1KSUA

Crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHYTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c
publication title Role of His505 in the soluble fumarate reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 196
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1ksuA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1ksuA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1ksuA01
3CGDA 3UTFA 2WQYA 3LB8A 5BUKA 3V3OA 2CULA 4DSHA 4BK2A 1O95A 2PHHA 1GERA 4CBQA 1NAAA 1BGJA 2JB2A 2BC0A 3GRTA 1CJ3A 4GUVA 4U2TA 4YSYA 4H2QA 1W4XA 4K5SA 2YR5A 2BCGG 2RGOA 1YKJA 3KD9A 2DKIA 3P4RA 4LU6A 1VG0A 1PS9A 4Z25A 3CNTA 4P9SA 2EQ6A 3SXQA 2XLUA 1TYPA 2JAEA 2R9ZA 1E1KA 3DGHA 4TM4A 2A89A 1X31B 1GU6A 3BNFA 3JSKA 3LZWA 1GETA 3F8DA 4Q17A 3B6DA 1GALA 4J36A 3UKFA 3CN8A 3V76A 4REKA 2X8CA 2GMHA 3QFAA 1GRGA 1OJDA 4EMJA 1PDHA 3GYXA 2EQ9A 2ZZBA 1AOGA 3SGLA 2WDQA 2B7RA 1KNPA 3NK0X 4Q4UA 2Z5XA 1VQWA 1D5TA 4XWZA 2XVEA 3SFDA 4U8OA 2C65A 1DOCA 4EQSA 1JEHA 1SP3A 2K3VA 1GRBA 2JKCA 4EM3A 1BKWA 1ZK7A 4Y4MA 4K8DA 4YSZA 3II4A 5TR3A 1KNRA 3GSIA 3L8KA 3D1CA 5DBJA 4C3XA 2WDRA 4AT2A 3LG1A 3OC4A 2R0GA 1H7XA 1LQTA 4M52A 3PVCA 3FIMB 1PBDA 2YG6A 2YLRA 1GTEA 3H8LA 5FMHA 2C7GA 4UDPA 1B37A 2IVEA 3P4PA 1GPEA 3LADA 5KVIA 1VRQB 2XYOA 4JDRA 2YLTA 4L3ZA 3AECA 4YTPA 3BI4A 4B68A 5EBKA 4X9NA 3AE8A 1Z6LA 2JB3A 4Q0TA 5HXIA 3NLCA 2X50A 4A6NA 2Q6UA 4H4ZA 4JNAA 4H4XA 4WJYA 1EL8A 4JY3A 1RYIA 4OPUA 1GV4A 3G5SA 3VR8A 1XHCA 5L46A 1H83A 1OAHA 3F29A 2VOUA 1BF3A 4KX6A 3NTAA 5HHFA 3SFEA 1M1QA 4OPCA 3UP5A 1E1NA 1DXLA 2XFQA 4BK3A 1GEUA 2GMJA 3AEEA 2BXSA 4H4QA 2JK6A 3L1TA 1CJ2A 2BS3A 2R46A 3BNJA 1PJ6A 1ELIA 3KA7A 1QDBA 3DJEA 3LJPA 4ICYA 1K0LA 4OPIA 1MO9A 3LXDA 4Z26A 4RG4A 2E5VA 2C75A 1E1MA 2X8HA 3MMOA 3LOVA 3M13A 2Q0LA 4Z2RA 1K0JA 1CF3A 3FPZA 1CL0A 2Q0KA 3S61A 5JCIA 1NHQA 2VR0A 1E1LA 4Z44A 3AD8B 1PN0A 1KSUA 4LA1A 4NTEA 4YWOA 2APGA 4H4RA 2XLSA 1JRYA 1QO8A 2C72A 3QSMA 4GDPA 1N4VA 4U8JA 4EIQA 4X4JA 5EOWA 3M12A 3NH3X 1N1PA 1K0IA 1IUWA 4L38A 4U8NA 2XFNA 3S5WA 3BNMA 2C66A 3AE4A 1TYTA 4EQRA 4Z2UA 4J31A 4TLXA 3ABVA 4UDQA 1OJCA 4TM0A 4EQXA 1F8RA 5CKUA 3RP6A 3CGCA 2RDZA 4Z43A 1D4CA 3IHGA 2YLSA 4J56A 2GEWA 3UKLA 2GF3A 3ICRA 4B66A 1PJ7A 3P1WA 1KSSA 1FECA 2AR8A 4DGKA 3BI2A 2V3AA 2NVKX 5FS8A 2C76A 2AAQA 5IQ4A 3QJ4A 2C70A 2OALA 1S3BA 2XVFA 1YQ3A 3G5RA 4AOXA 4D04A 1IUSA 1D7YA 4JNQA 3NYFA 3TORA 5FS7A 2OLOA 1EBDA 2WOWA 1FS9A 5C2TA 1Y0PA 3BNUA 1Y56A 1B4VA 2RABA 1FOHA 4WCTA 1YY5A 3SM8A 3AE7A 3AWIA 4N9XA 3KPFA 4A6NB 2ACZA 5M0ZA 4AOSA 1EL7A 4U8MA 2GV8A 3HZLA 3UTHA 4A99A 4CNJA 2J7AA 1JNRA 3UKKA 2ZBWA 2WDVA 3SCEA 1OJ9A 2A87A 2FJBA 2XVHA 3QFBA 4O5QA 3R9UA 1DJQA 2YLXA 4ADWA 3Q9TA 3ADAB 2J3NA 3C4NA 4USQA 4BK1A 4UDRA 2GAGB 4IVOB 4K2XA 2YG7A 3NT6A 1XDIA 4UP3A 4K22A 1ZMCA 4BJZA 2UZZA 3ZDNA 1LQUA 3COXA 2YAUA 1H6VA 1PBBA 4A79A 4B69A 3AEBA 2ZO5A 1H81A 3AE3A 1DOEA 1F6MA 3VQRA 3GYIA 3QSEA 3NG7X 2Y6RA 3UKPA 1NG3A 1GNDA 1H84A 3DH9A 3NIXA 3OZ2A 2B76A 3BI5A 2QA2A 3GYJA 2BS2A 4CY6A 5J7XA 1B8SA 2R0CA 4BURA 2I0ZA 2YG4A 5M10A 1N4UA 2RGJA 3WE0A 5C3JA 1IUTA 2BA9A 4BV6A 3ICTA 1FEBA 4Q5BA 1NPXA 1FEAA 4Z2TA 2A8XA 2Q7VA 2XCGA 4YKGA 4O5UA 4H50A 1TDKA 2QA1A 5BRTA 4WX1A 3VRBA 5EB5A 2YM1A 2CDUA 5U63A 1CBOA 3AYLA 2E81A 2V60A 4PAAA 1LVLA 3RKHA 2WU2A 2GR1A 3PS9A 3UCLA 2CFYA 1Q1RA 4C74A 4I59A 2XFUA 1M6IA 2ZZCA 4NTCA 3KU9A 1BWCA 4YSHA 2YQUA 5KOWA 3NGCX 1YQ4A 3DK9A 4NEVA 4Y4LA 1PJ5A 2NPXA 4JQ9A 4U2LA 3CPIG 1GESA 4EMWA 4TM3A 2VRMA 4CNKA 3H4KA 4ZCCA 1S2QA 4TM1A 3CGBA 4GRTA 1IUUA 2FJEA 1Q9IA 2BCPA 1GOSA 4U8LA 1E39A 3AE1A 2BK5A 2XDOA 3KKJA 4YTMA 4L3YA 2GQFA 5HYMA 3M0OA 2YM2A 2ARDA 1DNCA 2B9YA 1VG9A 3CPHG 4H7UA 1PBCA 3RP7A 4A5LA 4YSXA 3E1TA 4I58A 3UP4A 2WPFA 2GQWA 3AEDA 3Q6JA 1LJ1A 1EL9A 2RF7A 4IVMB 3ICSA 2AQJA 4J57A 1LPFA 1LV0A 1CHUA 1RSGA 2BS4A 2VQBA 2FJAA 3NHOX 5FS6A 1PHHA 3AD9B 4CCQA 4Q5CA 2B9XA 2TPRA 3S7WA 2WP6A 1D4EA 2H88A 1ZMDA 2CVJA 3GD4A 5HY5A 3AXBA 1XANA 1FT6A 3RHAA 3UTGA 2YG3A 4FX9A 4GF7A 1GREA 3FO3A 1OJAA 2C73A 2QCUA 2VVMA 3LZXA 4H4SA 1P2EA 3UOYA 3EANA 1CC4A 3BHFA 2R4EA 3URHA 1F8WA 3TTBA 4D03A 2WOVA 4DSGA 4YXDA 3EAOA 2VQ7A 1M64A 1TRBA 2EQ7A 3AYIA 2B7SA 3NNEA 1QLBA 3T37A 3O0HA 1DODA 1TDOA 4X9MA 2W0HA 3AE2A 2WETA 1LTXR 2WPCA 1TDNA 1ZP0A 4IA6A 4Y4NA 1GRHA 3GM6A 2YVGA 4CCRA 5KXJA 1REOA 2GR3A 2GRTA 3UU9A 1ONFA 3GMCA 3IWAA 4B64A 2F5ZA 1M1PA 1V59A 4B1BA 4U2SA 2GB0A 1DOBA 3F8RA 2HQMA 2V61A 1M1RA 1GRAA 4APNA 3OWMA 1UKVG 1TDFA 5KWFA 3DJGX 3ALLA 4H4YA 1ZOYA 3K7TA 2YLZA 2C64A 2BABA 4TLZA 4AT0A 5BULA 2GR0A 3UTEA 3QVPA 3P4SA 1IUXA 3DK8A 4BJYA 2WP9A 3NN6X 2JB1A 4H4VA 3GD3A 3B3RA 3AEAA 3NK2X 1FS8A 3CGEA 5GRTA 3K7MX 1FT5A 1OJTA 4H4PA 4J2WA 4OCGA 5JCNA 3ALMA 4GR1A 1GRFA 4H2NA 1L0VA 4GDEA 5LV9A 4C3YA 1JU2A 1BZLA 1KF6A 2XFOA 2FBWA 3D1IA 1NDAA 1B5QA 4OPLA 3VRAA 3KLJA 4C5OA 1NHSA 4JN9A 3RP8A 4A65A 1JNIA 3UBRA 3AE5A 3UKQA 4JY2A 5KVHA 2EQ8A 4H4UA 5IQ1A 1ZKQA 2XLPA 1JOAA 1ZX9A 3FG2P 5KRQA 4RSLA 4OPGA 5U25A 2O9ZA 4DNAA 2X99A 1YQZA 3ATQA 1RP0A 4FK1C 3DGZA 3DA1A 1NHRA 3IHMA 1L9DA 2VVLG 3GRSA 2QAEA 2VVLA 3BNGA 1H82A 1PXAA 4H4WA 4H4TA 5U1OA 2VZ2A 4HA6A 1ZY8A 5ER0A 3G5QA 2WEUA 1NG4A 2TMDA 1PBEA 3UOVA 3VR9A 1L9EA 2GAHB 3CNDA 3FMWA 1COYA 3CPJG 2WHDA 1CC2A 2YG5A 4Z24A 3REDA 3K30A 1MOKA 3BHKA 4Q1OA 3C96A 1E6EA 1N4WA 2JBVA 3NYEA 4NTDA 1O5WA 4RG3A 3VRDB 3UKHA 4B63A 2R4JA 1GXFA 2X8GA 2WBAA 3QVRA 1BVBA 4L3XA 1Q1WA 2B9WA 4H2RA 3V3NA 2E4GA 1EL5A 1D7LA 3CNPA 3NKSA 4A7AA 3CNSA 3EPTA 4FDCB 1IJHA 3D8XA 4EMIA 4OPTA 3ISHA 2XVJA 2GVCA 1FCDA 1GSNA 2OA1A 2E1MA 2WS3A 4CRTA 2OT4A 1GTHA 3NYCA 1GT8A 1P2HA 3NTDA 5JCLA 4K5RA 4PABA 1HYUA 3H8IA 2GR2A 4B67A 1NEKA 5FS9A 2RGHA 2X3NA 1SEZA 2Y6QA 2C3DA 3DJJA 3I6DA 2BYBA 3GMBA 2FJDA 3DMEA 2R0PA 2BC1A 4MJWA 1L9CA 1PBFA 2YR6A 1GRTA 3NRNA 4YTNA 2YVJA 4LIIA 2V6OA 2Z5YA 3UOZA 3BNHA 1Y56B 1NHPA 2ZZ0A 3K7QX 4NEWA 3PO7A 4USRA 2BK4A 2XFPA 2XLRA 1F8SA 2XVIA 3EF6A 3P9UA 5JCKA 4C77A 4K7ZA 4KPRA 1F3PA 4IV9A 4EIPA 1VDCA 2YVFA 3ATRA 1H7WA 3AB1A 1FS7A 2LFCA 3QSSA 4U8KA 5JCMA 1D4DA 1FL2A 1ZOVA 3AYJA 3GWDA 3CNJA 3AE9A 2E80A 2BACA 2GH5A 4AP3A 4ECHA 4AP1A 2IVDA 3LGQA 2V3BA 2WPEA 1O94A 1H86A 1XPQA 4XXGA 1S3EA 4H2PA 4U8PA 3F8PA 5J60A 3SQPA 3CIRA 3P4QA 2BK3A 1NENA 3GWFA 4NZHA 3AD7B 1QJDA 1BGNA 1ZDLA 2YWLA 3C4AA 2IIDA 1KDGA 2WOIA 3AEFA 3DJDA 2OAMA 3NK1X 4GCMA 2H89A 3RNMA 4B65A 2DKHA 3IC9A 1JNZA 4HB9A 1CJ4A 5BVAA 4IA5A 4XWRA 3GDPA 3L1RA 3UKAA 5CQFA 3AE6A 3AEGA 4E0VA 1MXTA 4OPDA 1IUVA 2VRLA 3ALJA 3CTYA 1TDEA 2C67A 3GDNA 4U8IA 5EB4A 3DK4A 3FBSA 2WP5A 3ZYXA 4CY8A 4EQWA 1CC6A 2YLWA 4EM4A 1S2YA 4FK1A 5KOXA 2WU5A 5GSNA 4ZN0A 4OVIA 4J34A 4ZCDA 1JRXA 3UOXA 1CJCA 2C3CA 2V5ZA 3IF9A 1DJNA 2YR4A 5IPYA 4YKFA 3KVEA 4A9WA 4YT0A 2BXRA 1PXCA 2XLTA 1E7PA 2OLNA 2WESA 4J33A 1KFYA 2R45A 3I3LA 3NN0X 1K4QA 1JRZA 3ITJA 1PXBA 2PYXA
chains in the Genus database with same CATH superfamily
3CGDA 5KMRA 3UTFA 2WQYA 4NWZA 3LB8A 5BUKA 3V3OA 2CULA 4DSHA 4BK2A 1O95A 2PHHA 1GERA 4CBQA 1NAAA 1BGJA 2JB2A 2BC0A 3GRTA 1CJ3A 4GUVA 4U2TA 4YSYA 4H2QA 1W4XA 4K5SA 2YR5A 2BCGG 2RGOA 1YKJA 3KD9A 2DKIA 3P4RA 4LU6A 1VG0A 1PS9A 4Z25A 3CNTA 4P9SA 3HYXA 2EQ6A 3SXQA 2XLUA 1TYPA 2JAEA 2R9ZA 1E1KA 3DGHA 4TM4A 2A89A 1X31B 1GU6A 3BNFA 3JSKA 3LZWA 4G6HA 5KMPA 1GETA 3F8DA 4Q17A 3B6DA 1GALA 4J36A 3UKFA 3CN8A 3V76A 4REKA 2X8CA 2GMHA 3QFAA 1GRGA 1OJDA 2BRAA 4EMJA 1PDHA 3GYXA 2EQ9A 2ZZBA 1AOGA 3SGLA 2WDQA 2B7RA 1KNPA 3NK0X 4Q4UA 2Z5XA 1VQWA 1D5TA 4XWZA 2XVEA 3SFDA 4U8OA 2C65A 1DOCA 3HYWA 4EQSA 4G9KA 1JEHA 1SP3A 2K3VA 1GRBA 2JKCA 4NNJA 1BKWA 4EM3A 1ZK7A 4Y4MA 4K8DA 4YSZA 3II4A 5TR3A 1KNRA 3GSIA 3L8KA 3D1CA 5DBJA 4C3XA 2WDRA 4AT2A 3LG1A 3OC4A 2R0GA 1H7XA 1LQTA 4M52A 3PVCA 3FIMB 1PBDA 2YG6A 2YLRA 1GTEA 3H8LA 5FMHA 2C7GA 4UDPA 1B37A 2IVEA 3P4PA 1GPEA 3LADA 5KVIA 1VRQB 2XYOA 4JDRA 4II3A 2YLTA 4L3ZA 3AECA 4GAPA 4YTPA 3BI4A 3KPKA 4B68A 5EBKA 4X9NA 3AE8A 1Z6LA 2JB3A 4Q0TA 5HXIA 3NLCA 2X50A 4A6NA 2Q6UA 4H4ZA 4JNAA 3CMMA 4H4XA 4WJYA 1EL8A 4JY3A 1RYIA 4OPUA 1GV4A 3G5SA 3VR8A 1XHCA 5L46A 1H83A 1OAHA 3F29A 2VOUA 1BF3A 4KX6A 3NTAA 5HHFA 3SFEA 3T31A 1M1QA 4OPCA 3UP5A 1E1NA 1DXLA 2XFQA 4BK3A 1GEUA 2GMJA 3AEEA 2BXSA 4H4QA 2JK6A 3L1TA 1CJ2A 2BS3A 2R46A 3BNJA 1PJ6A 1ELIA 3KA7A 1QDBA 3DJEA 3LJPA 4ICYA 1K0LA 4OPIA 1MO9A 3LXDA 4Z26A 4RG4A 2E5VA 2C75A 1E1MA 2X8HA 3MMOA 3LOVA 3M13A 2Q0LA 4Z2RA 1K0JA 1CF3A 3FPZA 1CL0A 2Q0KA 3S61A 5JCIA 1NHQA 2VR0A 1E1LA 4Z44A 3AD8B 1PN0A 1KSUA 4LA1A 4NTEA 4YWOA 2APGA 4H4RA 2XLSA 1JRYA 1QO8A 2C72A 3QSMA 4GDPA 1N4VA 4U8JA 3RNMA 4EIQA 4X4JA 5EOWA 2C4CA 3M12A 3NH3X 1N1PA 1K0IA 1IUWA 4L38A 4U8NA 2XFNA 3S5WA 3BNMA 2C66A 3AE4A 1TYTA 4EQRA 4Z2UA 4J31A 4TLXA 3ABVA 4UDQA 1OJCA 4TM0A 4EQXA 1F8RA 5CKUA 3RP6A 3CGCA 2RDZA 4Z43A 1D4CA 3IHGA 2YLSA 4J56A 2GEWA 3UKLA 2GF3A 3ICRA 4B66A 1PJ7A 3P1WA 1KSSA 1FECA 2AR8A 4DGKA 3BI2A 2V3AA 2NVKX 5FS8A 2C76A 2AAQA 5IQ4A 3QJ4A 2C70A 2OALA 1S3BA 2XVFA 1YQ3A 3G5RA 3SXIA 4AOXA 4D04A 1IUSA 1D7YA 4JNQA 3NYFA 3TORA 5FS7A 2OLOA 1EBDA 2WOWA 1FS9A 5C2TA 1Y0PA 3BNUA 1Y56A 1B4VA 2RABA 1FOHA 4WCTA 1YY5A 3SM8A 3AE7A 3AWIA 4N9XA 3KPFA 4A6NB 2ACZA 5M0ZA 4AOSA 1EL7A 4U8MA 2GV8A 3HZLA 3UTHA 4A99A 4CNJA 2J7AA 1JNRA 3UKKA 2ZBWA 2WDVA 3SCEA 1OJ9A 2A87A 2FJBA 2XVHA 3QFBA 4O5QA 3R9UA 1DJQA 2YLXA 4ADWA 3Q9TA 3ADAB 2J3NA 3C4NA 4USQA 4BK1A 4UDRA 2GAGB 4IVOB 3SYIA 4K2XA 2YG7A 3NT6A 1XDIA 4UP3A 4K22A 1ZMCA 4BJZA 2UZZA 3ZDNA 1LQUA 3COXA 2YAUA 1H6VA 1PBBA 4A79A 4B69A 3AEBA 4II2A 2ZO5A 1H81A 3AE3A 1DOEA 1F6MA 3VQRA 3GYIA 3QSEA 3NG7X 2Y6RA 3UKPA 1NG3A 1GNDA 1H84A 3DH9A 3NIXA 3OZ2A 2B76A 3BI5A 2QA2A 3GYJA 2BS2A 4CY6A 5J7XA 1B8SA 2R0CA 4BURA 2I0ZA 2YG4A 5M10A 1N4UA 2RGJA 3WE0A 5C3JA 1IUTA 2BA9A 4BV6A 3ICTA 1FEBA 4Q5BA 1NPXA 1FEAA 4Z2TA 2A8XA 2Q7VA 2XCGA 4YKGA 4O5UA 4H50A 1TDKA 2QA1A 5BRTA 4WX1A 3VRBA 5EB5A 2YM1A 2CDUA 5U63A 1CBOA 3AYLA 2E81A 2V60A 4PAAA 1LVLA 3RKHA 2WU2A 2GR1A 3PS9A 3UCLA 2CFYA 1Q1RA 3T2ZA 4I59A 2XFUA 1M6IA 2ZZCA 4NTCA 3KU9A 1BWCA 4YSHA 2YQUA 5KOWA 3NGCX 1YQ4A 3DK9A 4NEVA 4Y4LA 1PJ5A 2NPXA 4JQ9A 4U2LA 3CPIG 1GESA 4EMWA 4TM3A 2VRMA 4CNKA 3H4KA 4ZCCA 1S2QA 4TM1A 3CGBA 4GRTA 1IUUA 2FJEA 1Q9IA 2BCPA 1GOSA 4U8LA 1E39A 3AE1A 2BK5A 2XDOA 3KKJA 4YTMA 4L3YA 2GQFA 5HYMA 3M0OA 2YM2A 2ARDA 1DNCA 2B9YA 1VG9A 3CPHG 4H7UA 1PBCA 3RP7A 4A5LA 4YSXA 3E1TA 4I58A 3UP4A 2WPFA 2GQWA 3AEDA 3Q6JA 1LJ1A 1EL9A 2RF7A 4IVMB 3ICSA 2AQJA 4J57A 1LPFA 1LV0A 1CHUA 1RSGA 2BS4A 2VQBA 2FJAA 3SZCA 3NHOX 5FS6A 1PHHA 3AD9B 4CCQA 4Q5CA 2B9XA 2TPRA 3S7WA 2WP6A 1D4EA 2H88A 3SZ0A 1ZMDA 2CVJA 3GD4A 5HY5A 3AXBA 1XANA 1FT6A 3RHAA 3UTGA 2YG3A 4FX9A 4GF7A 1GREA 3FO3A 1OJAA 2C73A 2QCUA 2VVMA 3LZXA 4H4SA 1P2EA 3T2YA 3EANA 1CC4A 3BHFA 2R4EA 3URHA 3UOYA 1F8WA 3TTBA 4D03A 2WOVA 4DSGA 4YXDA 3EAOA 2VQ7A 1M64A 1TRBA 2EQ7A 3AYIA 2B7SA 3NNEA 1QLBA 3T37A 3O0HA 1DODA 1TDOA 4X9MA 2W0HA 3AE2A 2WETA 1LTXR 2WPCA 1TDNA 1ZP0A 4IA6A 4Y4NA 1GRHA 3GM6A 2YVGA 4CCRA 5KXJA 1REOA 2GR3A 2GRTA 3UU9A 1ONFA 3GMCA 3HYVA 3IWAA 2F5ZA 1M1PA 1V59A 4B64A 4B1BA 4U2SA 2GB0A 1DOBA 3F8RA 2HQMA 2V61A 1M1RA 1GRAA 4APNA 3OWMA 1UKVG 1TDFA 5KWFA 3DJGX 3ALLA 4H4YA 1ZOYA 3K7TA 2YLZA 2C64A 2BABA 4TLZA 4AT0A 5BULA 2GR0A 3UTEA 3QVPA 3P4SA 1IUXA 4G73A 3DK8A 4BJYA 2WP9A 3NN6X 2JB1A 4H4VA 3GD3A 3B3RA 3AEAA 3NK2X 1FS8A 3CGEA 5GRTA 3K7MX 1FT5A 1OJTA 4H4PA 4J2WA 4OCGA 5JCNA 3ALMA 4GR1A 1GRFA 4H2NA 1L0VA 4GDEA 5LV9A 4C3YA 1JU2A 1BZLA 1KF6A 2XFOA 2FBWA 3D1IA 1NDAA 1B5QA 4OPLA 3VRAA 3KLJA 4C5OA 5KMQA 1NHSA 4JN9A 3RP8A 4A65A 1JNIA 3UBRA 3AE5A 3UKQA 4JY2A 5KVHA 4G6GA 2EQ8A 4H4UA 5IQ1A 1ZKQA 2XLPA 1JOAA 1ZX9A 3FG2P 5KRQA 4RSLA 4OPGA 5U25A 2O9ZA 3T0KA 4DNAA 2X99A 1YQZA 3ATQA 1RP0A 4FK1C 5KMSA 3DGZA 3DA1A 1NHRA 3IHMA 1L9DA 2VVLG 3GRSA 2QAEA 2VVLA 3BNGA 1H82A 1PXAA 4H4WA 4H4TA 5U1OA 3SZWA 2VZ2A 4HA6A 1ZY8A 5ER0A 3G5QA 2WEUA 1NG4A 2TMDA 1PBEA 3UOVA 3VR9A 1L9EA 2GAHB 3CNDA 3FMWA 1COYA 3CPJG 2WHDA 1CC2A 2YG5A 4Z24A 3REDA 3K30A 1MOKA 3BHKA 4Q1OA 3C96A 1E6EA 1N4WA 2JBVA 3NYEA 4NTDA 1O5WA 4RG3A 3VRDB 3UKHA 4B63A 2R4JA 1GXFA 2X8GA 2WBAA 3QVRA 1BVBA 4L3XA 1Q1WA 2B9WA 4H2RA 3V3NA 2E4GA 1EL5A 1D7LA 3CNPA 3NKSA 4A7AA 3CNSA 3EPTA 4FDCB 1IJHA 3D8XA 4EMIA 4OPTA 3ISHA 2XVJA 2GVCA 1FCDA 1GSNA 2OA1A 2E1MA 3SY4A 2WS3A 3T2KA 2OT4A 4CRTA 1GTHA 4C74A 3NYCA 1GT8A 1P2HA 3NTDA 5JCLA 4K5RA 4PABA 2CZSA 1HYUA 3H8IA 2GR2A 3T14A 1NEKA 5FS9A 2RGHA 4B67A 2X3NA 1SEZA 2Y6QA 2C3DA 3DJJA 3I6DA 2BYBA 3GMBA 2FJDA 3DMEA 2R0PA 2BC1A 4MJWA 1L9CA 1PBFA 2YR6A 1GRTA 3NRNA 4YTNA 2YVJA 4LIIA 2V6OA 2Z5YA 3UOZA 5KNLA 3BNHA 1Y56B 1NHPA 2ZZ0A 3K7QX 4NEWA 3PO7A 4USRA 2BK4A 2XFPA 2XLRA 1F8SA 2XVIA 3EF6A 3P9UA 5JCKA 4C77A 4K7ZA 4KPRA 1F3PA 4IV9A 4EIPA 1VDCA 2YVFA 3ATRA 1H7WA 3AB1A 1FS7A 2LFCA 3QSSA 4U8KA 5JCMA 1D4DA 1FL2A 1ZOVA 3AYJA 3GWDA 3CNJA 3AE9A 2E80A 2BACA 2GH5A 4AP3A 4ECHA 4AP1A 2IVDA 3LGQA 2V3BA 2WPEA 1O94A 1H86A 1XPQA 4XXGA 1S3EA 4H2PA 4U8PA 3F8PA 5J60A 3SQPA 3CIRA 3P4QA 2BK3A 1NENA 3GWFA 4NZHA 3AD7B 1QJDA 1BGNA 1ZDLA 2YWLA 3C4AA 2IIDA 1KDGA 2WOIA 3AEFA 3DJDA 2OAMA 3NK1X 4GCMA 2H89A 4G74A 4B65A 2DKHA 3IC9A 1JNZA 4HB9A 1CJ4A 5BVAA 4IA5A 4XWRA 3GDPA 3L1RA 3UKAA 5CQFA 3AE6A 3AEGA 4E0VA 1MXTA 4OPDA 1IUVA 2VRLA 3ALJA 3SZFA 3CTYA 1TDEA 2C67A 3GDNA 4U8IA 5EB4A 3DK4A 3FBSA 2WP5A 3ZYXA 4CY8A 4EQWA 1CC6A 2YLWA 4EM4A 1S2YA 4FK1A 5KOXA 2WU5A 5GSNA 4ZN0A 4OVIA 4J34A 4ZCDA 1JRXA 3UOXA 1CJCA 2C3CA 2V5ZA 3IF9A 1DJNA 2YR4A 4GAVA 5IPYA 4YKFA 3KVEA 4A9WA 4YT0A 2BXRA 1PXCA 2XLTA 3SX6A 2BRYA 1E7PA 2OLNA 2WESA 4J33A 1KFYA 2R45A 3I3LA 3NN0X 1K4QA 1JRZA 3ITJA 1PXBA 2PYXA
chains in the Genus database with same CATH topology
3CGDA 5KMRA 3UTFA 2WQYA 4NWZA 3LB8A 5BUKA 3V3OA 2CULA 4DSHA 4BK2A 1O95A 2PHHA 1GERA 4CBQA 1NAAA 1BGJA 2JB2A 2BC0A 3GRTA 1CJ3A 4GUVA 4U2TA 4YSYA 4H2QA 1W4XA 4K5SA 2YR5A 2BCGG 2RGOA 1YKJA 3KD9A 2DKIA 3P4RA 4LU6A 1VG0A 1PS9A 4Z25A 3CNTA 4P9SA 3HYXA 2EQ6A 3SXQA 2XLUA 1TYPA 2JAEA 2R9ZA 1E1KA 3DGHA 4TM4A 2A89A 1X31B 1GU6A 3BNFA 3JSKA 3LZWA 4G6HA 5KMPA 1GETA 3F8DA 4Q17A 3B6DA 1GALA 4J36A 3UKFA 3CN8A 3V76A 4REKA 2X8CA 2GMHA 3QFAA 1GRGA 1OJDA 2BRAA 4EMJA 1PDHA 3GYXA 2EQ9A 2ZZBA 1AOGA 3SGLA 2WDQA 2B7RA 1KNPA 3NK0X 4Q4UA 2Z5XA 1VQWA 1D5TA 4XWZA 2XVEA 3SFDA 4U8OA 2C65A 1DOCA 3HYWA 4EQSA 4G9KA 1JEHA 1SP3A 2K3VA 1GRBA 2JKCA 4NNJA 1BKWA 4EM3A 1ZK7A 4Y4MA 4K8DA 4YSZA 3II4A 5TR3A 1KNRA 3GSIA 3L8KA 3D1CA 5DBJA 4C3XA 2WDRA 4AT2A 3LG1A 3OC4A 2R0GA 1H7XA 1LQTA 4M52A 3PVCA 3FIMB 1PBDA 2YG6A 2YLRA 1GTEA 3H8LA 5FMHA 2C7GA 4UDPA 1B37A 2IVEA 3P4PA 1GPEA 3LADA 5KVIA 1VRQB 2XYOA 4JDRA 4II3A 2YLTA 4L3ZA 3AECA 4GAPA 4YTPA 3BI4A 3KPKA 4B68A 5EBKA 4X9NA 3AE8A 1Z6LA 2JB3A 4Q0TA 5HXIA 3NLCA 2X50A 4A6NA 2Q6UA 4H4ZA 4JNAA 3CMMA 4H4XA 4WJYA 1EL8A 4JY3A 1RYIA 4OPUA 1GV4A 3G5SA 3VR8A 1XHCA 5L46A 1H83A 1OAHA 3F29A 2VOUA 1BF3A 4KX6A 3NTAA 5HHFA 3SFEA 3T31A 1M1QA 4OPCA 3UP5A 1E1NA 1DXLA 2XFQA 4BK3A 1GEUA 2GMJA 3AEEA 2BXSA 4H4QA 2JK6A 3L1TA 1CJ2A 2BS3A 2R46A 3BNJA 1PJ6A 1ELIA 3KA7A 1QDBA 3DJEA 3LJPA 4ICYA 1K0LA 4OPIA 1MO9A 3LXDA 4Z26A 4RG4A 2E5VA 2C75A 1E1MA 2X8HA 3MMOA 3LOVA 3M13A 2Q0LA 4Z2RA 1K0JA 1CF3A 3FPZA 1CL0A 2Q0KA 3S61A 5JCIA 1NHQA 2VR0A 1E1LA 4Z44A 3AD8B 1PN0A 1KSUA 4LA1A 4NTEA 4YWOA 2APGA 4H4RA 2XLSA 1JRYA 1QO8A 2C72A 3QSMA 4GDPA 1N4VA 4U8JA 3RNMA 4EIQA 4X4JA 5EOWA 2C4CA 3M12A 3NH3X 1N1PA 1K0IA 1IUWA 4L38A 4U8NA 2XFNA 3S5WA 3BNMA 2C66A 3AE4A 1TYTA 4EQRA 4Z2UA 4J31A 4TLXA 3ABVA 4UDQA 1OJCA 4TM0A 4EQXA 1F8RA 5CKUA 3RP6A 3CGCA 2RDZA 4Z43A 1D4CA 3IHGA 2YLSA 4J56A 2GEWA 3UKLA 2GF3A 3ICRA 4B66A 1PJ7A 3P1WA 1KSSA 1FECA 2AR8A 4DGKA 3BI2A 2V3AA 2NVKX 5FS8A 2C76A 2AAQA 5IQ4A 3QJ4A 2C70A 2OALA 1S3BA 2XVFA 1YQ3A 3G5RA 3SXIA 4AOXA 4D04A 1IUSA 1D7YA 4JNQA 3NYFA 3TORA 5FS7A 2OLOA 1EBDA 2WOWA 1FS9A 5C2TA 1Y0PA 3BNUA 1Y56A 1B4VA 2RABA 1FOHA 4WCTA 1YY5A 3SM8A 3AE7A 3AWIA 4N9XA 3KPFA 4A6NB 2ACZA 5M0ZA 4AOSA 1EL7A 4U8MA 2GV8A 3HZLA 3UTHA 4A99A 4CNJA 2J7AA 1JNRA 3UKKA 2ZBWA 2WDVA 3SCEA 1OJ9A 2A87A 2FJBA 2XVHA 3QFBA 4O5QA 3R9UA 1DJQA 2YLXA 4ADWA 3Q9TA 3ADAB 2J3NA 3C4NA 4USQA 4BK1A 4UDRA 2GAGB 4IVOB 3SYIA 4K2XA 2YG7A 3NT6A 1XDIA 4UP3A 4K22A 1ZMCA 4BJZA 2UZZA 3ZDNA 1LQUA 3COXA 2YAUA 1H6VA 1PBBA 4A79A 4B69A 3AEBA 4II2A 2ZO5A 1H81A 3AE3A 1DOEA 1F6MA 3VQRA 3GYIA 3QSEA 3NG7X 2Y6RA 3UKPA 1NG3A 1GNDA 1H84A 3DH9A 3NIXA 3OZ2A 2B76A 3BI5A 2QA2A 3GYJA 2BS2A 4CY6A 5J7XA 1B8SA 2R0CA 4BURA 2I0ZA 2YG4A 5M10A 1N4UA 2RGJA 3WE0A 5C3JA 1IUTA 2BA9A 4BV6A 3ICTA 1FEBA 4Q5BA 1NPXA 1FEAA 4Z2TA 2A8XA 2Q7VA 2XCGA 4YKGA 4O5UA 4H50A 1TDKA 2QA1A 5BRTA 4WX1A 3VRBA 5EB5A 2YM1A 2CDUA 5U63A 1CBOA 3AYLA 2E81A 2V60A 4PAAA 1LVLA 3RKHA 2WU2A 2GR1A 3PS9A 3UCLA 2CFYA 1Q1RA 3T2ZA 4I59A 2XFUA 1M6IA 2ZZCA 4NTCA 3KU9A 1BWCA 4YSHA 2YQUA 5KOWA 3NGCX 1YQ4A 3DK9A 4NEVA 4Y4LA 1PJ5A 2NPXA 4JQ9A 4U2LA 3CPIG 1GESA 4EMWA 4TM3A 2VRMA 4CNKA 3H4KA 4ZCCA 1S2QA 4TM1A 3CGBA 4GRTA 1IUUA 2FJEA 1Q9IA 2BCPA 1GOSA 4U8LA 1E39A 3AE1A 2BK5A 2XDOA 3KKJA 4YTMA 4L3YA 2GQFA 5HYMA 3M0OA 2YM2A 2ARDA 1DNCA 2B9YA 1VG9A 3CPHG 4H7UA 1PBCA 3RP7A 4A5LA 4YSXA 3E1TA 4I58A 3UP4A 2WPFA 2GQWA 3AEDA 3Q6JA 1LJ1A 1EL9A 2RF7A 4IVMB 3ICSA 2AQJA 4J57A 1LPFA 1LV0A 1CHUA 1RSGA 2BS4A 2VQBA 2FJAA 3SZCA 3NHOX 5FS6A 1PHHA 3AD9B 4CCQA 4Q5CA 2B9XA 2TPRA 3S7WA 2WP6A 1D4EA 2H88A 3SZ0A 1ZMDA 2CVJA 3GD4A 5HY5A 3AXBA 1XANA 1FT6A 3RHAA 3UTGA 2YG3A 4FX9A 4GF7A 1GREA 3FO3A 1OJAA 2C73A 2QCUA 2VVMA 3LZXA 4H4SA 1P2EA 3T2YA 3EANA 1CC4A 3BHFA 2R4EA 3URHA 3UOYA 1F8WA 3TTBA 4D03A 2WOVA 4DSGA 4YXDA 3EAOA 2VQ7A 1M64A 1TRBA 2EQ7A 3AYIA 2B7SA 3NNEA 1QLBA 3T37A 3O0HA 1DODA 1TDOA 4X9MA 2W0HA 3AE2A 2WETA 1LTXR 2WPCA 1TDNA 1ZP0A 4IA6A 4Y4NA 1GRHA 3GM6A 2YVGA 4CCRA 5KXJA 1REOA 2GR3A 2GRTA 3UU9A 1ONFA 3GMCA 3HYVA 3IWAA 2F5ZA 1M1PA 1V59A 4B64A 4B1BA 4U2SA 2GB0A 1DOBA 3F8RA 2HQMA 2V61A 1M1RA 1GRAA 4APNA 3OWMA 1UKVG 1TDFA 5KWFA 3DJGX 3ALLA 4H4YA 1ZOYA 3K7TA 2YLZA 2C64A 2BABA 4TLZA 4AT0A 5BULA 2GR0A 3UTEA 3QVPA 3P4SA 1IUXA 4G73A 3DK8A 4BJYA 2WP9A 3NN6X 2JB1A 4H4VA 3GD3A 3B3RA 3AEAA 3NK2X 1FS8A 3CGEA 5GRTA 3K7MX 1FT5A 1OJTA 4H4PA 4J2WA 4OCGA 5JCNA 3ALMA 4GR1A 1GRFA 4H2NA 1L0VA 4GDEA 5LV9A 4C3YA 1JU2A 1BZLA 1KF6A 2XFOA 2FBWA 3D1IA 1NDAA 1B5QA 4OPLA 3VRAA 3KLJA 4C5OA 5KMQA 1NHSA 4JN9A 3RP8A 4A65A 1JNIA 3UBRA 3AE5A 3UKQA 4JY2A 5KVHA 4G6GA 2EQ8A 4H4UA 5IQ1A 1ZKQA 2XLPA 1JOAA 1ZX9A 3FG2P 5KRQA 4RSLA 4OPGA 5U25A 2O9ZA 3T0KA 4DNAA 2X99A 1YQZA 3ATQA 1RP0A 4FK1C 5KMSA 3DGZA 3DA1A 1NHRA 3IHMA 1L9DA 2VVLG 3GRSA 2QAEA 2VVLA 3BNGA 1H82A 1PXAA 4H4WA 4H4TA 5U1OA 3SZWA 2VZ2A 4HA6A 1ZY8A 5ER0A 3G5QA 2WEUA 1NG4A 2TMDA 1PBEA 3UOVA 3VR9A 1L9EA 2GAHB 3CNDA 3FMWA 1COYA 3CPJG 2WHDA 1CC2A 2YG5A 4Z24A 3REDA 3K30A 1MOKA 3BHKA 4Q1OA 3C96A 1E6EA 1N4WA 2JBVA 3NYEA 4NTDA 1O5WA 4RG3A 3VRDB 3UKHA 4B63A 2R4JA 1GXFA 2X8GA 2WBAA 3QVRA 1BVBA 4L3XA 1Q1WA 2B9WA 4H2RA 3V3NA 2E4GA 1EL5A 1D7LA 3CNPA 3NKSA 4A7AA 3CNSA 3EPTA 4FDCB 1IJHA 3D8XA 4EMIA 4OPTA 3ISHA 2XVJA 2GVCA 1FCDA 1GSNA 2OA1A 2E1MA 3SY4A 2WS3A 3T2KA 2OT4A 4CRTA 1GTHA 4C74A 3NYCA 1GT8A 1P2HA 3NTDA 5JCLA 4K5RA 4PABA 1HYUA 3H8IA 2GR2A 3T14A 1NEKA 5FS9A 2RGHA 4B67A 2X3NA 1SEZA 2Y6QA 2C3DA 3DJJA 3I6DA 2BYBA 3GMBA 2FJDA 3DMEA 2R0PA 2BC1A 4MJWA 1L9CA 1PBFA 2YR6A 1GRTA 3NRNA 4YTNA 2YVJA 4LIIA 2V6OA 2Z5YA 3UOZA 5KNLA 3BNHA 1Y56B 1NHPA 2ZZ0A 3K7QX 4NEWA 3PO7A 4USRA 2BK4A 2XFPA 2XLRA 1F8SA 2XVIA 3EF6A 3P9UA 5JCKA 4C77A 4K7ZA 4KPRA 1F3PA 4IV9A 4EIPA 1VDCA 2YVFA 3ATRA 1H7WA 3AB1A 1FS7A 2LFCA 3QSSA 4U8KA 5JCMA 1D4DA 1FL2A 1ZOVA 3AYJA 3GWDA 3CNJA 3AE9A 2E80A 2BACA 2GH5A 4AP3A 4ECHA 4AP1A 2IVDA 3LGQA 2V3BA 2WPEA 1O94A 1H86A 1XPQA 4XXGA 1S3EA 4H2PA 4U8PA 3F8PA 5J60A 3SQPA 3CIRA 3P4QA 2BK3A 1NENA 3GWFA 4NZHA 3AD7B 1QJDA 1BGNA 1ZDLA 2YWLA 3C4AA 2IIDA 1KDGA 2WOIA 3AEFA 3DJDA 2OAMA 3NK1X 4GCMA 2H89A 4G74A 4B65A 2DKHA 3IC9A 1JNZA 4HB9A 1CJ4A 5BVAA 4IA5A 4XWRA 3GDPA 3L1RA 3UKAA 5CQFA 3AE6A 3AEGA 4E0VA 1MXTA 4OPDA 1IUVA 2VRLA 3ALJA 3SZFA 3CTYA 1TDEA 2C67A 3GDNA 4U8IA 5EB4A 3DK4A 3FBSA 2WP5A 3ZYXA 4CY8A 4EQWA 1CC6A 2YLWA 4EM4A 1S2YA 4FK1A 5KOXA 2WU5A 5GSNA 4ZN0A 4OVIA 4J34A 4ZCDA 1JRXA 3UOXA 1CJCA 2C3CA 2V5ZA 3IF9A 1DJNA 2YR4A 4GAVA 5IPYA 4YKFA 3KVEA 4A9WA 4YT0A 2BXRA 1PXCA 2XLTA 3SX6A 2BRYA 1E7PA 2OLNA 2WESA 4J33A 1KFYA 2R45A 3I3LA 3NN0X 1K4QA 1JRZA 3ITJA 1PXBA 2PYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGD A;  3UTF A;  2WQY A;  3LB8 A;  5BUK A;  3V3O A;  2CUL A;  4DSH A;  4BK2 A;  1O95 A;  2PHH A;  1GER A;  4CBQ A;  1NAA A;  1BGJ A;  2JB2 A;  2BC0 A;  3GRT A;  1CJ3 A;  4GUV A;  4U2T A;  4YSY A;  4H2Q A;  1W4X A;  4K5S A;  2YR5 A;  2BCG G;  2RGO A;  1YKJ A;  3KD9 A;  2DKI A;  3P4R A;  4LU6 A;  1VG0 A;  1PS9 A;  4Z25 A;  3CNT A;  4P9S A;  2EQ6 A;  3SXQ A;  2XLU A;  1TYP A;  2JAE A;  2R9Z A;  1E1K A;  3DGH A;  4TM4 A;  2A89 A;  1X31 B;  1GU6 A;  3BNF A;  3JSK A;  3LZW A;  1GET A;  3F8D A;  4Q17 A;  3B6D A;  1GAL A;  4J36 A;  3UKF A;  3CN8 A;  3V76 A;  4REK A;  2X8C A;  2GMH A;  3QFA A;  1GRG A;  1OJD A;  4EMJ A;  1PDH A;  3GYX A;  2EQ9 A;  2ZZB A;  1AOG A;  3SGL A;  2WDQ A;  2B7R A;  1KNP A;  3NK0 X;  4Q4U A;  2Z5X A;  1VQW A;  1D5T A;  4XWZ A;  2XVE A;  3SFD A;  4U8O A;  2C65 A;  1DOC A;  4EQS A;  1JEH A;  1SP3 A;  2K3V A;  1GRB A;  2JKC A;  4EM3 A;  1BKW A;  1ZK7 A;  4Y4M A;  4K8D A;  4YSZ A;  3II4 A;  5TR3 A;  1KNR A;  3GSI A;  3L8K A;  3D1C A;  5DBJ A;  4C3X A;  2WDR A;  4AT2 A;  3LG1 A;  3OC4 A;  2R0G A;  1H7X A;  1LQT A;  4M52 A;  3PVC A;  3FIM B;  1PBD A;  2YG6 A;  2YLR A;  1GTE A;  3H8L A;  5FMH A;  2C7G A;  4UDP A;  1B37 A;  2IVE A;  3P4P A;  1GPE A;  3LAD A;  5KVI A;  1VRQ B;  2XYO A;  4JDR A;  2YLT A;  4L3Z A;  3AEC A;  4YTP A;  3BI4 A;  4B68 A;  5EBK A;  4X9N A;  3AE8 A;  1Z6L A;  2JB3 A;  4Q0T A;  5HXI A;  3NLC A;  2X50 A;  4A6N A;  2Q6U A;  4H4Z A;  4JNA A;  4H4X A;  4WJY A;  1EL8 A;  4JY3 A;  1RYI A;  4OPU A;  1GV4 A;  3G5S A;  3VR8 A;  1XHC A;  5L46 A;  1H83 A;  1OAH A;  3F29 A;  2VOU A;  1BF3 A;  4KX6 A;  3NTA A;  5HHF A;  3SFE A;  1M1Q A;  4OPC A;  3UP5 A;  1E1N A;  1DXL A;  2XFQ A;  4BK3 A;  1GEU A;  2GMJ A;  3AEE A;  2BXS A;  4H4Q A;  2JK6 A;  3L1T A;  1CJ2 A;  2BS3 A;  2R46 A;  3BNJ A;  1PJ6 A;  1ELI A;  3KA7 A;  1QDB A;  3DJE A;  3LJP A;  4ICY A;  1K0L A;  4OPI A;  1MO9 A;  3LXD A;  4Z26 A;  4RG4 A;  2E5V A;  2C75 A;  1E1M A;  2X8H A;  3MMO A;  3LOV A;  3M13 A;  2Q0L A;  4Z2R A;  1K0J A;  1CF3 A;  3FPZ A;  1CL0 A;  2Q0K A;  3S61 A;  5JCI A;  1NHQ A;  2VR0 A;  1E1L A;  4Z44 A;  3AD8 B;  1PN0 A;  1KSU A;  4LA1 A;  4NTE A;  4YWO A;  2APG A;  4H4R A;  2XLS A;  1JRY A;  1QO8 A;  2C72 A;  3QSM A;  4GDP A;  1N4V A;  4U8J A;  4EIQ A;  4X4J A;  5EOW A;  3M12 A;  3NH3 X;  1N1P A;  1K0I A;  1IUW A;  4L38 A;  4U8N A;  2XFN A;  3S5W A;  3BNM A;  2C66 A;  3AE4 A;  1TYT A;  4EQR A;  4Z2U A;  4J31 A;  4TLX A;  3ABV A;  4UDQ A;  1OJC A;  4TM0 A;  4EQX A;  1F8R A;  5CKU A;  3RP6 A;  3CGC A;  2RDZ A;  4Z43 A;  1D4C A;  3IHG A;  2YLS A;  4J56 A;  2GEW A;  3UKL A;  2GF3 A;  3ICR A;  4B66 A;  1PJ7 A;  3P1W A;  1KSS A;  1FEC A;  2AR8 A;  4DGK A;  3BI2 A;  2V3A A;  2NVK X;  5FS8 A;  2C76 A;  2AAQ A;  5IQ4 A;  3QJ4 A;  2C70 A;  2OAL A;  1S3B A;  2XVF A;  1YQ3 A;  3G5R A;  4AOX A;  4D04 A;  1IUS A;  1D7Y A;  4JNQ A;  3NYF A;  3TOR A;  5FS7 A;  2OLO A;  1EBD A;  2WOW A;  1FS9 A;  5C2T A;  1Y0P A;  3BNU A;  1Y56 A;  1B4V A;  2RAB A;  1FOH A;  4WCT A;  1YY5 A;  3SM8 A;  3AE7 A;  3AWI A;  4N9X A;  3KPF A;  4A6N B;  2ACZ A;  5M0Z A;  4AOS A;  1EL7 A;  4U8M A;  2GV8 A;  3HZL A;  3UTH A;  4A99 A;  4CNJ A;  2J7A A;  1JNR A;  3UKK A;  2ZBW A;  2WDV A;  3SCE A;  1OJ9 A;  2A87 A;  2FJB A;  2XVH A;  3QFB A;  4O5Q A;  3R9U A;  1DJQ A;  2YLX A;  4ADW A;  3Q9T A;  3ADA B;  2J3N A;  3C4N A;  4USQ A;  4BK1 A;  4UDR A;  2GAG B;  4IVO B;  4K2X A;  2YG7 A;  3NT6 A;  1XDI A;  4UP3 A;  4K22 A;  1ZMC A;  4BJZ A;  2UZZ A;  3ZDN A;  1LQU A;  3COX A;  2YAU A;  1H6V A;  1PBB A;  4A79 A;  4B69 A;  3AEB A;  2ZO5 A;  1H81 A;  3AE3 A;  1DOE A;  1F6M A;  3VQR A;  3GYI A;  3QSE A;  3NG7 X;  2Y6R A;  3UKP A;  1NG3 A;  1GND A;  1H84 A;  3DH9 A;  3NIX A;  3OZ2 A;  2B76 A;  3BI5 A;  2QA2 A;  3GYJ A;  2BS2 A;  4CY6 A;  5J7X A;  1B8S A;  2R0C A;  4BUR A;  2I0Z A;  2YG4 A;  5M10 A;  1N4U A;  2RGJ A;  3WE0 A;  5C3J A;  1IUT A;  2BA9 A;  4BV6 A;  3ICT A;  1FEB A;  4Q5B A;  1NPX A;  1FEA A;  4Z2T A;  2A8X A;  2Q7V A;  2XCG A;  4YKG A;  4O5U A;  4H50 A;  1TDK A;  2QA1 A;  5BRT A;  4WX1 A;  3VRB A;  5EB5 A;  2YM1 A;  2CDU A;  5U63 A;  1CBO A;  3AYL A;  2E81 A;  2V60 A;  4PAA A;  1LVL A;  3RKH A;  2WU2 A;  2GR1 A;  3PS9 A;  3UCL A;  2CFY A;  1Q1R A;  4C74 A;  4I59 A;  2XFU A;  1M6I A;  2ZZC A;  4NTC A;  3KU9 A;  1BWC A;  4YSH A;  2YQU A;  5KOW A;  3NGC X;  1YQ4 A;  3DK9 A;  4NEV A;  4Y4L A;  1PJ5 A;  2NPX A;  4JQ9 A;  4U2L A;  3CPI G;  1GES A;  4EMW A;  4TM3 A;  2VRM A;  4CNK A;  3H4K A;  4ZCC A;  1S2Q A;  4TM1 A;  3CGB A;  4GRT A;  1IUU A;  2FJE A;  1Q9I A;  2BCP A;  1GOS A;  4U8L A;  1E39 A;  3AE1 A;  2BK5 A;  2XDO A;  3KKJ A;  4YTM A;  4L3Y A;  2GQF A;  5HYM A;  3M0O A;  2YM2 A;  2ARD A;  1DNC A;  2B9Y A;  1VG9 A;  3CPH G;  4H7U A;  1PBC A;  3RP7 A;  4A5L A;  4YSX A;  3E1T A;  4I58 A;  3UP4 A;  2WPF A;  2GQW A;  3AED A;  3Q6J A;  1LJ1 A;  1EL9 A;  2RF7 A;  4IVM B;  3ICS A;  2AQJ A;  4J57 A;  1LPF A;  1LV0 A;  1CHU A;  1RSG A;  2BS4 A;  2VQB A;  2FJA A;  3NHO X;  5FS6 A;  1PHH A;  3AD9 B;  4CCQ A;  4Q5C A;  2B9X A;  2TPR A;  3S7W A;  2WP6 A;  1D4E A;  2H88 A;  1ZMD A;  2CVJ A;  3GD4 A;  5HY5 A;  3AXB A;  1XAN A;  1FT6 A;  3RHA A;  3UTG A;  2YG3 A;  4FX9 A;  4GF7 A;  1GRE A;  3FO3 A;  1OJA A;  2C73 A;  2QCU A;  2VVM A;  3LZX A;  4H4S A;  1P2E A;  3UOY A;  3EAN A;  1CC4 A;  3BHF A;  2R4E A;  3URH A;  1F8W A;  3TTB A;  4D03 A;  2WOV A;  4DSG A;  4YXD A;  3EAO A;  2VQ7 A;  1M64 A;  1TRB A;  2EQ7 A;  3AYI A;  2B7S A;  3NNE A;  1QLB A;  3T37 A;  3O0H A;  1DOD A;  1TDO A;  4X9M A;  2W0H A;  3AE2 A;  2WET A;  1LTX R;  2WPC A;  1TDN A;  1ZP0 A;  4IA6 A;  4Y4N A;  1GRH A;  3GM6 A;  2YVG A;  4CCR A;  5KXJ A;  1REO A;  2GR3 A;  2GRT A;  3UU9 A;  1ONF A;  3GMC A;  3IWA A;  4B64 A;  2F5Z A;  1M1P A;  1V59 A;  4B1B A;  4U2S A;  2GB0 A;  1DOB A;  3F8R A;  2HQM A;  2V61 A;  1M1R A;  1GRA A;  4APN A;  3OWM A;  1UKV G;  1TDF A;  5KWF A;  3DJG X;  3ALL A;  4H4Y A;  1ZOY A;  3K7T A;  2YLZ A;  2C64 A;  2BAB A;  4TLZ A;  4AT0 A;  5BUL A;  2GR0 A;  3UTE A;  3QVP A;  3P4S A;  1IUX A;  3DK8 A;  4BJY A;  2WP9 A;  3NN6 X;  2JB1 A;  4H4V A;  3GD3 A;  3B3R A;  3AEA A;  3NK2 X;  1FS8 A;  3CGE A;  5GRT A;  3K7M X;  1FT5 A;  1OJT A;  4H4P A;  4J2W A;  4OCG A;  5JCN A;  3ALM A;  4GR1 A;  1GRF A;  4H2N A;  1L0V A;  4GDE A;  5LV9 A;  4C3Y A;  1JU2 A;  1BZL A;  1KF6 A;  2XFO A;  2FBW A;  3D1I A;  1NDA A;  1B5Q A;  4OPL A;  3VRA A;  3KLJ A;  4C5O A;  1NHS A;  4JN9 A;  3RP8 A;  4A65 A;  1JNI A;  3UBR A;  3AE5 A;  3UKQ A;  4JY2 A;  5KVH A;  2EQ8 A;  4H4U A;  5IQ1 A;  1ZKQ A;  2XLP A;  1JOA A;  1ZX9 A;  3FG2 P;  5KRQ A;  4RSL A;  4OPG A;  5U25 A;  2O9Z A;  4DNA A;  2X99 A;  1YQZ A;  3ATQ A;  1RP0 A;  4FK1 C;  3DGZ A;  3DA1 A;  1NHR A;  3IHM A;  1L9D A;  2VVL G;  3GRS A;  2QAE A;  2VVL A;  3BNG A;  1H82 A;  1PXA A;  4H4W A;  4H4T A;  5U1O A;  2VZ2 A;  4HA6 A;  1ZY8 A;  5ER0 A;  3G5Q A;  2WEU A;  1NG4 A;  2TMD A;  1PBE A;  3UOV A;  3VR9 A;  1L9E A;  2GAH B;  3CND A;  3FMW A;  1COY A;  3CPJ G;  2WHD A;  1CC2 A;  2YG5 A;  4Z24 A;  3RED A;  3K30 A;  1MOK A;  3BHK A;  4Q1O A;  3C96 A;  1E6E A;  1N4W A;  2JBV A;  3NYE A;  4NTD A;  1O5W A;  4RG3 A;  3VRD B;  3UKH A;  4B63 A;  2R4J A;  1GXF A;  2X8G A;  2WBA A;  3QVR A;  1BVB A;  4L3X A;  1Q1W A;  2B9W A;  4H2R A;  3V3N A;  2E4G A;  1EL5 A;  1D7L A;  3CNP A;  3NKS A;  4A7A A;  3CNS A;  3EPT A;  4FDC B;  1IJH A;  3D8X A;  4EMI A;  4OPT A;  3ISH A;  2XVJ A;  2GVC A;  1FCD A;  1GSN A;  2OA1 A;  2E1M A;  2WS3 A;  4CRT A;  2OT4 A;  1GTH A;  3NYC A;  1GT8 A;  1P2H A;  3NTD A;  5JCL A;  4K5R A;  4PAB A;  1HYU A;  3H8I A;  2GR2 A;  4B67 A;  1NEK A;  5FS9 A;  2RGH A;  2X3N A;  1SEZ A;  2Y6Q A;  2C3D A;  3DJJ A;  3I6D A;  2BYB A;  3GMB A;  2FJD A;  3DME A;  2R0P A;  2BC1 A;  4MJW A;  1L9C A;  1PBF A;  2YR6 A;  1GRT A;  3NRN A;  4YTN A;  2YVJ A;  4LII A;  2V6O A;  2Z5Y A;  3UOZ A;  3BNH A;  1Y56 B;  1NHP A;  2ZZ0 A;  3K7Q X;  4NEW A;  3PO7 A;  4USR A;  2BK4 A;  2XFP A;  2XLR A;  1F8S A;  2XVI A;  3EF6 A;  3P9U A;  5JCK A;  4C77 A;  4K7Z A;  4KPR A;  1F3P A;  4IV9 A;  4EIP A;  1VDC A;  2YVF A;  3ATR A;  1H7W A;  3AB1 A;  1FS7 A;  2LFC A;  3QSS A;  4U8K A;  5JCM A;  1D4D A;  1FL2 A;  1ZOV A;  3AYJ A;  3GWD A;  3CNJ A;  3AE9 A;  2E80 A;  2BAC A;  2GH5 A;  4AP3 A;  4ECH A;  4AP1 A;  2IVD A;  3LGQ A;  2V3B A;  2WPE A;  1O94 A;  1H86 A;  1XPQ A;  4XXG A;  1S3E A;  4H2P A;  4U8P A;  3F8P A;  5J60 A;  3SQP A;  3CIR A;  3P4Q A;  2BK3 A;  1NEN A;  3GWF A;  4NZH A;  3AD7 B;  1QJD A;  1BGN A;  1ZDL A;  2YWL A;  3C4A A;  2IID A;  1KDG A;  2WOI A;  3AEF A;  3DJD A;  2OAM A;  3NK1 X;  4GCM A;  2H89 A;  3RNM A;  4B65 A;  2DKH A;  3IC9 A;  1JNZ A;  4HB9 A;  1CJ4 A;  5BVA A;  4IA5 A;  4XWR A;  3GDP A;  3L1R A;  3UKA A;  5CQF A;  3AE6 A;  3AEG A;  4E0V A;  1MXT A;  4OPD A;  1IUV A;  2VRL A;  3ALJ A;  3CTY A;  1TDE A;  2C67 A;  3GDN A;  4U8I A;  5EB4 A;  3DK4 A;  3FBS A;  2WP5 A;  3ZYX A;  4CY8 A;  4EQW A;  1CC6 A;  2YLW A;  4EM4 A;  1S2Y A;  4FK1 A;  5KOX A;  2WU5 A;  5GSN A;  4ZN0 A;  4OVI A;  4J34 A;  4ZCD A;  1JRX A;  3UOX A;  1CJC A;  2C3C A;  2V5Z A;  3IF9 A;  1DJN A;  2YR4 A;  5IPY A;  4YKF A;  3KVE A;  4A9W A;  4YT0 A;  2BXR A;  1PXC A;  2XLT A;  1E7P A;  2OLN A;  2WES A;  4J33 A;  1KFY A;  2R45 A;  3I3L A;  3NN0 X;  1K4Q A;  1JRZ A;  3ITJ A;  1PXB A;  2PYX A; 
#chains in the Genus database with same CATH topology
 3CGD A;  5KMR A;  3UTF A;  2WQY A;  4NWZ A;  3LB8 A;  5BUK A;  3V3O A;  2CUL A;  4DSH A;  4BK2 A;  1O95 A;  2PHH A;  1GER A;  4CBQ A;  1NAA A;  1BGJ A;  2JB2 A;  2BC0 A;  3GRT A;  1CJ3 A;  4GUV A;  4U2T A;  4YSY A;  4H2Q A;  1W4X A;  4K5S A;  2YR5 A;  2BCG G;  2RGO A;  1YKJ A;  3KD9 A;  2DKI A;  3P4R A;  4LU6 A;  1VG0 A;  1PS9 A;  4Z25 A;  3CNT A;  4P9S A;  3HYX A;  2EQ6 A;  3SXQ A;  2XLU A;  1TYP A;  2JAE A;  2R9Z A;  1E1K A;  3DGH A;  4TM4 A;  2A89 A;  1X31 B;  1GU6 A;  3BNF A;  3JSK A;  3LZW A;  4G6H A;  5KMP A;  1GET A;  3F8D A;  4Q17 A;  3B6D A;  1GAL A;  4J36 A;  3UKF A;  3CN8 A;  3V76 A;  4REK A;  2X8C A;  2GMH A;  3QFA A;  1GRG A;  1OJD A;  2BRA A;  4EMJ A;  1PDH A;  3GYX A;  2EQ9 A;  2ZZB A;  1AOG A;  3SGL A;  2WDQ A;  2B7R A;  1KNP A;  3NK0 X;  4Q4U A;  2Z5X A;  1VQW A;  1D5T A;  4XWZ A;  2XVE A;  3SFD A;  4U8O A;  2C65 A;  1DOC A;  3HYW A;  4EQS A;  4G9K A;  1JEH A;  1SP3 A;  2K3V A;  1GRB A;  2JKC A;  4NNJ A;  1BKW A;  4EM3 A;  1ZK7 A;  4Y4M A;  4K8D A;  4YSZ A;  3II4 A;  5TR3 A;  1KNR A;  3GSI A;  3L8K A;  3D1C A;  5DBJ A;  4C3X A;  2WDR A;  4AT2 A;  3LG1 A;  3OC4 A;  2R0G A;  1H7X A;  1LQT A;  4M52 A;  3PVC A;  3FIM B;  1PBD A;  2YG6 A;  2YLR A;  1GTE A;  3H8L A;  5FMH A;  2C7G A;  4UDP A;  1B37 A;  2IVE A;  3P4P A;  1GPE A;  3LAD A;  5KVI A;  1VRQ B;  2XYO A;  4JDR A;  4II3 A;  2YLT A;  4L3Z A;  3AEC A;  4GAP A;  4YTP A;  3BI4 A;  3KPK A;  4B68 A;  5EBK A;  4X9N A;  3AE8 A;  1Z6L A;  2JB3 A;  4Q0T A;  5HXI A;  3NLC A;  2X50 A;  4A6N A;  2Q6U A;  4H4Z A;  4JNA A;  3CMM A;  4H4X A;  4WJY A;  1EL8 A;  4JY3 A;  1RYI A;  4OPU A;  1GV4 A;  3G5S A;  3VR8 A;  1XHC A;  5L46 A;  1H83 A;  1OAH A;  3F29 A;  2VOU A;  1BF3 A;  4KX6 A;  3NTA A;  5HHF A;  3SFE A;  3T31 A;  1M1Q A;  4OPC A;  3UP5 A;  1E1N A;  1DXL A;  2XFQ A;  4BK3 A;  1GEU A;  2GMJ A;  3AEE A;  2BXS A;  4H4Q A;  2JK6 A;  3L1T A;  1CJ2 A;  2BS3 A;  2R46 A;  3BNJ A;  1PJ6 A;  1ELI A;  3KA7 A;  1QDB A;  3DJE A;  3LJP A;  4ICY A;  1K0L A;  4OPI A;  1MO9 A;  3LXD A;  4Z26 A;  4RG4 A;  2E5V A;  2C75 A;  1E1M A;  2X8H A;  3MMO A;  3LOV A;  3M13 A;  2Q0L A;  4Z2R A;  1K0J A;  1CF3 A;  3FPZ A;  1CL0 A;  2Q0K A;  3S61 A;  5JCI A;  1NHQ A;  2VR0 A;  1E1L A;  4Z44 A;  3AD8 B;  1PN0 A;  1KSU A;  4LA1 A;  4NTE A;  4YWO A;  2APG A;  4H4R A;  2XLS A;  1JRY A;  1QO8 A;  2C72 A;  3QSM A;  4GDP A;  1N4V A;  4U8J A;  3RNM A;  4EIQ A;  4X4J A;  5EOW A;  2C4C A;  3M12 A;  3NH3 X;  1N1P A;  1K0I A;  1IUW A;  4L38 A;  4U8N A;  2XFN A;  3S5W A;  3BNM A;  2C66 A;  3AE4 A;  1TYT A;  4EQR A;  4Z2U A;  4J31 A;  4TLX A;  3ABV A;  4UDQ A;  1OJC A;  4TM0 A;  4EQX A;  1F8R A;  5CKU A;  3RP6 A;  3CGC A;  2RDZ A;  4Z43 A;  1D4C A;  3IHG A;  2YLS A;  4J56 A;  2GEW A;  3UKL A;  2GF3 A;  3ICR A;  4B66 A;  1PJ7 A;  3P1W A;  1KSS A;  1FEC A;  2AR8 A;  4DGK A;  3BI2 A;  2V3A A;  2NVK X;  5FS8 A;  2C76 A;  2AAQ A;  5IQ4 A;  3QJ4 A;  2C70 A;  2OAL A;  1S3B A;  2XVF A;  1YQ3 A;  3G5R A;  3SXI A;  4AOX A;  4D04 A;  1IUS A;  1D7Y A;  4JNQ A;  3NYF A;  3TOR A;  5FS7 A;  2OLO A;  1EBD A;  2WOW A;  1FS9 A;  5C2T A;  1Y0P A;  3BNU A;  1Y56 A;  1B4V A;  2RAB A;  1FOH A;  4WCT A;  1YY5 A;  3SM8 A;  3AE7 A;  3AWI A;  4N9X A;  3KPF A;  4A6N B;  2ACZ A;  5M0Z A;  4AOS A;  1EL7 A;  4U8M A;  2GV8 A;  3HZL A;  3UTH A;  4A99 A;  4CNJ A;  2J7A A;  1JNR A;  3UKK A;  2ZBW A;  2WDV A;  3SCE A;  1OJ9 A;  2A87 A;  2FJB A;  2XVH A;  3QFB A;  4O5Q A;  3R9U A;  1DJQ A;  2YLX A;  4ADW A;  3Q9T A;  3ADA B;  2J3N A;  3C4N A;  4USQ A;  4BK1 A;  4UDR A;  2GAG B;  4IVO B;  3SYI A;  4K2X A;  2YG7 A;  3NT6 A;  1XDI A;  4UP3 A;  4K22 A;  1ZMC A;  4BJZ A;  2UZZ A;  3ZDN A;  1LQU A;  3COX A;  2YAU A;  1H6V A;  1PBB A;  4A79 A;  4B69 A;  3AEB A;  4II2 A;  2ZO5 A;  1H81 A;  3AE3 A;  1DOE A;  1F6M A;  3VQR A;  3GYI A;  3QSE A;  3NG7 X;  2Y6R A;  3UKP A;  1NG3 A;  1GND A;  1H84 A;  3DH9 A;  3NIX A;  3OZ2 A;  2B76 A;  3BI5 A;  2QA2 A;  3GYJ A;  2BS2 A;  4CY6 A;  5J7X A;  1B8S A;  2R0C A;  4BUR A;  2I0Z A;  2YG4 A;  5M10 A;  1N4U A;  2RGJ A;  3WE0 A;  5C3J A;  1IUT A;  2BA9 A;  4BV6 A;  3ICT A;  1FEB A;  4Q5B A;  1NPX A;  1FEA A;  4Z2T A;  2A8X A;  2Q7V A;  2XCG A;  4YKG A;  4O5U A;  4H50 A;  1TDK A;  2QA1 A;  5BRT A;  4WX1 A;  3VRB A;  5EB5 A;  2YM1 A;  2CDU A;  5U63 A;  1CBO A;  3AYL A;  2E81 A;  2V60 A;  4PAA A;  1LVL A;  3RKH A;  2WU2 A;  2GR1 A;  3PS9 A;  3UCL A;  2CFY A;  1Q1R A;  3T2Z A;  4I59 A;  2XFU A;  1M6I A;  2ZZC A;  4NTC A;  3KU9 A;  1BWC A;  4YSH A;  2YQU A;  5KOW A;  3NGC X;  1YQ4 A;  3DK9 A;  4NEV A;  4Y4L A;  1PJ5 A;  2NPX A;  4JQ9 A;  4U2L A;  3CPI G;  1GES A;  4EMW A;  4TM3 A;  2VRM A;  4CNK A;  3H4K A;  4ZCC A;  1S2Q A;  4TM1 A;  3CGB A;  4GRT A;  1IUU A;  2FJE A;  1Q9I A;  2BCP A;  1GOS A;  4U8L A;  1E39 A;  3AE1 A;  2BK5 A;  2XDO A;  3KKJ A;  4YTM A;  4L3Y A;  2GQF A;  5HYM A;  3M0O A;  2YM2 A;  2ARD A;  1DNC A;  2B9Y A;  1VG9 A;  3CPH G;  4H7U A;  1PBC A;  3RP7 A;  4A5L A;  4YSX A;  3E1T A;  4I58 A;  3UP4 A;  2WPF A;  2GQW A;  3AED A;  3Q6J A;  1LJ1 A;  1EL9 A;  2RF7 A;  4IVM B;  3ICS A;  2AQJ A;  4J57 A;  1LPF A;  1LV0 A;  1CHU A;  1RSG A;  2BS4 A;  2VQB A;  2FJA A;  3SZC A;  3NHO X;  5FS6 A;  1PHH A;  3AD9 B;  4CCQ A;  4Q5C A;  2B9X A;  2TPR A;  3S7W A;  2WP6 A;  1D4E A;  2H88 A;  3SZ0 A;  1ZMD A;  2CVJ A;  3GD4 A;  5HY5 A;  3AXB A;  1XAN A;  1FT6 A;  3RHA A;  3UTG A;  2YG3 A;  4FX9 A;  4GF7 A;  1GRE A;  3FO3 A;  1OJA A;  2C73 A;  2QCU A;  2VVM A;  3LZX A;  4H4S A;  1P2E A;  3T2Y A;  3EAN A;  1CC4 A;  3BHF A;  2R4E A;  3URH A;  3UOY A;  1F8W A;  3TTB A;  4D03 A;  2WOV A;  4DSG A;  4YXD A;  3EAO A;  2VQ7 A;  1M64 A;  1TRB A;  2EQ7 A;  3AYI A;  2B7S A;  3NNE A;  1QLB A;  3T37 A;  3O0H A;  1DOD A;  1TDO A;  4X9M A;  2W0H A;  3AE2 A;  2WET A;  1LTX R;  2WPC A;  1TDN A;  1ZP0 A;  4IA6 A;  4Y4N A;  1GRH A;  3GM6 A;  2YVG A;  4CCR A;  5KXJ A;  1REO A;  2GR3 A;  2GRT A;  3UU9 A;  1ONF A;  3GMC A;  3HYV A;  3IWA A;  2F5Z A;  1M1P A;  1V59 A;  4B64 A;  4B1B A;  4U2S A;  2GB0 A;  1DOB A;  3F8R A;  2HQM A;  2V61 A;  1M1R A;  1GRA A;  4APN A;  3OWM A;  1UKV G;  1TDF A;  5KWF A;  3DJG X;  3ALL A;  4H4Y A;  1ZOY A;  3K7T A;  2YLZ A;  2C64 A;  2BAB A;  4TLZ A;  4AT0 A;  5BUL A;  2GR0 A;  3UTE A;  3QVP A;  3P4S A;  1IUX A;  4G73 A;  3DK8 A;  4BJY A;  2WP9 A;  3NN6 X;  2JB1 A;  4H4V A;  3GD3 A;  3B3R A;  3AEA A;  3NK2 X;  1FS8 A;  3CGE A;  5GRT A;  3K7M X;  1FT5 A;  1OJT A;  4H4P A;  4J2W A;  4OCG A;  5JCN A;  3ALM A;  4GR1 A;  1GRF A;  4H2N A;  1L0V A;  4GDE A;  5LV9 A;  4C3Y A;  1JU2 A;  1BZL A;  1KF6 A;  2XFO A;  2FBW A;  3D1I A;  1NDA A;  1B5Q A;  4OPL A;  3VRA A;  3KLJ A;  4C5O A;  5KMQ A;  1NHS A;  4JN9 A;  3RP8 A;  4A65 A;  1JNI A;  3UBR A;  3AE5 A;  3UKQ A;  4JY2 A;  5KVH A;  4G6G A;  2EQ8 A;  4H4U A;  5IQ1 A;  1ZKQ A;  2XLP A;  1JOA A;  1ZX9 A;  3FG2 P;  5KRQ A;  4RSL A;  4OPG A;  5U25 A;  2O9Z A;  3T0K A;  4DNA A;  2X99 A;  1YQZ A;  3ATQ A;  1RP0 A;  4FK1 C;  5KMS A;  3DGZ A;  3DA1 A;  1NHR A;  3IHM A;  1L9D A;  2VVL G;  3GRS A;  2QAE A;  2VVL A;  3BNG A;  1H82 A;  1PXA A;  4H4W A;  4H4T A;  5U1O A;  3SZW A;  2VZ2 A;  4HA6 A;  1ZY8 A;  5ER0 A;  3G5Q A;  2WEU A;  1NG4 A;  2TMD A;  1PBE A;  3UOV A;  3VR9 A;  1L9E A;  2GAH B;  3CND A;  3FMW A;  1COY A;  3CPJ G;  2WHD A;  1CC2 A;  2YG5 A;  4Z24 A;  3RED A;  3K30 A;  1MOK A;  3BHK A;  4Q1O A;  3C96 A;  1E6E A;  1N4W A;  2JBV A;  3NYE A;  4NTD A;  1O5W A;  4RG3 A;  3VRD B;  3UKH A;  4B63 A;  2R4J A;  1GXF A;  2X8G A;  2WBA A;  3QVR A;  1BVB A;  4L3X A;  1Q1W A;  2B9W A;  4H2R A;  3V3N A;  2E4G A;  1EL5 A;  1D7L A;  3CNP A;  3NKS A;  4A7A A;  3CNS A;  3EPT A;  4FDC B;  1IJH A;  3D8X A;  4EMI A;  4OPT A;  3ISH A;  2XVJ A;  2GVC A;  1FCD A;  1GSN A;  2OA1 A;  2E1M A;  3SY4 A;  2WS3 A;  3T2K A;  2OT4 A;  4CRT A;  1GTH A;  4C74 A;  3NYC A;  1GT8 A;  1P2H A;  3NTD A;  5JCL A;  4K5R A;  4PAB A;  2CZS A;  1HYU A;  3H8I A;  2GR2 A;  3T14 A;  1NEK A;  5FS9 A;  2RGH A;  4B67 A;  2X3N A;  1SEZ A;  2Y6Q A;  2C3D A;  3DJJ A;  3I6D A;  2BYB A;  3GMB A;  2FJD A;  3DME A;  2R0P A;  2BC1 A;  4MJW A;  1L9C A;  1PBF A;  2YR6 A;  1GRT A;  3NRN A;  4YTN A;  2YVJ A;  4LII A;  2V6O A;  2Z5Y A;  3UOZ A;  5KNL A;  3BNH A;  1Y56 B;  1NHP A;  2ZZ0 A;  3K7Q X;  4NEW A;  3PO7 A;  4USR A;  2BK4 A;  2XFP A;  2XLR A;  1F8S A;  2XVI A;  3EF6 A;  3P9U A;  5JCK A;  4C77 A;  4K7Z A;  4KPR A;  1F3P A;  4IV9 A;  4EIP A;  1VDC A;  2YVF A;  3ATR A;  1H7W A;  3AB1 A;  1FS7 A;  2LFC A;  3QSS A;  4U8K A;  5JCM A;  1D4D A;  1FL2 A;  1ZOV A;  3AYJ A;  3GWD A;  3CNJ A;  3AE9 A;  2E80 A;  2BAC A;  2GH5 A;  4AP3 A;  4ECH A;  4AP1 A;  2IVD A;  3LGQ A;  2V3B A;  2WPE A;  1O94 A;  1H86 A;  1XPQ A;  4XXG A;  1S3E A;  4H2P A;  4U8P A;  3F8P A;  5J60 A;  3SQP A;  3CIR A;  3P4Q A;  2BK3 A;  1NEN A;  3GWF A;  4NZH A;  3AD7 B;  1QJD A;  1BGN A;  1ZDL A;  2YWL A;  3C4A A;  2IID A;  1KDG A;  2WOI A;  3AEF A;  3DJD A;  2OAM A;  3NK1 X;  4GCM A;  2H89 A;  4G74 A;  4B65 A;  2DKH A;  3IC9 A;  1JNZ A;  4HB9 A;  1CJ4 A;  5BVA A;  4IA5 A;  4XWR A;  3GDP A;  3L1R A;  3UKA A;  5CQF A;  3AE6 A;  3AEG A;  4E0V A;  1MXT A;  4OPD A;  1IUV A;  2VRL A;  3ALJ A;  3SZF A;  3CTY A;  1TDE A;  2C67 A;  3GDN A;  4U8I A;  5EB4 A;  3DK4 A;  3FBS A;  2WP5 A;  3ZYX A;  4CY8 A;  4EQW A;  1CC6 A;  2YLW A;  4EM4 A;  1S2Y A;  4FK1 A;  5KOX A;  2WU5 A;  5GSN A;  4ZN0 A;  4OVI A;  4J34 A;  4ZCD A;  1JRX A;  3UOX A;  1CJC A;  2C3C A;  2V5Z A;  3IF9 A;  1DJN A;  2YR4 A;  4GAV A;  5IPY A;  4YKF A;  3KVE A;  4A9W A;  4YT0 A;  2BXR A;  1PXC A;  2XLT A;  3SX6 A;  2BRY A;  1E7P A;  2OLN A;  2WES A;  4J33 A;  1KFY A;  2R45 A;  3I3L A;  3NN0 X;  1K4Q A;  1JRZ A;  3ITJ A;  1PXB A;  2PYX A; 
#chains in the Genus database with same CATH homology
 3CGD A;  5KMR A;  3UTF A;  2WQY A;  4NWZ A;  3LB8 A;  5BUK A;  3V3O A;  2CUL A;  4DSH A;  4BK2 A;  1O95 A;  2PHH A;  1GER A;  4CBQ A;  1NAA A;  1BGJ A;  2JB2 A;  2BC0 A;  3GRT A;  1CJ3 A;  4GUV A;  4U2T A;  4YSY A;  4H2Q A;  1W4X A;  4K5S A;  2YR5 A;  2BCG G;  2RGO A;  1YKJ A;  3KD9 A;  2DKI A;  3P4R A;  4LU6 A;  1VG0 A;  1PS9 A;  4Z25 A;  3CNT A;  4P9S A;  3HYX A;  2EQ6 A;  3SXQ A;  2XLU A;  1TYP A;  2JAE A;  2R9Z A;  1E1K A;  3DGH A;  4TM4 A;  2A89 A;  1X31 B;  1GU6 A;  3BNF A;  3JSK A;  3LZW A;  4G6H A;  5KMP A;  1GET A;  3F8D A;  4Q17 A;  3B6D A;  1GAL A;  4J36 A;  3UKF A;  3CN8 A;  3V76 A;  4REK A;  2X8C A;  2GMH A;  3QFA A;  1GRG A;  1OJD A;  2BRA A;  4EMJ A;  1PDH A;  3GYX A;  2EQ9 A;  2ZZB A;  1AOG A;  3SGL A;  2WDQ A;  2B7R A;  1KNP A;  3NK0 X;  4Q4U A;  2Z5X A;  1VQW A;  1D5T A;  4XWZ A;  2XVE A;  3SFD A;  4U8O A;  2C65 A;  1DOC A;  3HYW A;  4EQS A;  4G9K A;  1JEH A;  1SP3 A;  2K3V A;  1GRB A;  2JKC A;  4NNJ A;  1BKW A;  4EM3 A;  1ZK7 A;  4Y4M A;  4K8D A;  4YSZ A;  3II4 A;  5TR3 A;  1KNR A;  3GSI A;  3L8K A;  3D1C A;  5DBJ A;  4C3X A;  2WDR A;  4AT2 A;  3LG1 A;  3OC4 A;  2R0G A;  1H7X A;  1LQT A;  4M52 A;  3PVC A;  3FIM B;  1PBD A;  2YG6 A;  2YLR A;  1GTE A;  3H8L A;  5FMH A;  2C7G A;  4UDP A;  1B37 A;  2IVE A;  3P4P A;  1GPE A;  3LAD A;  5KVI A;  1VRQ B;  2XYO A;  4JDR A;  4II3 A;  2YLT A;  4L3Z A;  3AEC A;  4GAP A;  4YTP A;  3BI4 A;  3KPK A;  4B68 A;  5EBK A;  4X9N A;  3AE8 A;  1Z6L A;  2JB3 A;  4Q0T A;  5HXI A;  3NLC A;  2X50 A;  4A6N A;  2Q6U A;  4H4Z A;  4JNA A;  3CMM A;  4H4X A;  4WJY A;  1EL8 A;  4JY3 A;  1RYI A;  4OPU A;  1GV4 A;  3G5S A;  3VR8 A;  1XHC A;  5L46 A;  1H83 A;  1OAH A;  3F29 A;  2VOU A;  1BF3 A;  4KX6 A;  3NTA A;  5HHF A;  3SFE A;  3T31 A;  1M1Q A;  4OPC A;  3UP5 A;  1E1N A;  1DXL A;  2XFQ A;  4BK3 A;  1GEU A;  2GMJ A;  3AEE A;  2BXS A;  4H4Q A;  2JK6 A;  3L1T A;  1CJ2 A;  2BS3 A;  2R46 A;  3BNJ A;  1PJ6 A;  1ELI A;  3KA7 A;  1QDB A;  3DJE A;  3LJP A;  4ICY A;  1K0L A;  4OPI A;  1MO9 A;  3LXD A;  4Z26 A;  4RG4 A;  2E5V A;  2C75 A;  1E1M A;  2X8H A;  3MMO A;  3LOV A;  3M13 A;  2Q0L A;  4Z2R A;  1K0J A;  1CF3 A;  3FPZ A;  1CL0 A;  2Q0K A;  3S61 A;  5JCI A;  1NHQ A;  2VR0 A;  1E1L A;  4Z44 A;  3AD8 B;  1PN0 A;  1KSU A;  4LA1 A;  4NTE A;  4YWO A;  2APG A;  4H4R A;  2XLS A;  1JRY A;  1QO8 A;  2C72 A;  3QSM A;  4GDP A;  1N4V A;  4U8J A;  3RNM A;  4EIQ A;  4X4J A;  5EOW A;  2C4C A;  3M12 A;  3NH3 X;  1N1P A;  1K0I A;  1IUW A;  4L38 A;  4U8N A;  2XFN A;  3S5W A;  3BNM A;  2C66 A;  3AE4 A;  1TYT A;  4EQR A;  4Z2U A;  4J31 A;  4TLX A;  3ABV A;  4UDQ A;  1OJC A;  4TM0 A;  4EQX A;  1F8R A;  5CKU A;  3RP6 A;  3CGC A;  2RDZ A;  4Z43 A;  1D4C A;  3IHG A;  2YLS A;  4J56 A;  2GEW A;  3UKL A;  2GF3 A;  3ICR A;  4B66 A;  1PJ7 A;  3P1W A;  1KSS A;  1FEC A;  2AR8 A;  4DGK A;  3BI2 A;  2V3A A;  2NVK X;  5FS8 A;  2C76 A;  2AAQ A;  5IQ4 A;  3QJ4 A;  2C70 A;  2OAL A;  1S3B A;  2XVF A;  1YQ3 A;  3G5R A;  3SXI A;  4AOX A;  4D04 A;  1IUS A;  1D7Y A;  4JNQ A;  3NYF A;  3TOR A;  5FS7 A;  2OLO A;  1EBD A;  2WOW A;  1FS9 A;  5C2T A;  1Y0P A;  3BNU A;  1Y56 A;  1B4V A;  2RAB A;  1FOH A;  4WCT A;  1YY5 A;  3SM8 A;  3AE7 A;  3AWI A;  4N9X A;  3KPF A;  4A6N B;  2ACZ A;  5M0Z A;  4AOS A;  1EL7 A;  4U8M A;  2GV8 A;  3HZL A;  3UTH A;  4A99 A;  4CNJ A;  2J7A A;  1JNR A;  3UKK A;  2ZBW A;  2WDV A;  3SCE A;  1OJ9 A;  2A87 A;  2FJB A;  2XVH A;  3QFB A;  4O5Q A;  3R9U A;  1DJQ A;  2YLX A;  4ADW A;  3Q9T A;  3ADA B;  2J3N A;  3C4N A;  4USQ A;  4BK1 A;  4UDR A;  2GAG B;  4IVO B;  3SYI A;  4K2X A;  2YG7 A;  3NT6 A;  1XDI A;  4UP3 A;  4K22 A;  1ZMC A;  4BJZ A;  2UZZ A;  3ZDN A;  1LQU A;  3COX A;  2YAU A;  1H6V A;  1PBB A;  4A79 A;  4B69 A;  3AEB A;  4II2 A;  2ZO5 A;  1H81 A;  3AE3 A;  1DOE A;  1F6M A;  3VQR A;  3GYI A;  3QSE A;  3NG7 X;  2Y6R A;  3UKP A;  1NG3 A;  1GND A;  1H84 A;  3DH9 A;  3NIX A;  3OZ2 A;  2B76 A;  3BI5 A;  2QA2 A;  3GYJ A;  2BS2 A;  4CY6 A;  5J7X A;  1B8S A;  2R0C A;  4BUR A;  2I0Z A;  2YG4 A;  5M10 A;  1N4U A;  2RGJ A;  3WE0 A;  5C3J A;  1IUT A;  2BA9 A;  4BV6 A;  3ICT A;  1FEB A;  4Q5B A;  1NPX A;  1FEA A;  4Z2T A;  2A8X A;  2Q7V A;  2XCG A;  4YKG A;  4O5U A;  4H50 A;  1TDK A;  2QA1 A;  5BRT A;  4WX1 A;  3VRB A;  5EB5 A;  2YM1 A;  2CDU A;  5U63 A;  1CBO A;  3AYL A;  2E81 A;  2V60 A;  4PAA A;  1LVL A;  3RKH A;  2WU2 A;  2GR1 A;  3PS9 A;  3UCL A;  2CFY A;  1Q1R A;  3T2Z A;  4I59 A;  2XFU A;  1M6I A;  2ZZC A;  4NTC A;  3KU9 A;  1BWC A;  4YSH A;  2YQU A;  5KOW A;  3NGC X;  1YQ4 A;  3DK9 A;  4NEV A;  4Y4L A;  1PJ5 A;  2NPX A;  4JQ9 A;  4U2L A;  3CPI G;  1GES A;  4EMW A;  4TM3 A;  2VRM A;  4CNK A;  3H4K A;  4ZCC A;  1S2Q A;  4TM1 A;  3CGB A;  4GRT A;  1IUU A;  2FJE A;  1Q9I A;  2BCP A;  1GOS A;  4U8L A;  1E39 A;  3AE1 A;  2BK5 A;  2XDO A;  3KKJ A;  4YTM A;  4L3Y A;  2GQF A;  5HYM A;  3M0O A;  2YM2 A;  2ARD A;  1DNC A;  2B9Y A;  1VG9 A;  3CPH G;  4H7U A;  1PBC A;  3RP7 A;  4A5L A;  4YSX A;  3E1T A;  4I58 A;  3UP4 A;  2WPF A;  2GQW A;  3AED A;  3Q6J A;  1LJ1 A;  1EL9 A;  2RF7 A;  4IVM B;  3ICS A;  2AQJ A;  4J57 A;  1LPF A;  1LV0 A;  1CHU A;  1RSG A;  2BS4 A;  2VQB A;  2FJA A;  3SZC A;  3NHO X;  5FS6 A;  1PHH A;  3AD9 B;  4CCQ A;  4Q5C A;  2B9X A;  2TPR A;  3S7W A;  2WP6 A;  1D4E A;  2H88 A;  3SZ0 A;  1ZMD A;  2CVJ A;  3GD4 A;  5HY5 A;  3AXB A;  1XAN A;  1FT6 A;  3RHA A;  3UTG A;  2YG3 A;  4FX9 A;  4GF7 A;  1GRE A;  3FO3 A;  1OJA A;  2C73 A;  2QCU A;  2VVM A;  3LZX A;  4H4S A;  1P2E A;  3T2Y A;  3EAN A;  1CC4 A;  3BHF A;  2R4E A;  3URH A;  3UOY A;  1F8W A;  3TTB A;  4D03 A;  2WOV A;  4DSG A;  4YXD A;  3EAO A;  2VQ7 A;  1M64 A;  1TRB A;  2EQ7 A;  3AYI A;  2B7S A;  3NNE A;  1QLB A;  3T37 A;  3O0H A;  1DOD A;  1TDO A;  4X9M A;  2W0H A;  3AE2 A;  2WET A;  1LTX R;  2WPC A;  1TDN A;  1ZP0 A;  4IA6 A;  4Y4N A;  1GRH A;  3GM6 A;  2YVG A;  4CCR A;  5KXJ A;  1REO A;  2GR3 A;  2GRT A;  3UU9 A;  1ONF A;  3GMC A;  3HYV A;  3IWA A;  2F5Z A;  1M1P A;  1V59 A;  4B64 A;  4B1B A;  4U2S A;  2GB0 A;  1DOB A;  3F8R A;  2HQM A;  2V61 A;  1M1R A;  1GRA A;  4APN A;  3OWM A;  1UKV G;  1TDF A;  5KWF A;  3DJG X;  3ALL A;  4H4Y A;  1ZOY A;  3K7T A;  2YLZ A;  2C64 A;  2BAB A;  4TLZ A;  4AT0 A;  5BUL A;  2GR0 A;  3UTE A;  3QVP A;  3P4S A;  1IUX A;  4G73 A;  3DK8 A;  4BJY A;  2WP9 A;  3NN6 X;  2JB1 A;  4H4V A;  3GD3 A;  3B3R A;  3AEA A;  3NK2 X;  1FS8 A;  3CGE A;  5GRT A;  3K7M X;  1FT5 A;  1OJT A;  4H4P A;  4J2W A;  4OCG A;  5JCN A;  3ALM A;  4GR1 A;  1GRF A;  4H2N A;  1L0V A;  4GDE A;  5LV9 A;  4C3Y A;  1JU2 A;  1BZL A;  1KF6 A;  2XFO A;  2FBW A;  3D1I A;  1NDA A;  1B5Q A;  4OPL A;  3VRA A;  3KLJ A;  4C5O A;  5KMQ A;  1NHS A;  4JN9 A;  3RP8 A;  4A65 A;  1JNI A;  3UBR A;  3AE5 A;  3UKQ A;  4JY2 A;  5KVH A;  4G6G A;  2EQ8 A;  4H4U A;  5IQ1 A;  1ZKQ A;  2XLP A;  1JOA A;  1ZX9 A;  3FG2 P;  5KRQ A;  4RSL A;  4OPG A;  5U25 A;  2O9Z A;  3T0K A;  4DNA A;  2X99 A;  1YQZ A;  3ATQ A;  1RP0 A;  4FK1 C;  5KMS A;  3DGZ A;  3DA1 A;  1NHR A;  3IHM A;  1L9D A;  2VVL G;  3GRS A;  2QAE A;  2VVL A;  3BNG A;  1H82 A;  1PXA A;  4H4W A;  4H4T A;  5U1O A;  3SZW A;  2VZ2 A;  4HA6 A;  1ZY8 A;  5ER0 A;  3G5Q A;  2WEU A;  1NG4 A;  2TMD A;  1PBE A;  3UOV A;  3VR9 A;  1L9E A;  2GAH B;  3CND A;  3FMW A;  1COY A;  3CPJ G;  2WHD A;  1CC2 A;  2YG5 A;  4Z24 A;  3RED A;  3K30 A;  1MOK A;  3BHK A;  4Q1O A;  3C96 A;  1E6E A;  1N4W A;  2JBV A;  3NYE A;  4NTD A;  1O5W A;  4RG3 A;  3VRD B;  3UKH A;  4B63 A;  2R4J A;  1GXF A;  2X8G A;  2WBA A;  3QVR A;  1BVB A;  4L3X A;  1Q1W A;  2B9W A;  4H2R A;  3V3N A;  2E4G A;  1EL5 A;  1D7L A;  3CNP A;  3NKS A;  4A7A A;  3CNS A;  3EPT A;  4FDC B;  1IJH A;  3D8X A;  4EMI A;  4OPT A;  3ISH A;  2XVJ A;  2GVC A;  1FCD A;  1GSN A;  2OA1 A;  2E1M A;  3SY4 A;  2WS3 A;  3T2K A;  2OT4 A;  4CRT A;  1GTH A;  4C74 A;  3NYC A;  1GT8 A;  1P2H A;  3NTD A;  5JCL A;  4K5R A;  4PAB A;  1HYU A;  3H8I A;  2GR2 A;  3T14 A;  1NEK A;  5FS9 A;  2RGH A;  4B67 A;  2X3N A;  1SEZ A;  2Y6Q A;  2C3D A;  3DJJ A;  3I6D A;  2BYB A;  3GMB A;  2FJD A;  3DME A;  2R0P A;  2BC1 A;  4MJW A;  1L9C A;  1PBF A;  2YR6 A;  1GRT A;  3NRN A;  4YTN A;  2YVJ A;  4LII A;  2V6O A;  2Z5Y A;  3UOZ A;  5KNL A;  3BNH A;  1Y56 B;  1NHP A;  2ZZ0 A;  3K7Q X;  4NEW A;  3PO7 A;  4USR A;  2BK4 A;  2XFP A;  2XLR A;  1F8S A;  2XVI A;  3EF6 A;  3P9U A;  5JCK A;  4C77 A;  4K7Z A;  4KPR A;  1F3P A;  4IV9 A;  4EIP A;  1VDC A;  2YVF A;  3ATR A;  1H7W A;  3AB1 A;  1FS7 A;  2LFC A;  3QSS A;  4U8K A;  5JCM A;  1D4D A;  1FL2 A;  1ZOV A;  3AYJ A;  3GWD A;  3CNJ A;  3AE9 A;  2E80 A;  2BAC A;  2GH5 A;  4AP3 A;  4ECH A;  4AP1 A;  2IVD A;  3LGQ A;  2V3B A;  2WPE A;  1O94 A;  1H86 A;  1XPQ A;  4XXG A;  1S3E A;  4H2P A;  4U8P A;  3F8P A;  5J60 A;  3SQP A;  3CIR A;  3P4Q A;  2BK3 A;  1NEN A;  3GWF A;  4NZH A;  3AD7 B;  1QJD A;  1BGN A;  1ZDL A;  2YWL A;  3C4A A;  2IID A;  1KDG A;  2WOI A;  3AEF A;  3DJD A;  2OAM A;  3NK1 X;  4GCM A;  2H89 A;  4G74 A;  4B65 A;  2DKH A;  3IC9 A;  1JNZ A;  4HB9 A;  1CJ4 A;  5BVA A;  4IA5 A;  4XWR A;  3GDP A;  3L1R A;  3UKA A;  5CQF A;  3AE6 A;  3AEG A;  4E0V A;  1MXT A;  4OPD A;  1IUV A;  2VRL A;  3ALJ A;  3SZF A;  3CTY A;  1TDE A;  2C67 A;  3GDN A;  4U8I A;  5EB4 A;  3DK4 A;  3FBS A;  2WP5 A;  3ZYX A;  4CY8 A;  4EQW A;  1CC6 A;  2YLW A;  4EM4 A;  1S2Y A;  4FK1 A;  5KOX A;  2WU5 A;  5GSN A;  4ZN0 A;  4OVI A;  4J34 A;  4ZCD A;  1JRX A;  3UOX A;  1CJC A;  2C3C A;  2V5Z A;  3IF9 A;  1DJN A;  2YR4 A;  4GAV A;  5IPY A;  4YKF A;  3KVE A;  4A9W A;  4YT0 A;  2BXR A;  1PXC A;  2XLT A;  3SX6 A;  2BRY A;  1E7P A;  2OLN A;  2WES A;  4J33 A;  1KFY A;  2R45 A;  3I3L A;  3NN0 X;  1K4Q A;  1JRZ A;  3ITJ A;  1PXB A;  2PYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...