;  2B76 A;  5CQF A;  3CNT A;  4YTN A;  1W4X A;  3AD8 B;  3G5S A;  4CCR A;  2V5Z A;  1IUS A;  3CND A;  1GV4 A;  5EBK A;  4H2R A;  2RDZ A;  4CBQ A;  2YQU A;  4L3X A;  1PXC A;  1GRT A;  2X50 A;  1E6E A;  4XWZ A;  1ZOV A;  3AXB A;  4BV6 A;  2CUL A;  1GET A;  1D7Y A;  2BS4 A;  3NYE A;  3KVE A;  1GU6 A;  1MO9 A;  1CC4 A;  3CNS A;  4GDE A;  4Y4M A;  1B5Q A;  1BGJ A;  4CY8 A;  4XWR A;  3QFA A;  2ZZB A;  3VRD B;  4BUR A;  4K5R A;  1IUT A;  2WPF A;  3F8D A;  4ZN0 A;  2H89 A;  4DNA A;  5KOW A;  2JBV A;  5BRT A;  2JK6 A;  1XHC A;  3DJJ A;  1XPQ A;  3RED A;  2OT4 A;  2E1M A;  1FS8 A;  3CGE A;  1MOK A;  1X31 B;  4ICY A;  2JB3 A;  3LJP A;  2XFN A;  3UP4 A;  4Z25 A;  4BK1 A;  1Z6L A;  2GRT A;  2GEW A;  3EF6 A;  4GDP A;  1NG4 A;  1QLB A;  5C2T A;  4A6N A;  1Y56 A;  1VG9 A;  3AE3 A;  5L46 A;  2HQM A;  1E1L A;  1H83 A;  3Q6J A;  3VRA A;  4IVM B;  3K7Q X;  2TPR A;  2GQW A;  1SEZ A;  4REK A;  3H8L A;  1NHQ A;  3UU9 A;  2JKC A;  2RGH A;  2XFP A;  1B8S A;  1F3P A;  1N4W A;  4PAA A;  1M1P A;  3AE6 A;  3AB1 A;  3LXD A;  3AED A;  1H86 A;  2YLT A;  3FG2 P;  4Y4N A;  3UKA A;  4Q17 A;  4KPR A;  2V61 A;  3NN6 X;  4GCM A;  3ITJ A;  3E1T A;  2RGO A;  3GM6 A;  2JB1 A;  1DOD A;  2YR6 A;  4WX1 A;  4C3X A;  3II4 A;  2Q6U A;  1D5T A;  2R45 A;  3UTG A;  5C3J A;  4U2T A;  1E1K A;  2DKI A;  1FT5 A;  2EQ8 A;  4L3Y A;  1Y0P A;  4OPG A;  2YG4 A;  4B67 A;  1LVL A;  1UKV G;  1KFY A;  4NEW A;  4YSY A;  3AEF A;  2YR5 A;  2J7A A;  1VQW A;  4B69 A;  5KVH A;  4YT0 A;  4TLX A;  5GRT A;  2H88 A;  4Z44 A;  2ZZ0 A;  3BHF A;  4U8J A;  1B4V A;  1RYI A;  4YSX A;  2WDQ A;  1TDN A;  1EL8 A;  2V6O A;  4K8D A;  1B37 A;  4AP1 A;  3IHG A;  5HY5 A;  3P4Q A;  1RP0 A;  4BJZ A;  2QAE A;  2X8H A;  2X8G A;  2FBW A;  1V59 A;  3ICR A;  4K7Z A;  3I6D A;  3BI2 A;  3OWM A;  4D04 A;  3AE7 A;  3NT6 A;  5LV9 A;  1D7L A;  1YQZ A;  4O5U A;  2GMH A;  2RF7 A;  3M12 A;  2PYX A;  1JRX A;  4H2N A;  3NLC A;  1TYP A;  3RP7 A;  3KA7 A;  1GEU A;  2ZBW A;  1OJC A;  3P4P A;  2E81 A;  2WOW A;  3V3O A;  4UDP A;  5JCL A;  3D8X A;  4B65 A;  1H7W A;  2GV8 A;  2C67 A;  3DGH A;  4JDR A;  3DA1 A;  3TTB A;  1NG3 A;  1TYT A;  4H4W A;  4H4U A;  2R9Z A;  3C96 A;  1LQU A;  4EIP A;  1BKW A;  3K30 A;  3VQR A;  3ADA B;  3NN0 X;  2ACZ A;  4B64 A;  2B7S A;  4OPI A;  2GR2 A;  2BAB A;  3D1C A;  1Q1R A;  5IQ1 A;  3NTD A;  5M10 A;  4H2P A;  2YLS A;  2VVM A;  4Q5B A;  1ZY8 A;  1HYU A;  1L9D A;  1NDA A;  1GPE A;  2CFY A;  2QCU A;  1NHP A;  3B3R A;  3CPI G;  1KF6 A;  4H7U A;  2NVK X;  1JNI A;  2VR0 A;  1QO8 A;  1S2Y A;  3NG7 X;  4U2S A;  1E1N A;  5FMH A;  2GAG B;  1O94 A;  1ZKQ A;  3UKP A;  4EQR A;  2WP9 A;  2YG7 A;  1S3B A;  3GMB A;  1DJN A;  4RG3 A;  3NYC A;  4OPL A;  2YG6 A;  1FEA A;  4H4S A;  4U8O A;  1CBO A;  1VRQ B;  2TMD A;  5M0Z A;  4L38 A;  2EQ6 A;  3NKS A;  4RG4 A;  2AR8 A;  3GRS A;  2BXR A;  4BK3 A;  3B6D A;  2YM2 A;  5FS9 A;  4FK1 C;  3S5W A;  4FDC B;  4B63 A;  4Z2R A;  2YVJ A;  2YLX A;  2VVL G;  1TDF A;  1PJ7 A;  4Z43 A;  1BZL A;  2APG A;  1YQ3 A;  1LJ1 A;  3GSI A;  4USQ A;  2C75 A;  1YKJ A;  4EQX A;  2XLT A;  3GYX A;  1GRE A;  2OAL A;  1FS7 A;  1PS9 A;  3PVC A;  4J57 A;  3BNM A;  1FEB A;  1K0I A;  3NNE A;  2BXS A;  4NEV A;  4Z2U A;  1M64 A;  3VRB A;  3AD9 B;  1JRZ A;  3IC9 A;  3VR8 A;  3AYJ A;  2WU5 A;  1GSN A;  3UOZ A;  4YKG A;  3AEG A;  3ATR A;  1GRH A;  2WEU A;  2E5V A;  4A99 A;  5J60 A;  2K3V A;  1EBD A;  2WDV A;  3GYI A;  3COX A;  1S2Q A;  4IV9 A;  4U8K A;  5CKU A;  3C4N A;  4TM1 A;  2IVE A;  3K7T A;  3R9U A;  2I0Z A;  3CGB A;  3BHK A;  1E1M A;  1OJT A;  1P2E A;  2B7R A;  1LQT A;  2WES A;  1BF3 A;  4TLZ A;  1GXF A;  1OAH A;  3GWD A;  5KVI A;  2V60 A;  1D4E A;  1QDB A;  1N4V A;  1VG0 A;  1DXL A;  4TM4 A;  3L1R A;  1JNR A;  3HZL A;  4X9N A;  4ZCC A;  1TDO A;  2CDU A;  2XLP A;  5FS7 A;  3AWI A;  2WBA A;  2GR1 A;  3ALJ A;  2O9Z A;  3DK4 A;  1L9C A;  2BS2 A;  3CNP A;  4NTD A;  1NEN A;  1IUX A;  2C65 A;  3BNJ A;  1JNZ A;  5ER0 A;  3UCL A;  4TM0 A;  3LZW A;  2VQB A;  2YVG A;  4J33 A;  1GOS A;  2J3N A;  3URH A;  3CGC A;  1IUU A;  2GMJ A;  2YR4 A;  2GB0 A;  3UKK A;  1P2H A;  2WPC A;  2XFO A;  3CNJ A;  5J7X A;  2XVE A;  1F8W A;  2OLN A;  2GQF A;  4H4X A;  1L9E A;  2GVC A;  5DBJ A;  1TRB A;  2E4G A;  2V3A A;  3WE0 A;  1PBC A;  1NPX A;  2YG3 A;  5HYM A;  4IA5 A;  1FOH A;  3AE2 A;  2FJA A;  4DGK A;  3PS9 A;  1GTH A;  1KDG A;  2YM1 A;  3DJD A;  4FK1 A;  1K4Q A;  4LII A;  2C70 A;  1O5W A;  1M1R A;  4NTC A;  1PBB A;  4CCQ A;  2DKH A;  1ZMC A;  3SCE A;  1OJA A;  5HXI A;  4JNQ A; 
#chains in the Genus database with same CATH topology
 1GRB A;  3UKH A;  2BCG G;  2BK4 A;  4DSG A;  2VRL A;  3BI5 A;  2R0C A;  4OVI A;  5KRQ A;  1PJ5 A;  3AEB A;  1PN0 A;  2WPE A;  2Y6R A;  1EL9 A;  3ALL A;  3KLJ A;  4U8I A;  3M13 A;  3RHA A;  3FO3 A;  2C7G A;  1FCD A;  3M0O A;  5FS6 A;  3IHM A;  3G5R A;  1JOA A;  4Z24 A;  2VQ7 A;  5IQ4 A;  4P9S A;  4AT0 A;  2XCG A;  3QVP A;  4K5S A;  1ZMD A;  3K7M X;  2XVI A;  1Y56 B;  4U8L A;  3FIM B;  3QSE A;  3DME A;  3NYF A;  4YSH A;  1IJH A;  4UDQ A;  4H4Y A;  2BA9 A;  3EAO A;  3I3L A;  1XAN A;  3RNM A;  1CC2 A;  2A8X A;  4II3 A;  3UOV A;  1BVB A;  3F8R A;  3FPZ A;  2XFQ A;  3O0H A;  4E0V A;  4HA6 A;  3QSM A;  1NHS A;  4WCT A;  3NTA A;  4AOS A;  1VDC A;  5KXJ A;  1H82 A;  2CVJ A;  2Z5Y A;  2BK3 A;  3ICT A;  1COY A;  4X4J A;  3MMO A;  1K0L A;  3NH3 X;  3AEC A;  3JSK A;  4X9M A;  1CJC A;  4YSZ A;  2X99 A;  1CF3 A;  2FJD A;  1FT6 A;  2C3C A;  3H8I A;  4EQS A;  3ICS A;  1DOC A;  1F8S A;  1CJ2 A;  2B9X A;  4WJY A;  4A6N B;  1YY5 A;  3AE4 A;  4H4R A;  4Y4L A;  2Q0L A;  5KMQ A;  3NHO X;  3RKH A;  1S3E A;  2XFU A;  3H4K A;  3QSS A;  2C73 A;  3GRT A;  4BJY A;  3V76 A;  3CTY A;  2WOV A;  3NGC X;  2IVD A;  3AE9 A;  3VR9 A;  4K22 A;  1Q9I A;  1DOB A;  3SM8 A;  3DJE A;  3AYI A;  4A79 A;  3CPJ G;  4A65 A;  1DOE A;  4YKF A;  3QVR A;  4XXG A;  3T2K A;  4AOX A;  4G9K A;  5BVA A;  1GRA A;  3IWA A;  5U63 A;  2R0G A;  2YLR A;  5GSN A;  5KWF A;  2WHD A;  1JEH A;  1L0V A;  1M6I A;  3V3N A;  3RP8 A;  3CIR A;  2WU2 A;  2XVF A;  4B66 A;  4G6G A;  3KU9 A;  3LZX A;  4GRT A;  1ELI A;  3CN8 A;  1N1P A;  4GAV A;  2JB2 A;  3KPK A;  3T14 A;  3NRN A;  5HHF A;  2YG5 A;  2IID A;  3BNF A;  1BGN A;  1FEC A;  2RAB A;  3DH9 A;  3LAD A;  3NK0 X;  2C64 A;  2XLS A;  2Z5X A;  3LOV A;  3KD9 A;  3ATQ A;  5U1O A;  2R4E A;  1M1Q A;  3GWF A;  5KMP A;  2E80 A;  3SZW A;  4G73 A;  4NZH A;  3P4R A;  3AE8 A;  3T0K A;  3EAN A;  2YLZ A;  2RGJ A;  1D4C A;  4U8P A;  3UP5 A;  5KOX A;  4Q0T A;  1D4D A;  4IA6 A;  3UKF A;  2VRM A;  4JQ9 A;  3LB8 A;  3NK1 X;  3T2Y A;  1ZOY A;  1KSS A;  4OPT A;  4BK2 A;  5EB5 A;  1ONF A;  4ZCD A;  3SZ0 A;  3P1W A;  4AT2 A;  5JCN A;  1LPF A;  2FJE A;  4J34 A;  4JN9 A;  4GF7 A;  4ECH A;  2UZZ A;  1PDH A;  2OLO A;  1KSU A;  3PO7 A;  4H2Q A;  2XVH A;  4A9W A;  2C66 A;  2PHH A;  3AE5 A;  4U2L A;  4CNK A;  4Q4U A;  4LU6 A;  4YWO A;  3T37 A;  2YWL A;  3UOY A;  3NK2 X;  2GH5 A;  2BC0 A;  3QJ4 A;  4EMJ A;  3BNG A;  1DNC A;  1PBD A;  2C3D A;  4KX6 A;  3GDN A;  4NTE A;  4D03 A;  4FX9 A;  1CJ4 A;  1ZX9 A;  4RSL A;  1GRG A;  4M52 A;  4GUV A;  4YXD A;  3ABV A;  3P9U A;  3DJG X;  1FS9 A;  4A7A A;  2OAM A;  1QJD A;  3OZ2 A;  4PAB A;  1OJD A;  4J36 A;  4CY6 A;  1GND A;  1O95 A;  4CRT A;  4K2X A;  2WP6 A;  1ZK7 A;  4GR1 A;  5EOW A;  3RP6 A;  3LG1 A;  2B9W A;  1REO A;  2C72 A;  3HYW A;  3AE1 A;  1E7P A;  2WP5 A;  3CGD A;  3FBS A;  2WDR A;  3F8P A;  3GMC A;  3GDP A;  4DSH A;  4U8M A;  1SP3 A;  4NNJ A;  2XLR A;  2QA2 A;  3SFE A;  3UTF A;  4EMI A;  2R0P A;  1LV0 A;  4APN A;  5JCK A;  2BS3 A;  4UDR A;  1GAL A;  4I58 A;  2GF3 A;  2R46 A;  1N4U A;  2X8C A;  3SY4 A;  1GER A;  1PXB A;  4O5Q A;  2WQY A;  2NPX A;  1XDI A;  3GD3 A;  4EMW A;  1H6V A;  2ZO5 A;  3CPH G;  3ZDN A;  1GRF A;  2R4J A;  4EM3 A;  5JCM A;  3FMW A;  3S7W A;  1GTE A;  3KKJ A;  3SFD A;  2Q0K A;  3UTH A;  1IUW A;  4OPD A;  5IPY A;  2BK5 A;  3IF9 A;  4H4V A;  4J2W A;  3AEE A;  3BNH A;  4ADW A;  2EQ7 A;  1GT8 A;  1KNP A;  1H84 A;  1KNR A;  1PJ6 A;  1NAA A;  4H50 A;  5U25 A;  2YLW A;  2GR3 A;  2WOI A;  4B68 A;  3BNU A;  2C76 A;  1ZP0 A;  1TDK A;  3UBR A;  4UP3 A;  2EQ9 A;  4H4T A;  4B1B A;  2W0H A;  2BRA A;  4Q1O A;  3Q9T A;  3ZYX A;  5EB4 A;  3SQP A;  2B9Y A;  4CNJ A;  4L3Z A;  4USR A;  2WET A;  3SGL A;  5BUL A;  4H4P A;  2F5Z A;  4G74 A;  1E39 A;  4YTM A;  2C4C A;  1MXT A;  3UTE A;  2BYB A;  4AP3 A;  3NIX A;  3D1I A;  2Y6Q A;  2Q7V A;  4LA1 A;  5KNL A;  4Z26 A;  1JRY A;  3OC4 A;  4OCG A;  2WS3 A;  1F8R A;  1NEK A;  3AD7 B;  4IVO B;  1PBE A;  3AYL A;  2A87 A;  1BWC A;  3DGZ A;  4J31 A;  4U8N A;  2VOU A;  4C77 A;  1OJ9 A;  2YVF A;  1PHH A;  3P4S A;  1AOG A;  1PXA A;  2LFC A;  1JU2 A;  1GES A;  1CC6 A;  2X3N A;  3ALM A;  1PBF A;  3BI4 A;  2AAQ A;  1Q1W A;  3ISH A;  4A5L A;  4TM3 A;  4Z2T A;  1CL0 A;  3C4A A;  5JCI A;  2BRY A;  3AEA A;  3F29 A;  3DK8 A;  3HYX A;  3SZC A;  4EIQ A;  3T31 A;  1LTX R;  4I59 A;  3UKL A;  3GYJ A;  4H4Z A;  2FJB A;  4MJW A;  4C5O A;  3TOR A;  2ARD A;  1F6M A;  5KMR A;  2AQJ A;  1FL2 A;  1EL5 A;  1CHU A;  1EL7 A;  1NHR A;  2A89 A;  2VVL A;  4JNA A;  4OPU A;  1RSG A;  2OA1 A;  2XLU A;  5TR3 A;  3UKQ A;  4OPC A;  2VZ2 A;  4JY3 A;  1YQ4 A;  2GAH B;  3L8K A;  4HB9 A;  4EQW A;  3L1T A;  1TDE A;  2V3B A;  3GD4 A;  2BAC A;  2XYO A;  4YTP A;  3LGQ A;  2ZZC A;  4EM4 A;  2GR0 A;  3QFB A;  4J56 A;  4Q5C A;  1H7X A;  1CJ3 A;  3S61 A;  2XDO A;  5BUK A;  4H4Q A;  3UOX A;  2JAE A;  1IUV A;  3G5Q A;  2BCP A;  3EPT A;  4JY2 A;  3KPF A;  5FS8 A;  1H81 A;  1K0J A;  2YAU A;  4C3Y A;  4C74 A;  4N9X A;  2QA1 A;  1DJQ A;  2XVJ A;  1ZDL A;  3DK9 A;  4GAP A;  2BC1 A;  3SXQ A;  2B76 A;  5CQF A;  3CNT A;  4YTN A;  1W4X A;  3AD8 B;  3G5S A;  4CCR A;  2V5Z A;  1IUS A;  3CND A;  1GV4 A;  5EBK A;  4H2R A;  2RDZ A;  4CBQ A;  2YQU A;  4L3X A;  1PXC A;  1GRT A;  2X50 A;  1E6E A;  4XWZ A;  1ZOV A;  3AXB A;  4BV6 A;  2CUL A;  1GET A;  1D7Y A;  2BS4 A;  3NYE A;  3KVE A;  1GU6 A;  1MO9 A;  1CC4 A;  3CNS A;  4GDE A;  4Y4M A;  1B5Q A;  1BGJ A;  4CY8 A;  4XWR A;  3QFA A;  2ZZB A;  3VRD B;  4BUR A;  4K5R A;  1IUT A;  2WPF A;  3F8D A;  4ZN0 A;  2H89 A;  3T2Z A;  4DNA A;  5KOW A;  2JBV A;  5BRT A;  2JK6 A;  1XHC A;  3DJJ A;  1XPQ A;  3RED A;  2OT4 A;  2E1M A;  1FS8 A;  3CGE A;  1MOK A;  1X31 B;  4ICY A;  2JB3 A;  3LJP A;  2XFN A;  3UP4 A;  4Z25 A;  4BK1 A;  1Z6L A;  2GRT A;  2GEW A;  3EF6 A;  4GDP A;  1NG4 A;  1QLB A;  5C2T A;  4A6N A;  1Y56 A;  1VG9 A;  3AE3 A;  5L46 A;  2HQM A;  1E1L A;  1H83 A;  3Q6J A;  3VRA A;  4IVM B;  3K7Q X;  2TPR A;  2GQW A;  1SEZ A;  4REK A;  3H8L A;  1NHQ A;  3UU9 A;  2JKC A;  2RGH A;  2XFP A;  1B8S A;  1F3P A;  1N4W A;  4PAA A;  1M1P A;  3AE6 A;  3AB1 A;  3LXD A;  3AED A;  1H86 A;  2YLT A;  3FG2 P;  4Y4N A;  3UKA A;  4Q17 A;  4KPR A;  2V61 A;  3NN6 X;  4GCM A;  3ITJ A;  3E1T A;  2RGO A;  3GM6 A;  2JB1 A;  1DOD A;  2YR6 A;  4WX1 A;  4C3X A;  3II4 A;  4NWZ A;  2CZS A;  2Q6U A;  1D5T A;  2R45 A;  3UTG A;  5C3J A;  4U2T A;  1E1K A;  2DKI A;  1FT5 A;  2EQ8 A;  4L3Y A;  1Y0P A;  4OPG A;  2YG4 A;  4B67 A;  1LVL A;  1UKV G;  1KFY A;  4NEW A;  4YSY A;  3AEF A;  2YR5 A;  2J7A A;  1VQW A;  4B69 A;  5KVH A;  4YT0 A;  4TLX A;  5GRT A;  2H88 A;  4Z44 A;  2ZZ0 A;  3BHF A;  4U8J A;  1B4V A;  1RYI A;  4YSX A;  2WDQ A;  1TDN A;  1EL8 A;  2V6O A;  4K8D A;  1B37 A;  4AP1 A;  3IHG A;  5HY5 A;  3HYV A;  3P4Q A;  1RP0 A;  4BJZ A;  2QAE A;  2X8H A;  2X8G A;  2FBW A;  1V59 A;  3ICR A;  4K7Z A;  3I6D A;  3BI2 A;  3SYI A;  3OWM A;  4D04 A;  3AE7 A;  3NT6 A;  5LV9 A;  1D7L A;  1YQZ A;  4O5U A;  2GMH A;  2RF7 A;  3M12 A;  2PYX A;  1JRX A;  4H2N A;  3NLC A;  1TYP A;  4G6H A;  3RP7 A;  3KA7 A;  1GEU A;  2ZBW A;  1OJC A;  3P4P A;  2E81 A;  2WOW A;  3V3O A;  4UDP A;  5JCL A;  3D8X A;  4B65 A;  1H7W A;  2GV8 A;  2C67 A;  3DGH A;  4JDR A;  3DA1 A;  3TTB A;  1NG3 A;  1TYT A;  4H4W A;  4H4U A;  2R9Z A;  3C96 A;  1LQU A;  4EIP A;  1BKW A;  3K30 A;  3VQR A;  3ADA B;  3NN0 X;  2ACZ A;  3SX6 A;  4B64 A;  2B7S A;  4OPI A;  2GR2 A;  2BAB A;  3D1C A;  1Q1R A;  5IQ1 A;  3NTD A;  5M10 A;  4H2P A;  2YLS A;  2VVM A;  4Q5B A;  1ZY8 A;  1HYU A;  1L9D A;  1NDA A;  1GPE A;  2CFY A;  2QCU A;  1NHP A;  3B3R A;  3CPI G;  1KF6 A;  4H7U A;  2NVK X;  1JNI A;  2VR0 A;  1QO8 A;  1S2Y A;  3NG7 X;  4U2S A;  1E1N A;  5FMH A;  2GAG B;  1O94 A;  1ZKQ A;  3UKP A;  4EQR A;  2WP9 A;  2YG7 A;  1S3B A;  3GMB A;  1DJN A;  4RG3 A;  3NYC A;  5KMS A;  4OPL A;  2YG6 A;  1FEA A;  4H4S A;  4U8O A;  1CBO A;  1VRQ B;  2TMD A;  5M0Z A;  4L38 A;  2EQ6 A;  3NKS A;  4RG4 A;  2AR8 A;  3GRS A;  2BXR A;  4BK3 A;  3B6D A;  2YM2 A;  5FS9 A;  4FK1 C;  3S5W A;  4FDC B;  4B63 A;  4Z2R A;  2YVJ A;  2YLX A;  2VVL G;  3SXI A;  1TDF A;  1PJ7 A;  4Z43 A;  1BZL A;  2APG A;  1YQ3 A;  1LJ1 A;  3GSI A;  4USQ A;  2C75 A;  1YKJ A;  4EQX A;  2XLT A;  3GYX A;  1GRE A;  2OAL A;  1FS7 A;  1PS9 A;  3PVC A;  4J57 A;  3BNM A;  1FEB A;  1K0I A;  3NNE A;  2BXS A;  4NEV A;  3SZF A;  1M64 A;  4Z2U A;  3VRB A;  3AD9 B;  1JRZ A;  3IC9 A;  3VR8 A;  3AYJ A;  2WU5 A;  1GSN A;  3UOZ A;  4YKG A;  3AEG A;  3ATR A;  1GRH A;  2WEU A;  2E5V A;  4A99 A;  5J60 A;  2K3V A;  1EBD A;  2WDV A;  3GYI A;  3COX A;  1S2Q A;  4IV9 A;  4U8K A;  5CKU A;  3C4N A;  4TM1 A;  2IVE A;  3K7T A;  3R9U A;  2I0Z A;  3CGB A;  3BHK A;  1E1M A;  1OJT A;  1P2E A;  2B7R A;  1LQT A;  2WES A;  1BF3 A;  4TLZ A;  1GXF A;  1OAH A;  3GWD A;  5KVI A;  2V60 A;  1D4E A;  1QDB A;  1N4V A;  1VG0 A;  1DXL A;  4TM4 A;  3L1R A;  1JNR A;  3HZL A;  4X9N A;  4ZCC A;  1TDO A;  2CDU A;  2XLP A;  5FS7 A;  3AWI A;  2WBA A;  2GR1 A;  3ALJ A;  2O9Z A;  3DK4 A;  1L9C A;  2BS2 A;  3CNP A;  4NTD A;  4II2 A;  1NEN A;  1IUX A;  2C65 A;  3BNJ A;  1JNZ A;  5ER0 A;  3UCL A;  4TM0 A;  3LZW A;  3CMM A;  2VQB A;  2YVG A;  4J33 A;  1GOS A;  2J3N A;  3URH A;  3CGC A;  1IUU A;  2GMJ A;  2YR4 A;  2GB0 A;  3UKK A;  1P2H A;  2WPC A;  2XFO A;  3CNJ A;  5J7X A;  2XVE A;  1F8W A;  2OLN A;  2GQF A;  4H4X A;  1L9E A;  2GVC A;  5DBJ A;  1TRB A;  2E4G A;  2V3A A;  3WE0 A;  1PBC A;  1NPX A;  2YG3 A;  5HYM A;  4IA5 A;  1FOH A;  3AE2 A;  2FJA A;  4DGK A;  3PS9 A;  1GTH A;  1KDG A;  2YM1 A;  3DJD A;  4FK1 A;  1K4Q A;  4LII A;  2C70 A;  1O5W A;  1M1R A;  4NTC A;  1PBB A;  4CCQ A;  2DKH A;  1ZMC A;  3SCE A;  1OJA A;  5HXI A;  4JNQ A; 
#chains in the Genus database with same CATH homology
 1GRB A;  3UKH A;  2BCG G;  2BK4 A;  4DSG A;  2VRL A;  3BI5 A;  2R0C A;  4OVI A;  5KRQ A;  1PJ5 A;  3AEB A;  1PN0 A;  2WPE A;  2Y6R A;  1EL9 A;  3ALL A;  3KLJ A;  4U8I A;  3M13 A;  3RHA A;  3FO3 A;  2C7G A;  1FCD A;  3M0O A;  5FS6 A;  3IHM A;  3G5R A;  1JOA A;  4Z24 A;  2VQ7 A;  5IQ4 A;  4P9S A;  4AT0 A;  2XCG A;  3QVP A;  4K5S A;  1ZMD A;  3K7M X;  2XVI A;  1Y56 B;  4U8L A;  3FIM B;  3QSE A;  3DME A;  3NYF A;  4YSH A;  1IJH A;  4UDQ A;  4H4Y A;  2BA9 A;  3EAO A;  3I3L A;  1XAN A;  3RNM A;  1CC2 A;  2A8X A;  4II3 A;  3UOV A;  1BVB A;  3F8R A;  3FPZ A;  2XFQ A;  3O0H A;  4E0V A;  4HA6 A;  3QSM A;  1NHS A;  4WCT A;  3NTA A;  4AOS A;  1VDC A;  5KXJ A;  1H82 A;  2CVJ A;  2Z5Y A;  2BK3 A;  3ICT A;  1COY A;  4X4J A;  3MMO A;  1K0L A;  3NH3 X;  3AEC A;  3JSK A;  4X9M A;  1CJC A;  4YSZ A;  2X99 A;  1CF3 A;  2FJD A;  1FT6 A;  2C3C A;  3H8I A;  4EQS A;  3ICS A;  1DOC A;  1F8S A;  1CJ2 A;  2B9X A;  4WJY A;  4A6N B;  1YY5 A;  3AE4 A;  4H4R A;  4Y4L A;  2Q0L A;  5KMQ A;  3NHO X;  3RKH A;  1S3E A;  2XFU A;  3H4K A;  3QSS A;  2C73 A;  3GRT A;  4BJY A;  3V76 A;  3CTY A;  2WOV A;  3NGC X;  2IVD A;  3AE9 A;  3VR9 A;  4K22 A;  1Q9I A;  1DOB A;  3SM8 A;  3DJE A;  3AYI A;  4A79 A;  3CPJ G;  4A65 A;  1DOE A;  4YKF A;  3QVR A;  4XXG A;  3T2K A;  4AOX A;  4G9K A;  5BVA A;  1GRA A;  3IWA A;  5U63 A;  2R0G A;  2YLR A;  5GSN A;  5KWF A;  2WHD A;  1JEH A;  1L0V A;  1M6I A;  3V3N A;  3RP8 A;  3CIR A;  2WU2 A;  2XVF A;  4B66 A;  4G6G A;  3KU9 A;  3LZX A;  4GRT A;  1ELI A;  3CN8 A;  1N1P A;  4GAV A;  2JB2 A;  3KPK A;  3T14 A;  3NRN A;  5HHF A;  2YG5 A;  2IID A;  3BNF A;  1BGN A;  1FEC A;  2RAB A;  3DH9 A;  3LAD A;  3NK0 X;  2C64 A;  2XLS A;  2Z5X A;  3LOV A;  3KD9 A;  3ATQ A;  5U1O A;  2R4E A;  1M1Q A;  3GWF A;  5KMP A;  2E80 A;  3SZW A;  4G73 A;  4NZH A;  3P4R A;  3AE8 A;  3T0K A;  3EAN A;  2YLZ A;  2RGJ A;  1D4C A;  4U8P A;  3UP5 A;  5KOX A;  4Q0T A;  1D4D A;  4IA6 A;  3UKF A;  2VRM A;  4JQ9 A;  3LB8 A;  3NK1 X;  3T2Y A;  1ZOY A;  1KSS A;  4OPT A;  4BK2 A;  5EB5 A;  1ONF A;  4ZCD A;  3SZ0 A;  3P1W A;  4AT2 A;  5JCN A;  1LPF A;  2FJE A;  4J34 A;  4JN9 A;  4GF7 A;  4ECH A;  2UZZ A;  1PDH A;  2OLO A;  1KSU A;  3PO7 A;  4H2Q A;  2XVH A;  4A9W A;  2C66 A;  2PHH A;  3AE5 A;  4U2L A;  4CNK A;  4Q4U A;  4LU6 A;  4YWO A;  3T37 A;  2YWL A;  3UOY A;  3NK2 X;  2GH5 A;  2BC0 A;  3QJ4 A;  4EMJ A;  3BNG A;  1DNC A;  1PBD A;  2C3D A;  4KX6 A;  3GDN A;  4NTE A;  4D03 A;  4FX9 A;  1CJ4 A;  1ZX9 A;  4RSL A;  1GRG A;  4M52 A;  4GUV A;  4YXD A;  3ABV A;  3P9U A;  3DJG X;  1FS9 A;  4A7A A;  2OAM A;  1QJD A;  3OZ2 A;  4PAB A;  1OJD A;  4J36 A;  4CY6 A;  1GND A;  1O95 A;  4CRT A;  4K2X A;  2WP6 A;  1ZK7 A;  4GR1 A;  5EOW A;  3RP6 A;  3LG1 A;  2B9W A;  1REO A;  2C72 A;  3HYW A;  3AE1 A;  1E7P A;  2WP5 A;  3CGD A;  3FBS A;  2WDR A;  3F8P A;  3GMC A;  3GDP A;  4DSH A;  4U8M A;  1SP3 A;  4NNJ A;  2XLR A;  2QA2 A;  3SFE A;  3UTF A;  4EMI A;  2R0P A;  1LV0 A;  4APN A;  5JCK A;  2BS3 A;  4UDR A;  1GAL A;  4I58 A;  2GF3 A;  2R46 A;  1N4U A;  2X8C A;  3SY4 A;  1GER A;  1PXB A;  4O5Q A;  2WQY A;  2NPX A;  1XDI A;  3GD3 A;  4EMW A;  1H6V A;  2ZO5 A;  3CPH G;  3ZDN A;  1GRF A;  2R4J A;  4EM3 A;  5JCM A;  3FMW A;  3S7W A;  1GTE A;  3KKJ A;  3SFD A;  2Q0K A;  3UTH A;  1IUW A;  4OPD A;  5IPY A;  2BK5 A;  3IF9 A;  4H4V A;  4J2W A;  3AEE A;  3BNH A;  4ADW A;  2EQ7 A;  1GT8 A;  1KNP A;  1H84 A;  1KNR A;  1PJ6 A;  1NAA A;  4H50 A;  5U25 A;  2YLW A;  2GR3 A;  2WOI A;  4B68 A;  3BNU A;  2C76 A;  1ZP0 A;  1TDK A;  3UBR A;  4UP3 A;  2EQ9 A;  4H4T A;  4B1B A;  2W0H A;  2BRA A;  4Q1O A;  3Q9T A;  3ZYX A;  5EB4 A;  3SQP A;  2B9Y A;  4CNJ A;  4L3Z A;  4USR A;  2WET A;  3SGL A;  5BUL A;  4H4P A;  2F5Z A;  4G74 A;  1E39 A;  4YTM A;  2C4C A;  1MXT A;  3UTE A;  2BYB A;  4AP3 A;  3NIX A;  3D1I A;  2Y6Q A;  2Q7V A;  4LA1 A;  5KNL A;  4Z26 A;  1JRY A;  3OC4 A;  4OCG A;  2WS3 A;  1F8R A;  1NEK A;  3AD7 B;  4IVO B;  1PBE A;  3AYL A;  2A87 A;  1BWC A;  3DGZ A;  4J31 A;  4U8N A;  2VOU A;  4C77 A;  1OJ9 A;  2YVF A;  1PHH A;  3P4S A;  1AOG A;  1PXA A;  2LFC A;  1JU2 A;  1GES A;  1CC6 A;  2X3N A;  3ALM A;  1PBF A;  3BI4 A;  2AAQ A;  1Q1W A;  3ISH A;  4A5L A;  4TM3 A;  4Z2T A;  1CL0 A;  3C4A A;  5JCI A;  2BRY A;  3AEA A;  3F29 A;  3DK8 A;  3HYX A;  3SZC A;  4EIQ A;  3T31 A;  1LTX R;  4I59 A;  3UKL A;  3GYJ A;  4H4Z A;  2FJB A;  4MJW A;  4C5O A;  3TOR A;  2ARD A;  1F6M A;  5KMR A;  2AQJ A;  1FL2 A;  1EL5 A;  1CHU A;  1EL7 A;  1NHR A;  2A89 A;  2VVL A;  4JNA A;  4OPU A;  1RSG A;  2OA1 A;  2XLU A;  5TR3 A;  3UKQ A;  4OPC A;  2VZ2 A;  4JY3 A;  1YQ4 A;  2GAH B;  3L8K A;  4HB9 A;  4EQW A;  3L1T A;  1TDE A;  2V3B A;  3GD4 A;  2BAC A;  2XYO A;  4YTP A;  3LGQ A;  2ZZC A;  4EM4 A;  2GR0 A;  3QFB A;  4J56 A;  4Q5C A;  1H7X A;  1CJ3 A;  3S61 A;  2XDO A;  5BUK A;  4H4Q A;  3UOX A;  2JAE A;  1IUV A;  3G5Q A;  2BCP A;  3EPT A;  4JY2 A;  3KPF A;  5FS8 A;  1H81 A;  1K0J A;  2YAU A;  4C3Y A;  4C74 A;  4N9X A;  2QA1 A;  1DJQ A;  2XVJ A;  1ZDL A;  3DK9 A;  4GAP A;  2BC1 A;  3SXQ A;  2B76 A;  5CQF A;  3CNT A;  4YTN A;  1W4X A;  3AD8 B;  3G5S A;  4CCR A;  2V5Z A;  1IUS A;  3CND A;  1GV4 A;  5EBK A;  4H2R A;  2RDZ A;  4CBQ A;  2YQU A;  4L3X A;  1PXC A;  1GRT A;  2X50 A;  1E6E A;  4XWZ A;  1ZOV A;  3AXB A;  4BV6 A;  2CUL A;  1GET A;  1D7Y A;  2BS4 A;  3NYE A;  3KVE A;  1GU6 A;  1MO9 A;  1CC4 A;  3CNS A;  4GDE A;  4Y4M A;  1B5Q A;  1BGJ A;  4CY8 A;  4XWR A;  3QFA A;  2ZZB A;  3VRD B;  4BUR A;  4K5R A;  1IUT A;  2WPF A;  3F8D A;  4ZN0 A;  2H89 A;  3T2Z A;  4DNA A;  5KOW A;  2JBV A;  5BRT A;  2JK6 A;  1XHC A;  3DJJ A;  1XPQ A;  3RED A;  2OT4 A;  2E1M A;  1FS8 A;  3CGE A;  1MOK A;  1X31 B;  4ICY A;  2JB3 A;  3LJP A;  2XFN A;  3UP4 A;  4Z25 A;  4BK1 A;  1Z6L A;  2GRT A;  2GEW A;  3EF6 A;  4GDP A;  1NG4 A;  1QLB A;  5C2T A;  4A6N A;  1Y56 A;  1VG9 A;  3AE3 A;  5L46 A;  2HQM A;  1E1L A;  1H83 A;  3Q6J A;  3VRA A;  4IVM B;  3K7Q X;  2TPR A;  2GQW A;  1SEZ A;  4REK A;  3H8L A;  1NHQ A;  3UU9 A;  2JKC A;  2RGH A;  2XFP A;  1B8S A;  1F3P A;  1N4W A;  4PAA A;  1M1P A;  3AE6 A;  3AB1 A;  3LXD A;  3AED A;  1H86 A;  2YLT A;  3FG2 P;  4Y4N A;  3UKA A;  4Q17 A;  4KPR A;  2V61 A;  3NN6 X;  4GCM A;  3ITJ A;  3E1T A;  2RGO A;  3GM6 A;  2JB1 A;  1DOD A;  2YR6 A;  4WX1 A;  4C3X A;  3II4 A;  4NWZ A;  2Q6U A;  1D5T A;  2R45 A;  3UTG A;  5C3J A;  4U2T A;  1E1K A;  2DKI A;  1FT5 A;  2EQ8 A;  4L3Y A;  1Y0P A;  4OPG A;  2YG4 A;  4B67 A;  1LVL A;  1UKV G;  1KFY A;  4NEW A;  4YSY A;  3AEF A;  2YR5 A;  2J7A A;  1VQW A;  4B69 A;  5KVH A;  4YT0 A;  4TLX A;  5GRT A;  2H88 A;  4Z44 A;  2ZZ0 A;  3BHF A;  4U8J A;  1B4V A;  1RYI A;  4YSX A;  2WDQ A;  1TDN A;  1EL8 A;  2V6O A;  4K8D A;  1B37 A;  4AP1 A;  3IHG A;  5HY5 A;  3HYV A;  3P4Q A;  1RP0 A;  4BJZ A;  2QAE A;  2X8H A;  2X8G A;  2FBW A;  1V59 A;  3ICR A;  4K7Z A;  3I6D A;  3BI2 A;  3SYI A;  3OWM A;  4D04 A;  3AE7 A;  3NT6 A;  5LV9 A;  1D7L A;  1YQZ A;  4O5U A;  2GMH A;  2RF7 A;  3M12 A;  2PYX A;  1JRX A;  4H2N A;  3NLC A;  1TYP A;  4G6H A;  3RP7 A;  3KA7 A;  1GEU A;  2ZBW A;  1OJC A;  3P4P A;  2E81 A;  2WOW A;  3V3O A;  4UDP A;  5JCL A;  3D8X A;  4B65 A;  1H7W A;  2GV8 A;  2C67 A;  3DGH A;  4JDR A;  3DA1 A;  3TTB A;  1NG3 A;  1TYT A;  4H4W A;  4H4U A;  2R9Z A;  3C96 A;  1LQU A;  4EIP A;  1BKW A;  3K30 A;  3VQR A;  3ADA B;  3NN0 X;  2ACZ A;  3SX6 A;  4B64 A;  2B7S A;  4OPI A;  2GR2 A;  2BAB A;  3D1C A;  1Q1R A;  5IQ1 A;  3NTD A;  5M10 A;  4H2P A;  2YLS A;  2VVM A;  4Q5B A;  1ZY8 A;  1HYU A;  1L9D A;  1NDA A;  1GPE A;  2CFY A;  2QCU A;  1NHP A;  3B3R A;  3CPI G;  1KF6 A;  4H7U A;  2NVK X;  1JNI A;  2VR0 A;  1QO8 A;  1S2Y A;  3NG7 X;  4U2S A;  1E1N A;  5FMH A;  2GAG B;  1O94 A;  1ZKQ A;  3UKP A;  4EQR A;  2WP9 A;  2YG7 A;  1S3B A;  3GMB A;  1DJN A;  4RG3 A;  3NYC A;  5KMS A;  4OPL A;  2YG6 A;  1FEA A;  4H4S A;  4U8O A;  1CBO A;  1VRQ B;  2TMD A;  5M0Z A;  4L38 A;  2EQ6 A;  3NKS A;  4RG4 A;  2AR8 A;  3GRS A;  2BXR A;  4BK3 A;  3B6D A;  2YM2 A;  5FS9 A;  4FK1 C;  3S5W A;  4FDC B;  4B63 A;  4Z2R A;  2YVJ A;  2YLX A;  2VVL G;  3SXI A;  1TDF A;  1PJ7 A;  4Z43 A;  1BZL A;  2APG A;  1YQ3 A;  1LJ1 A;  3GSI A;  4USQ A;  2C75 A;  1YKJ A;  4EQX A;  2XLT A;  3GYX A;  1GRE A;  2OAL A;  1FS7 A;  1PS9 A;  3PVC A;  4J57 A;  3BNM A;  1FEB A;  1K0I A;  3NNE A;  2BXS A;  4NEV A;  3SZF A;  1M64 A;  4Z2U A;  3VRB A;  3AD9 B;  1JRZ A;  3IC9 A;  3VR8 A;  3AYJ A;  2WU5 A;  1GSN A;  3UOZ A;  4YKG A;  3AEG A;  3ATR A;  1GRH A;  2WEU A;  2E5V A;  4A99 A;  5J60 A;  2K3V A;  1EBD A;  2WDV A;  3GYI A;  3COX A;  1S2Q A;  4IV9 A;  4U8K A;  5CKU A;  3C4N A;  4TM1 A;  2IVE A;  3K7T A;  3R9U A;  2I0Z A;  3CGB A;  3BHK A;  1E1M A;  1OJT A;  1P2E A;  2B7R A;  1LQT A;  2WES A;  1BF3 A;  4TLZ A;  1GXF A;  1OAH A;  3GWD A;  5KVI A;  2V60 A;  1D4E A;  1QDB A;  1N4V A;  1VG0 A;  1DXL A;  4TM4 A;  3L1R A;  1JNR A;  3HZL A;  4X9N A;  4ZCC A;  1TDO A;  2CDU A;  2XLP A;  5FS7 A;  3AWI A;  2WBA A;  2GR1 A;  3ALJ A;  2O9Z A;  3DK4 A;  1L9C A;  2BS2 A;  3CNP A;  4NTD A;  4II2 A;  1NEN A;  1IUX A;  2C65 A;  3BNJ A;  1JNZ A;  5ER0 A;  3UCL A;  4TM0 A;  3LZW A;  3CMM A;  2VQB A;  2YVG A;  4J33 A;  1GOS A;  2J3N A;  3URH A;  3CGC A;  1IUU A;  2GMJ A;  2YR4 A;  2GB0 A;  3UKK A;  1P2H A;  2WPC A;  2XFO A;  3CNJ A;  5J7X A;  2XVE A;  1F8W A;  2OLN A;  2GQF A;  4H4X A;  1L9E A;  2GVC A;  5DBJ A;  1TRB A;  2E4G A;  2V3A A;  3WE0 A;  1PBC A;  1NPX A;  2YG3 A;  5HYM A;  4IA5 A;  1FOH A;  3AE2 A;  2FJA A;  4DGK A;  3PS9 A;  1GTH A;  1KDG A;  2YM1 A;  3DJD A;  4FK1 A;  1K4Q A;  4LII A;  2C70 A;  1O5W A;  1M1R A;  4NTC A;  1PBB A;  4CCQ A;  2DKH A;  1ZMC A;  3SCE A;  1OJA A;  5HXI A;  4JNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...