1KSUA

Crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHYTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c
publication title Role of His505 in the soluble fumarate reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 196
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1ksuA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1ksuA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1ksuA01
1OJCA 2GB0A 1M64A 1GTEA 4EQSA 4OPDA 3GDNA 3NYCA 3OZ2A 4OVIA 3UTHA 1KF6A 5J60A 4YWOA 1PS9A 2IVDA 3AE8A 3DJGX 4GDPA 4KPRA 5EB4A 1ZX9A 1E1LA 3B3RA 4TM1A 1TYTA 3NN6X 4EMJA 1IUSA 1X31B 2AQJA 4O5UA 2XLPA 3OWMA 1GPEA 4USRA 2B7RA 2K3VA 1Q9IA 1TDNA 2CDUA 1ZY8A 2B9WA 2VVMA 3KU9A 1CC2A 1YQ3A 2FJDA 1MXTA 2GR0A 4H2RA 3RP6A 4C77A 4WJYA 2BA9A 4WX1A 5IQ4A 3MMOA 3DK9A 3DH9A 3FIMB 3F8RA 1GU6A 5U25A 2E81A 3B6DA 4ZN0A 4HB9A 5DBJA 4ZCDA 5FS8A 4H2NA 3D1CA 3AYJA 5EB5A 1F8WA 5HY5A 4USQA 3GMCA 2ZBWA 4K2XA 3QFAA 2B9YA 2J3NA 2BK5A 3ATRA 1Y56B 3KVEA 1KSUA 2X50A 2XCGA 1ZKQA 2C7GA 1FOHA 2WP9A 4NEVA 1GRHA 5KXJA 1PBCA 2O9ZA 3AE9A 1M1RA 1XANA 4K8DA 4H2PA 4H4VA 1M1QA 5FS7A 3FMWA 1JNZA 1GESA 1O95A 3ZYXA 4PAAA 4AP1A 1GSNA 1L9CA 1TDEA 4A65A 4CNJA 2ARDA 2V60A 4XWZA 5KWFA 4H4QA 4YTPA 2GMJA 2BYBA 3BNGA 3CGCA 4UDRA 3AWIA 2VQ7A 3L1TA 1P2HA 1GRTA 4A99A 4K5SA 3NYFA 2QCUA 1OAHA 4A6NA 2BS3A 3AECA 5CKUA 1Q1WA 4Y4NA 1LJ1A 2YAUA 2BK3A 5KVIA 2PYXA 1F6MA 2WDVA 1D7LA 3AEFA 3K7QX 3NH3X 3KA7A 5IPYA 3KPFA 4TLXA 3AYLA 4UDPA 4TM3A 2BXSA 4JNQA 1GRAA 3UTGA 2OA1A 4BURA 2GVCA 1OJDA 1ONFA 1ZOYA 4A7AA 2Q7VA 1K0LA 4NEWA 4PABA 1FS8A 3RHAA 3AXBA 3NIXA 3FO3A 4AOXA 1DNCA 2FJBA 2YVJA 3FBSA 4Q4UA 2R9ZA 3RNMA 5HYMA 2EQ9A 4ADWA 1Q1RA 2ACZA 2EQ7A 2WOVA 1BZLA 1L9DA 4J34A 4IA6A 4J33A 1EBDA 1M6IA 1O94A 3E1TA 1DODA 2YM1A 3TORA 4J2WA 2BS2A 4JNAA 4YKFA 2GH5A 3GYJA 2FJAA 1SP3A 1Y56A 4U2TA 5KRQA 2IIDA 3UTEA 1OJ9A 3ABVA 1ZOVA 3CNTA 3BI4A 2XFUA 2J7AA 1PJ7A 5FS6A 4L3XA 2R0CA 2C64A 1N4UA 1FS9A 2H88A 3CTYA 4L3ZA 3NK1X 2TMDA 5FS9A 3LB8A 2QA2A 4U2SA 1CJCA 1NG4A 4CY6A 1GEUA 2JKCA 2B76A 4Y4MA 1H82A 4B64A 5JCIA 2YLRA 3GYXA 2NPXA 2CULA 4OPLA 4EIQA 4C3YA 1LV0A 3SM8A 4EMWA 1GNDA 4J57A 3UKKA 2GQFA 2GR1A 1H84A 1FEBA 2E1MA 2UZZA 3CPJG 4A6NB 5J7XA 3UKHA 4I58A 4B63A 3RP8A 1PBBA 3DGHA 4WCTA 3AE6A 3FPZA 1JU2A 3IWAA 1ZP0A 1GRFA 1O5WA 3SQPA 1JRZA 2WOIA 3AD7B 3ALJA 3AE7A 3M0OA 4AOSA 3F8PA 5CQFA 2YG5A 4M52A 3R9UA 1VG0A 3QJ4A 3AEGA 1FL2A 3P4QA 2Q0KA 3JSKA 4NTDA 4L38A 5JCMA 4C5OA 1PN0A 1KSSA 4DGKA 1KDGA 3DJJA 2DKHA 3GYIA 1TYPA 4XWRA 3CGEA 4TLZA 4Z25A 3P1WA 3NG7X 5GRTA 2NVKX 4OPUA 4Q5CA 3GM6A 1F3PA 1LQTA 2YLSA 4IA5A 1EL9A 1CC6A 2Q0LA 2WPFA 1B4VA 4AP3A 4U8PA 1YY5A 4J36A 2TPRA 3NK2X 3P4SA 4AT2A 2IVEA 1LQUA 1VG9A 2GAGB 5EBKA 1GXFA 1ZK7A 2RGHA 3GSIA 1D5TA 4DSHA 5KOXA 2GF3A 3KKJA 1PJ6A 2XDOA 4Z2UA 1D7YA 4KX6A 2C70A 2XVHA 3G5RA 1L0VA 2BXRA 4BJYA 2BC1A 1FECA 4AT0A 1FT5A 2C66A 2XLTA 4U8IA 3H8IA 1E1KA 3AE2A 2XFPA 3UTFA 3ALMA 2VVLG 1W4XA 3I6DA 1Z6LA 4RG4A 1NHPA 1VQWA 3FG2P 1MOKA 3UKFA 4B66A 1E1NA 4B67A 4FK1C 4YSZA 2AR8A 2Y6RA 3M12A 2JAEA 1EL7A 2C76A 1GALA 3BNJA 1JNRA 3V3OA 3VRAA 4YXDA 2GR2A 3SCEA 1QLBA 4OPIA 3S7WA 1JOAA 4Z24A 3ICTA 3UKLA 4YSHA 1LPFA 4Z43A 2YG3A 2XFQA 1LVLA 5GSNA 4BK1A 2WPCA 4B69A 4Z26A 4X4JA 3KD9A 4LA1A 3QSMA 1XHCA 1GERA 4CY8A 4YTNA 2GMHA 2XVIA 4H2QA 2WP5A 1N4WA 4EQRA 1IUUA 1IUWA 3CIRA 1MO9A 2WEUA 2A87A 3BI2A 2C72A 2XLSA 4GUVA 3ALLA 5C3JA 3K30A 1TDFA 3AEAA 3DMEA 2HQMA 1DOBA 3AE4A 4IVOB 3VR9A 2B7SA 2YVGA 1VRQB 1M1PA 3AEEA 4JY2A 4GRTA 3QVRA 3NRNA 2GAHB 2XFNA 4U8KA 3UOYA 3BHFA 1S2YA 5JCNA 4GF7A 2X99A 2XFOA 5U1OA 2DKIA 2F5ZA 2WESA 1S3EA 3O0HA 2A8XA 4U8JA 4D03A 2YM2A 1NHRA 5HHFA 2C73A 2EQ8A 1GRGA 1QDBA 1Y0PA 1JRXA 2RF7A 2YG4A 1SEZA 1ZDLA 3F8DA 4FK1A 1FS7A 2PHHA 1BVBA 3LGQA 2EQ6A 2VZ2A 1ELIA 4Z44A 3SXQA 3UU9A 1S3BA 4BJZA 3VQRA 4E0VA 1PBDA 1COYA 4U8LA 2BABA 2ZZ0A 1GT8A 2BACA 3COXA 4P9SA 3DJDA 1H7XA 2GV8A 3II4A 3AYIA 3UOVA 1PXBA 3Q9TA 3VR8A 2YLZA 5M10A 1CHUA 1JNIA 1FCDA 3ICSA 4XXGA 4JY3A 1CC4A 1RYIA 2WDQA 2WETA 3SFDA 2OLOA 3EANA 3ICRA 5BULA 1B8SA 1NAAA 2ZO5A 2X8GA 2R0PA 1OJTA 2WPEA 3HZLA 3NT6A 1CJ2A 2YVFA 1EL5A 2BCGG 2YR4A 3P4RA 4CCRA 4O5QA 4EIPA 2H89A 4Q1OA 4A5LA 5KOWA 1E39A 3BHKA 1QO8A 2VOUA 2B9XA 2QAEA 4OPGA 3NTDA 2C65A 1CBOA 2X3NA 4H4UA 4A79A 2Y6QA 3CNJA 1QJDA 3LJPA 4H4WA 1H7WA 4Q17A 1RSGA 3AEBA 3H8LA 2WDRA 3ISHA 4CNKA 3BNUA 3V3NA 1LTXR 1BKWA 4UDQA 1D4DA 3GDPA 4K7ZA 1K0JA 2V61A 3C96A 4ZCCA 3RP7A 4BK2A 3QFBA 4EM3A 4H4XA 4NZHA 2OALA 5BRTA 3QSEA 2RGJA 3VRDB 3AB1A 3NGCX 1NENA 2RGOA 1YQZA 5L46A 1XDIA 3C4AA 4GCMA 5JCKA 3LADA 2CFYA 2WU2A 2X8HA 3M13A 1TDOA 2X8CA 1NEKA 3IHMA 1REOA 4GR1A 4U2LA 4B68A 4H4ZA 4A9WA 4YSYA 1KNRA 4YSXA 3GD3A 4J56A 1BGNA 4Q0TA 1L9EA 1E6EA 2XVEA 3CNSA 3VRBA 1PBEA 3QSSA 1NDAA 2A89A 2BS4A 2YG6A 3NK0X 1PXAA 3G5QA 4UP3A 4Y4LA 2OT4A 4X9NA 3UCLA 3K7MX 3CGBA 4N9XA 4OCGA 3SGLA 3V76A 3DA1A 3LZWA 4JN9A 3GD4A 2XLRA 3AD9B 2Z5YA 2OAMA 1F8SA 1F8RA 3PS9A 4C74A 4Z2RA 3UOZA 3UBRA 2C75A 4Z2TA 5LV9A 2VR0A 4FX9A 3DK8A 5BUKA 3DJEA 3TTBA 1FEAA 3GRSA 5KVHA 4LU6A 2GQWA 3UOXA 1IUXA 4J31A 4H4PA 3AEDA 2YG7A 2WHDA 4U8OA 4YTMA 5TR3A 2BK4A 3CNDA 3I3LA 2JB2A 3BNMA 3P9UA 5U63A 2YLTA 5EOWA 1NHSA 1B37A 2GR3A 2R4JA 4H4SA 4L3YA 3LXDA 4IVMB 4MJWA 1GETA 1GV4A 3UP5A 3F29A 1N1PA 2XYOA 2YLXA 2QA1A 3GMBA 2BCPA 2VRLA 1H83A 1H81A 4GDEA 2FJEA 1TDKA 5IQ1A 3NLCA 3OC4A 3KLJA 2RABA 4CBQA 1CL0A 2JBVA 3IHGA 4B1BA 4DNAA 1UKVG 2WS3A 4FDCB 2Z5XA 5BVAA 1NG3A 4ICYA 2VQBA 3PVCA 3UKPA 2YR5A 1IUTA 2E4GA 2V3AA 4APNA 4TM4A 4EMIA 4K22A 3WE0A 1KFYA 1NPXA 3SFEA 3ZDNA 1IUVA 1N4VA 3L1RA 1CJ3A 1EL8A 4JDRA 3REDA 1DOCA 3T37A 1S2QA 2FBWA 4RG3A 4C3XA 3UKAA 4IV9A 4CCQA 2V5ZA 3EF6A 3NYEA 4REKA 2C3CA 3BNFA 3G5SA 1ZMCA 5JCLA 4Q5BA 3BNHA 3QVPA 1XPQA 3URHA 1H86A 2XVJA 3UP4A 2WQYA 4H50A 1K0IA 1D4CA 1OJAA 2XVFA 5FMHA 4BV6A 2R0GA 4OPCA 2V6OA 4RSLA 2XLUA 2GEWA 1DJNA 3AE1A 3NNEA 3EPTA 1DJQA 2VVLA 2WP6A 3K7TA 1RP0A 4K5RA 3RKHA 4BK3A 4H4YA 1FT6A 1DOEA 1PJ5A 4DSGA 4LIIA 3D8XA 4EQWA 1B5QA 1GRBA 2GRTA 2BC0A 2I0ZA 2YLWA 1JEHA 3CNPA 4U8MA 3GRTA 4H4RA 4H7UA 3Q6JA 3D1IA 3LG1A 5HXIA 2APGA 3H4KA 2AAQA 2LFCA 3DK4A 4EM4A 1GREA 3GWFA 2ZZBA 2V3BA 4NTEA 4YT0A 3S61A 3PO7A 1PXCA 1PBFA 1HYUA 1CJ4A 1IJHA 2E5VA 4JQ9A 3ATQA 5C2TA 4I59A 4H4TA 2RDZA 1BGJA 1NHQA 1DXLA 1YQ4A 1TRBA 2JB3A 4HA6A 4U8NA 2C3DA 1D4EA 3CN8A 1KNPA 3ADAB 4YKGA 3NKSA 2WBAA 3CPIG 3EAOA 3LOVA 3AE3A 3NHOX 1JRYA 2JB1A 1ZMDA 2YQUA 4B65A 3CPHG 2WOWA 1E1MA 2CVJA 1AOGA 3UKQA 2R46A 4NTCA 4CRTA 4OPTA 1GOSA 2WU5A 3NTAA 2YR6A 1VDCA 5M0ZA 3IF9A 4X9MA 1YKJA 3DGZA 2VRMA 3LZXA 3AE5A 1P2EA 2ZZCA 2E80A 2Q6UA 3P4PA 2OLNA 1BF3A 1CF3A 1E7PA 1H6VA 3BI5A 3L8KA 2JK6A 3AD8B 3ITJA 4TM0A 3IC9A 1BWCA 1PHHA 3S5WA 4ECHA 4EQXA 3CGDA 2W0HA 2YWLA 1K4QA 1V59A 2R45A 2R4EA 3NN0X 3GWDA 1GTHA 5ER0A 1PDHA 4D04A 3C4NA 2C67A
chains in the Genus database with same CATH superfamily
1OJCA 2GB0A 1M64A 1GTEA 4EQSA 4OPDA 3GDNA 3NYCA 3OZ2A 4OVIA 3UTHA 1KF6A 5J60A 4YWOA 1PS9A 2IVDA 5KMPA 3AE8A 3DJGX 4GDPA 3T2ZA 4KPRA 5EB4A 1ZX9A 1E1LA 3B3RA 4TM1A 1TYTA 3NN6X 4EMJA 1IUSA 1X31B 2AQJA 4O5UA 2XLPA 3OWMA 1GPEA 4USRA 2B7RA 2K3VA 1Q9IA 1TDNA 2CDUA 1ZY8A 2B9WA 2VVMA 3KU9A 1CC2A 1YQ3A 2FJDA 1MXTA 2GR0A 4H2RA 3RP6A 4C77A 4WJYA 2BA9A 4WX1A 5IQ4A 3MMOA 3DK9A 3DH9A 3FIMB 3F8RA 1GU6A 5U25A 2E81A 3B6DA 4ZN0A 4HB9A 4GAVA 5DBJA 4ZCDA 5FS8A 4H2NA 3D1CA 3AYJA 5EB5A 1F8WA 5HY5A 4USQA 3GMCA 2ZBWA 3SZ0A 4K2XA 3QFAA 2B9YA 2J3NA 2BK5A 3ATRA 1Y56B 3KVEA 1KSUA 2X50A 2XCGA 1ZKQA 2C7GA 1FOHA 2WP9A 4NEVA 1GRHA 5KXJA 1PBCA 2O9ZA 3AE9A 1M1RA 1XANA 4K8DA 4H2PA 4H4VA 1M1QA 5FS7A 3FMWA 1JNZA 1GESA 1O95A 3ZYXA 4PAAA 4AP1A 1GSNA 1L9CA 1TDEA 4A65A 4CNJA 2ARDA 2V60A 4XWZA 5KWFA 4H4QA 3SXIA 4G73A 4YTPA 2GMJA 2BYBA 3BNGA 3CGCA 4UDRA 3AWIA 3T14A 2VQ7A 3L1TA 1P2HA 1GRTA 3SZWA 4K5SA 3NYFA 4A99A 2QCUA 1OAHA 4A6NA 2BS3A 3AECA 5CKUA 1Q1WA 4Y4NA 1LJ1A 2YAUA 2BK3A 5KVIA 2PYXA 1F6MA 2WDVA 1D7LA 3AEFA 3K7QX 3NH3X 3KA7A 5IPYA 3KPFA 4TLXA 3AYLA 4UDPA 4TM3A 2BXSA 4JNQA 1GRAA 3UTGA 2OA1A 4BURA 2GVCA 1OJDA 1ONFA 1ZOYA 4A7AA 2Q7VA 1K0LA 4NEWA 4PABA 1FS8A 3RHAA 3AXBA 3NIXA 3FO3A 4AOXA 1DNCA 2FJBA 2YVJA 3FBSA 4Q4UA 2R9ZA 3RNMA 5HYMA 2EQ9A 4ADWA 2BRAA 3SYIA 1Q1RA 2ACZA 2EQ7A 2WOVA 1BZLA 1L9DA 4J34A 4IA6A 4J33A 1EBDA 1M6IA 1O94A 3E1TA 1DODA 2YM1A 3TORA 4J2WA 2BS2A 4JNAA 4NNJA 2GH5A 3GYJA 4YKFA 2FJAA 1SP3A 1Y56A 4U2TA 5KRQA 2IIDA 3UTEA 1OJ9A 3ABVA 1ZOVA 3CNTA 3BI4A 2XFUA 2J7AA 1PJ7A 5FS6A 4L3XA 2R0CA 2C64A 1N4UA 1FS9A 2H88A 3CTYA 4L3ZA 3NK1X 2TMDA 5FS9A 3LB8A 2QA2A 4U2SA 1CJCA 1NG4A 4CY6A 1GEUA 2JKCA 2B76A 4Y4MA 1H82A 4B64A 5JCIA 2YLRA 3GYXA 2NPXA 2CULA 4OPLA 4EIQA 4C3YA 1LV0A 3SZFA 3SM8A 4EMWA 1GNDA 4J57A 3UKKA 2GQFA 2GR1A 1H84A 1FEBA 2E1MA 2UZZA 3CPJG 4A6NB 5J7XA 3UKHA 4I58A 4B63A 3RP8A 1PBBA 3DGHA 4WCTA 3AE6A 3FPZA 1JU2A 3IWAA 1ZP0A 1GRFA 1O5WA 3SQPA 1JRZA 2WOIA 3AD7B 3ALJA 3AE7A 3M0OA 4AOSA 3F8PA 5CQFA 2YG5A 3HYXA 4M52A 3R9UA 1VG0A 3QJ4A 3AEGA 1FL2A 3P4QA 2Q0KA 3JSKA 4NTDA 4L38A 5JCMA 4C5OA 1PN0A 1KSSA 4DGKA 1KDGA 3DJJA 2DKHA 3GYIA 1TYPA 4XWRA 3SX6A 3CGEA 4TLZA 4Z25A 3P1WA 3NG7X 5GRTA 2NVKX 4OPUA 4Q5CA 4II3A 3GM6A 1F3PA 1LQTA 2YLSA 4IA5A 1EL9A 1CC6A 2Q0LA 2WPFA 1B4VA 4AP3A 4U8PA 1YY5A 4J36A 2TPRA 3NK2X 3P4SA 4AT2A 2IVEA 1LQUA 1VG9A 2GAGB 5EBKA 1GXFA 3T2YA 1ZK7A 2RGHA 3GSIA 1D5TA 4DSHA 5KOXA 2GF3A 3KKJA 1PJ6A 2XDOA 4Z2UA 1D7YA 4KX6A 2C70A 2XVHA 3G5RA 1L0VA 2BXRA 4BJYA 2BC1A 1FECA 4AT0A 1FT5A 2C66A 2XLTA 4U8IA 3H8IA 1E1KA 3AE2A 2XFPA 3UTFA 3ALMA 2VVLG 1W4XA 3I6DA 1Z6LA 4RG4A 1NHPA 1VQWA 3FG2P 1MOKA 3UKFA 4B66A 1E1NA 4B67A 4FK1C 4YSZA 2AR8A 2Y6RA 3M12A 2JAEA 1EL7A 2C76A 1GALA 3BNJA 1JNRA 3V3OA 3VRAA 4YXDA 2GR2A 3SCEA 1QLBA 4OPIA 3S7WA 1JOAA 4Z24A 3ICTA 3UKLA 4YSHA 1LPFA 4Z43A 2YG3A 2XFQA 1LVLA 5GSNA 4BK1A 2WPCA 4B69A 4Z26A 4X4JA 3KD9A 4LA1A 3QSMA 4G74A 1XHCA 1GERA 4CY8A 4YTNA 2GMHA 2XVIA 5KMQA 4H2QA 2WP5A 1N4WA 4EQRA 1IUUA 1IUWA 3CIRA 1MO9A 2WEUA 2A87A 3BI2A 2C72A 2XLSA 4GUVA 3ALLA 5C3JA 3K30A 1TDFA 3AEAA 3DMEA 2HQMA 1DOBA 3AE4A 4IVOB 3VR9A 2B7SA 2YVGA 1VRQB 1M1PA 3AEEA 4JY2A 4GRTA 3QVRA 3NRNA 2GAHB 2XFNA 4U8KA 3UOYA 3BHFA 1S2YA 5JCNA 4GF7A 2X99A 2XFOA 5U1OA 2DKIA 2F5ZA 2WESA 1S3EA 3O0HA 2A8XA 4U8JA 4D03A 2YM2A 1NHRA 3HYWA 5HHFA 4GAPA 4II2A 2C73A 2EQ8A 1GRGA 1QDBA 1Y0PA 1JRXA 2RF7A 2C4CA 2YG4A 1SEZA 4G6HA 1ZDLA 3F8DA 4FK1A 1FS7A 2PHHA 1BVBA 3LGQA 2EQ6A 2VZ2A 1ELIA 4Z44A 3SXQA 3UU9A 1S3BA 4BJZA 3VQRA 4E0VA 1PBDA 1COYA 4U8LA 2BABA 2ZZ0A 1GT8A 2BACA 3COXA 4P9SA 3DJDA 1H7XA 2GV8A 3II4A 3AYIA 3HYVA 1PXBA 3Q9TA 3UOVA 2YLZA 3VR8A 1CHUA 5M10A 1JNIA 1FCDA 3ICSA 4XXGA 4JY3A 1CC4A 1RYIA 2WDQA 2WETA 3SFDA 2OLOA 3EANA 3ICRA 5BULA 1B8SA 1NAAA 2ZO5A 2X8GA 3T0KA 2R0PA 1OJTA 2WPEA 3HZLA 3NT6A 1CJ2A 2YVFA 1EL5A 2BCGG 2YR4A 3P4RA 4CCRA 4O5QA 4EIPA 2H89A 4Q1OA 4A5LA 5KOWA 1E39A 3BHKA 4NWZA 1QO8A 2VOUA 2B9XA 2QAEA 4OPGA 3NTDA 2C65A 1CBOA 2X3NA 4H4UA 4A79A 2Y6QA 3CNJA 1QJDA 3LJPA 4H4WA 1H7WA 4Q17A 1RSGA 3AEBA 3H8LA 2WDRA 3ISHA 4CNKA 3BNUA 3V3NA 1LTXR 1BKWA 4UDQA 1D4DA 3GDPA 4K7ZA 1K0JA 3KPKA 2V61A 3C96A 4ZCCA 3RP7A 4BK2A 3QFBA 4EM3A 4H4XA 4NZHA 2OALA 5BRTA 3QSEA 2RGJA 3VRDB 3AB1A 3NGCX 1NENA 2RGOA 1YQZA 5L46A 5KMRA 1XDIA 3C4AA 4GCMA 5JCKA 3LADA 2CFYA 2WU2A 2X8HA 3M13A 1TDOA 2X8CA 1NEKA 3IHMA 1REOA 4GR1A 4U2LA 4B68A 4H4ZA 4A9WA 4YSYA 1KNRA 4YSXA 3GD3A 4J56A 3T2KA 1BGNA 4Q0TA 1L9EA 1E6EA 2XVEA 3CNSA 3VRBA 1PBEA 3QSSA 1NDAA 2A89A 2BS4A 2YG6A 3NK0X 1PXAA 3G5QA 4UP3A 4Y4LA 2OT4A 4X9NA 3UCLA 3SZCA 3K7MX 3CGBA 4N9XA 4OCGA 3SGLA 3V76A 3DA1A 3LZWA 4JN9A 3GD4A 2XLRA 3AD9B 2Z5YA 2OAMA 1F8SA 1F8RA 3PS9A 4C74A 4Z2RA 3UOZA 3UBRA 2C75A 4Z2TA 5LV9A 2VR0A 4FX9A 3DK8A 5BUKA 3DJEA 3TTBA 1FEAA 3GRSA 5KVHA 4LU6A 2GQWA 3UOXA 1IUXA 4J31A 4H4PA 3AEDA 2YG7A 2WHDA 4U8OA 4YTMA 5TR3A 2BK4A 3CNDA 3I3LA 2JB2A 3BNMA 3P9UA 5U63A 2YLTA 5EOWA 1NHSA 1B37A 2GR3A 2R4JA 4H4SA 4L3YA 3LXDA 4IVMB 4MJWA 1GETA 1GV4A 3UP5A 3F29A 1N1PA 2XYOA 2YLXA 2QA1A 3GMBA 2BCPA 2VRLA 5KNLA 1H83A 1H81A 4GDEA 2FJEA 1TDKA 5IQ1A 3NLCA 3OC4A 3KLJA 2RABA 4CBQA 1CL0A 2JBVA 3IHGA 4B1BA 4DNAA 1UKVG 2WS3A 4FDCB 2Z5XA 5BVAA 1NG3A 4ICYA 3SY4A 2BRYA 2VQBA 3PVCA 3UKPA 2YR5A 1IUTA 2E4GA 2V3AA 4APNA 4TM4A 4EMIA 4K22A 3WE0A 1KFYA 1NPXA 3SFEA 3ZDNA 1IUVA 1N4VA 3L1RA 1CJ3A 1EL8A 4JDRA 3REDA 1DOCA 3T37A 1S2QA 2FBWA 4G9KA 4RG3A 4C3XA 3UKAA 4IV9A 4CCQA 2V5ZA 3EF6A 3NYEA 4REKA 2C3CA 3BNFA 3G5SA 1ZMCA 5JCLA 4Q5BA 3BNHA 3QVPA 1XPQA 3URHA 1H86A 2XVJA 3UP4A 2WQYA 4H50A 1K0IA 1D4CA 1OJAA 2XVFA 5FMHA 4BV6A 2R0GA 4OPCA 2V6OA 4RSLA 2XLUA 2GEWA 1DJNA 3AE1A 3NNEA 3EPTA 1DJQA 2VVLA 2WP6A 3K7TA 1RP0A 4K5RA 5KMSA 3RKHA 4BK3A 4H4YA 1FT6A 1DOEA 1PJ5A 4DSGA 4LIIA 3D8XA 4EQWA 1B5QA 1GRBA 3T31A 2GRTA 2BC0A 2I0ZA 2YLWA 1JEHA 3CNPA 4U8MA 3GRTA 4H4RA 4H7UA 3Q6JA 3D1IA 3LG1A 5HXIA 2APGA 3H4KA 2AAQA 2LFCA 3DK4A 4EM4A 1GREA 3GWFA 2ZZBA 2V3BA 4NTEA 4YT0A 3S61A 3PO7A 1PXCA 1PBFA 1HYUA 1CJ4A 1IJHA 2E5VA 4JQ9A 3ATQA 5C2TA 4I59A 4H4TA 2RDZA 1BGJA 1NHQA 1DXLA 1YQ4A 1TRBA 2JB3A 4HA6A 2CZSA 4U8NA 2C3DA 3CMMA 1D4EA 3CN8A 1KNPA 3ADAB 4YKGA 3NKSA 2WBAA 3CPIG 3EAOA 3LOVA 3AE3A 3NHOX 1JRYA 2JB1A 1ZMDA 2YQUA 4B65A 3CPHG 2WOWA 1E1MA 2CVJA 1AOGA 3UKQA 2R46A 4NTCA 4CRTA 4OPTA 1GOSA 2WU5A 3NTAA 2YR6A 1VDCA 5M0ZA 3IF9A 4X9MA 1YKJA 3DGZA 2VRMA 3LZXA 3AE5A 1P2EA 2ZZCA 2E80A 2Q6UA 3P4PA 2OLNA 1BF3A 1CF3A 4G6GA 1E7PA 1H6VA 3BI5A 3L8KA 2JK6A 3AD8B 3ITJA 4TM0A 3IC9A 1BWCA 1PHHA 3S5WA 4ECHA 4EQXA 3CGDA 2W0HA 2YWLA 1K4QA 1V59A 2R45A 2R4EA 3NN0X 3GWDA 1GTHA 5ER0A 1PDHA 4D04A 3C4NA 2C67A
chains in the Genus database with same CATH topology
1OJCA 2GB0A 1M64A 1GTEA 4EQSA 4OPDA 3GDNA 3NYCA 3OZ2A 4OVIA 3UTHA 1KF6A 5J60A 4YWOA 1PS9A 2IVDA 5KMPA 3AE8A 3DJGX 4GDPA 3T2ZA 4KPRA 5EB4A 1ZX9A 1E1LA 3B3RA 4TM1A 1TYTA 3NN6X 4EMJA 1IUSA 1X31B 2AQJA 4O5UA 2XLPA 3OWMA 1GPEA 4USRA 2B7RA 2K3VA 1Q9IA 1TDNA 2CDUA 1ZY8A 2B9WA 2VVMA 3KU9A 1CC2A 1YQ3A 2FJDA 1MXTA 2GR0A 4H2RA 3RP6A 4C77A 4WJYA 2BA9A 4WX1A 5IQ4A 3MMOA 3DK9A 3DH9A 3FIMB 3F8RA 1GU6A 5U25A 2E81A 3B6DA 4ZN0A 4HB9A 4GAVA 5DBJA 4ZCDA 5FS8A 4H2NA 3D1CA 3AYJA 5EB5A 1F8WA 5HY5A 4USQA 3GMCA 2ZBWA 3SZ0A 4K2XA 3QFAA 2B9YA 2J3NA 2BK5A 3ATRA 1Y56B 3KVEA 1KSUA 2X50A 2XCGA 1ZKQA 2C7GA 1FOHA 2WP9A 4NEVA 1GRHA 5KXJA 1PBCA 2O9ZA 3AE9A 1M1RA 1XANA 4K8DA 4H2PA 4H4VA 1M1QA 5FS7A 3FMWA 1JNZA 1GESA 1O95A 3ZYXA 4PAAA 4AP1A 1GSNA 1L9CA 1TDEA 4A65A 4CNJA 2ARDA 2V60A 4XWZA 5KWFA 4H4QA 3SXIA 4G73A 4YTPA 2GMJA 2BYBA 3BNGA 3CGCA 4UDRA 3AWIA 3T14A 2VQ7A 3L1TA 1P2HA 1GRTA 3SZWA 4K5SA 3NYFA 4A99A 2QCUA 1OAHA 4A6NA 2BS3A 3AECA 5CKUA 1Q1WA 4Y4NA 1LJ1A 2YAUA 2BK3A 5KVIA 2PYXA 1F6MA 2WDVA 1D7LA 3AEFA 3K7QX 3NH3X 3KA7A 5IPYA 3KPFA 4TLXA 3AYLA 4UDPA 4TM3A 2BXSA 4JNQA 1GRAA 3UTGA 2OA1A 4BURA 2GVCA 1OJDA 1ONFA 1ZOYA 4A7AA 2Q7VA 1K0LA 4NEWA 4PABA 1FS8A 3RHAA 3AXBA 3NIXA 3FO3A 4AOXA 1DNCA 2FJBA 2YVJA 3FBSA 4Q4UA 2R9ZA 3RNMA 5HYMA 2EQ9A 4ADWA 2BRAA 3SYIA 1Q1RA 2ACZA 2EQ7A 2WOVA 1BZLA 1L9DA 4J34A 4IA6A 4J33A 1EBDA 1M6IA 1O94A 3E1TA 1DODA 2YM1A 3TORA 4J2WA 2BS2A 4JNAA 4NNJA 2GH5A 3GYJA 4YKFA 2FJAA 1SP3A 1Y56A 4U2TA 5KRQA 2IIDA 3UTEA 1OJ9A 3ABVA 1ZOVA 3CNTA 3BI4A 2XFUA 2J7AA 1PJ7A 5FS6A 4L3XA 2R0CA 2C64A 1N4UA 1FS9A 2H88A 3CTYA 4L3ZA 3NK1X 2TMDA 5FS9A 3LB8A 2QA2A 4U2SA 1CJCA 1NG4A 4CY6A 1GEUA 2JKCA 2B76A 4Y4MA 1H82A 4B64A 5JCIA 2YLRA 3GYXA 2NPXA 2CULA 4OPLA 4EIQA 4C3YA 1LV0A 3SZFA 3SM8A 4EMWA 1GNDA 4J57A 3UKKA 2GQFA 2GR1A 1H84A 1FEBA 2E1MA 2UZZA 3CPJG 4A6NB 5J7XA 3UKHA 4I58A 4B63A 3RP8A 1PBBA 3DGHA 4WCTA 3AE6A 3FPZA 1JU2A 3IWAA 1ZP0A 1GRFA 1O5WA 3SQPA 1JRZA 2WOIA 3AD7B 3ALJA 3AE7A 3M0OA 4AOSA 3F8PA 5CQFA 2YG5A 3HYXA 4M52A 3R9UA 1VG0A 3QJ4A 3AEGA 1FL2A 3P4QA 2Q0KA 3JSKA 4NTDA 4L38A 5JCMA 4C5OA 1PN0A 1KSSA 4DGKA 1KDGA 3DJJA 2DKHA 3GYIA 1TYPA 4XWRA 3SX6A 3CGEA 4TLZA 4Z25A 3P1WA 3NG7X 5GRTA 2NVKX 4OPUA 4Q5CA 4II3A 3GM6A 1F3PA 1LQTA 2YLSA 4IA5A 1EL9A 1CC6A 2Q0LA 2WPFA 1B4VA 4AP3A 4U8PA 1YY5A 4J36A 2TPRA 3NK2X 3P4SA 4AT2A 2IVEA 1LQUA 1VG9A 2GAGB 5EBKA 1GXFA 3T2YA 1ZK7A 2RGHA 3GSIA 1D5TA 4DSHA 5KOXA 2GF3A 3KKJA 1PJ6A 2XDOA 4Z2UA 1D7YA 4KX6A 2C70A 2XVHA 3G5RA 1L0VA 2BXRA 4BJYA 2BC1A 1FECA 4AT0A 1FT5A 2C66A 2XLTA 4U8IA 3H8IA 1E1KA 3AE2A 2XFPA 3UTFA 3ALMA 2VVLG 1W4XA 3I6DA 1Z6LA 4RG4A 1NHPA 1VQWA 3FG2P 1MOKA 3UKFA 4B66A 1E1NA 4B67A 4FK1C 4YSZA 2AR8A 2Y6RA 3M12A 2JAEA 1EL7A 2C76A 1GALA 3BNJA 1JNRA 3V3OA 3VRAA 4YXDA 2GR2A 3SCEA 1QLBA 4OPIA 3S7WA 1JOAA 4Z24A 3ICTA 3UKLA 4YSHA 1LPFA 4Z43A 2YG3A 2XFQA 1LVLA 5GSNA 4BK1A 2WPCA 4B69A 4Z26A 4X4JA 3KD9A 4LA1A 3QSMA 4G74A 1XHCA 1GERA 4CY8A 4YTNA 2GMHA 2XVIA 5KMQA 4H2QA 2WP5A 1N4WA 4EQRA 1IUUA 1IUWA 3CIRA 1MO9A 2WEUA 2A87A 3BI2A 2C72A 2XLSA 4GUVA 3ALLA 5C3JA 3K30A 1TDFA 3AEAA 3DMEA 2HQMA 1DOBA 3AE4A 4IVOB 3VR9A 2B7SA 2YVGA 1VRQB 1M1PA 3AEEA 4JY2A 4GRTA 3QVRA 3NRNA 2GAHB 2XFNA 4U8KA 3UOYA 3BHFA 1S2YA 5JCNA 4GF7A 2X99A 2XFOA 5U1OA 2DKIA 2F5ZA 2WESA 1S3EA 3O0HA 2A8XA 4U8JA 4D03A 2YM2A 1NHRA 3HYWA 5HHFA 4GAPA 4II2A 2C73A 2EQ8A 1GRGA 1QDBA 1Y0PA 1JRXA 2RF7A 2C4CA 2YG4A 1SEZA 4G6HA 1ZDLA 3F8DA 4FK1A 1FS7A 2PHHA 1BVBA 3LGQA 2EQ6A 2VZ2A 1ELIA 4Z44A 3SXQA 3UU9A 1S3BA 4BJZA 3VQRA 4E0VA 1PBDA 1COYA 4U8LA 2BABA 2ZZ0A 1GT8A 2BACA 3COXA 4P9SA 3DJDA 1H7XA 2GV8A 3II4A 3AYIA 3HYVA 1PXBA 3Q9TA 3UOVA 2YLZA 3VR8A 1CHUA 5M10A 1JNIA 1FCDA 3ICSA 4XXGA 4JY3A 1CC4A 1RYIA 2WDQA 2WETA 3SFDA 2OLOA 3EANA 3ICRA 5BULA 1B8SA 1NAAA 2ZO5A 2X8GA 3T0KA 2R0PA 1OJTA 2WPEA 3HZLA 3NT6A 1CJ2A 2YVFA 1EL5A 2BCGG 2YR4A 3P4RA 4CCRA 4O5QA 4EIPA 2H89A 4Q1OA 4A5LA 5KOWA 1E39A 3BHKA 4NWZA 1QO8A 2VOUA 2B9XA 2QAEA 4OPGA 3NTDA 2C65A 1CBOA 2X3NA 4H4UA 4A79A 2Y6QA 3CNJA 1QJDA 3LJPA 4H4WA 1H7WA 4Q17A 1RSGA 3AEBA 3H8LA 2WDRA 3ISHA 4CNKA 3BNUA 3V3NA 1LTXR 1BKWA 4UDQA 1D4DA 3GDPA 4K7ZA 1K0JA 3KPKA 2V61A 3C96A 4ZCCA 3RP7A 4BK2A 3QFBA 4EM3A 4H4XA 4NZHA 2OALA 5BRTA 3QSEA 2RGJA 3VRDB 3AB1A 3NGCX 1NENA 2RGOA 1YQZA 5L46A 5KMRA 1XDIA 3C4AA 4GCMA 5JCKA 3LADA 2CFYA 2WU2A 2X8HA 3M13A 1TDOA 2X8CA 1NEKA 3IHMA 1REOA 4GR1A 4U2LA 4B68A 4H4ZA 4A9WA 4YSYA 1KNRA 4YSXA 3GD3A 4J56A 3T2KA 1BGNA 4Q0TA 1L9EA 1E6EA 2XVEA 3CNSA 3VRBA 1PBEA 3QSSA 1NDAA 2A89A 2BS4A 2YG6A 3NK0X 1PXAA 3G5QA 4UP3A 4Y4LA 2OT4A 4X9NA 3UCLA 3SZCA 3K7MX 3CGBA 4N9XA 4OCGA 3SGLA 3V76A 3DA1A 3LZWA 4JN9A 3GD4A 2XLRA 3AD9B 2Z5YA 2OAMA 1F8SA 1F8RA 3PS9A 4C74A 4Z2RA 3UOZA 3UBRA 2C75A 4Z2TA 5LV9A 2VR0A 4FX9A 3DK8A 5BUKA 3DJEA 3TTBA 1FEAA 3GRSA 5KVHA 4LU6A 2GQWA 3UOXA 1IUXA 4J31A 4H4PA 3AEDA 2YG7A 2WHDA 4U8OA 4YTMA 5TR3A 2BK4A 3CNDA 3I3LA 2JB2A 3BNMA 3P9UA 5U63A 2YLTA 5EOWA 1NHSA 1B37A 2GR3A 2R4JA 4H4SA 4L3YA 3LXDA 4IVMB 4MJWA 1GETA 1GV4A 3UP5A 3F29A 1N1PA 2XYOA 2YLXA 2QA1A 3GMBA 2BCPA 2VRLA 5KNLA 1H83A 1H81A 4GDEA 2FJEA 1TDKA 5IQ1A 3NLCA 3OC4A 3KLJA 2RABA 4CBQA 1CL0A 2JBVA 3IHGA 4B1BA 4DNAA 1UKVG 2WS3A 4FDCB 2Z5XA 5BVAA 1NG3A 4ICYA 3SY4A 2BRYA 2VQBA 3PVCA 3UKPA 2YR5A 1IUTA 2E4GA 2V3AA 4APNA 4TM4A 4EMIA 4K22A 3WE0A 1KFYA 1NPXA 3SFEA 3ZDNA 1IUVA 1N4VA 3L1RA 1CJ3A 1EL8A 4JDRA 3REDA 1DOCA 3T37A 1S2QA 2FBWA 4G9KA 4RG3A 4C3XA 3UKAA 4IV9A 4CCQA 2V5ZA 3EF6A 3NYEA 4REKA 2C3CA 3BNFA 3G5SA 1ZMCA 5JCLA 4Q5BA 3BNHA 3QVPA 1XPQA 3URHA 1H86A 2XVJA 3UP4A 2WQYA 4H50A 1K0IA 1D4CA 1OJAA 2XVFA 5FMHA 4BV6A 2R0GA 4OPCA 2V6OA 4RSLA 2XLUA 2GEWA 1DJNA 3AE1A 3NNEA 3EPTA 1DJQA 2VVLA 2WP6A 3K7TA 1RP0A 4K5RA 5KMSA 3RKHA 4BK3A 4H4YA 1FT6A 1DOEA 1PJ5A 4DSGA 4LIIA 3D8XA 4EQWA 1B5QA 1GRBA 3T31A 2GRTA 2BC0A 2I0ZA 2YLWA 1JEHA 3CNPA 4U8MA 3GRTA 4H4RA 4H7UA 3Q6JA 3D1IA 3LG1A 5HXIA 2APGA 3H4KA 2AAQA 2LFCA 3DK4A 4EM4A 1GREA 3GWFA 2ZZBA 2V3BA 4NTEA 4YT0A 3S61A 3PO7A 1PXCA 1PBFA 1HYUA 1CJ4A 1IJHA 2E5VA 4JQ9A 3ATQA 5C2TA 4I59A 4H4TA 2RDZA 1BGJA 1NHQA 1DXLA 1YQ4A 1TRBA 2JB3A 4HA6A 4U8NA 2C3DA 3CMMA 1D4EA 3CN8A 1KNPA 3ADAB 4YKGA 3NKSA 2WBAA 3CPIG 3EAOA 3LOVA 3AE3A 3NHOX 1JRYA 2JB1A 1ZMDA 2YQUA 4B65A 3CPHG 2WOWA 1E1MA 2CVJA 1AOGA 3UKQA 2R46A 4NTCA 4CRTA 4OPTA 1GOSA 2WU5A 3NTAA 2YR6A 1VDCA 5M0ZA 3IF9A 4X9MA 1YKJA 3DGZA 2VRMA 3LZXA 3AE5A 1P2EA 2ZZCA 2E80A 2Q6UA 3P4PA 2OLNA 1BF3A 1CF3A 4G6GA 1E7PA 1H6VA 3BI5A 3L8KA 2JK6A 3AD8B 3ITJA 4TM0A 3IC9A 1BWCA 1PHHA 3S5WA 4ECHA 4EQXA 3CGDA 2W0HA 2YWLA 1K4QA 1V59A 2R45A 2R4EA 3NN0X 3GWDA 1GTHA 5ER0A 1PDHA 4D04A 3C4NA 2C67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJC A;  2GB0 A;  1M64 A;  1GTE A;  4EQS A;  4OPD A;  3GDN A;  3NYC A;  3OZ2 A;  4OVI A;  3UTH A;  1KF6 A;  5J60 A;  4YWO A;  1PS9 A;  2IVD A;  3AE8 A;  3DJG X;  4GDP A;  4KPR A;  5EB4 A;  1ZX9 A;  1E1L A;  3B3R A;  4TM1 A;  1TYT A;  3NN6 X;  4EMJ A;  1IUS A;  1X31 B;  2AQJ A;  4O5U A;  2XLP A;  3OWM A;  1GPE A;  4USR A;  2B7R A;  2K3V A;  1Q9I A;  1TDN A;  2CDU A;  1ZY8 A;  2B9W A;  2VVM A;  3KU9 A;  1CC2 A;  1YQ3 A;  2FJD A;  1MXT A;  2GR0 A;  4H2R A;  3RP6 A;  4C77 A;  4WJY A;  2BA9 A;  4WX1 A;  5IQ4 A;  3MMO A;  3DK9 A;  3DH9 A;  3FIM B;  3F8R A;  1GU6 A;  5U25 A;  2E81 A;  3B6D A;  4ZN0 A;  4HB9 A;  5DBJ A;  4ZCD A;  5FS8 A;  4H2N A;  3D1C A;  3AYJ A;  5EB5 A;  1F8W A;  5HY5 A;  4USQ A;  3GMC A;  2ZBW A;  4K2X A;  3QFA A;  2B9Y A;  2J3N A;  2BK5 A;  3ATR A;  1Y56 B;  3KVE A;  1KSU A;  2X50 A;  2XCG A;  1ZKQ A;  2C7G A;  1FOH A;  2WP9 A;  4NEV A;  1GRH A;  5KXJ A;  1PBC A;  2O9Z A;  3AE9 A;  1M1R A;  1XAN A;  4K8D A;  4H2P A;  4H4V A;  1M1Q A;  5FS7 A;  3FMW A;  1JNZ A;  1GES A;  1O95 A;  3ZYX A;  4PAA A;  4AP1 A;  1GSN A;  1L9C A;  1TDE A;  4A65 A;  4CNJ A;  2ARD A;  2V60 A;  4XWZ A;  5KWF A;  4H4Q A;  4YTP A;  2GMJ A;  2BYB A;  3BNG A;  3CGC A;  4UDR A;  3AWI A;  2VQ7 A;  3L1T A;  1P2H A;  1GRT A;  4A99 A;  4K5S A;  3NYF A;  2QCU A;  1OAH A;  4A6N A;  2BS3 A;  3AEC A;  5CKU A;  1Q1W A;  4Y4N A;  1LJ1 A;  2YAU A;  2BK3 A;  5KVI A;  2PYX A;  1F6M A;  2WDV A;  1D7L A;  3AEF A;  3K7Q X;  3NH3 X;  3KA7 A;  5IPY A;  3KPF A;  4TLX A;  3AYL A;  4UDP A;  4TM3 A;  2BXS A;  4JNQ A;  1GRA A;  3UTG A;  2OA1 A;  4BUR A;  2GVC A;  1OJD A;  1ONF A;  1ZOY A;  4A7A A;  2Q7V A;  1K0L A;  4NEW A;  4PAB A;  1FS8 A;  3RHA A;  3AXB A;  3NIX A;  3FO3 A;  4AOX A;  1DNC A;  2FJB A;  2YVJ A;  3FBS A;  4Q4U A;  2R9Z A;  3RNM A;  5HYM A;  2EQ9 A;  4ADW A;  1Q1R A;  2ACZ A;  2EQ7 A;  2WOV A;  1BZL A;  1L9D A;  4J34 A;  4IA6 A;  4J33 A;  1EBD A;  1M6I A;  1O94 A;  3E1T A;  1DOD A;  2YM1 A;  3TOR A;  4J2W A;  2BS2 A;  4JNA A;  4YKF A;  2GH5 A;  3GYJ A;  2FJA A;  1SP3 A;  1Y56 A;  4U2T A;  5KRQ A;  2IID A;  3UTE A;  1OJ9 A;  3ABV A;  1ZOV A;  3CNT A;  3BI4 A;  2XFU A;  2J7A A;  1PJ7 A;  5FS6 A;  4L3X A;  2R0C A;  2C64 A;  1N4U A;  1FS9 A;  2H88 A;  3CTY A;  4L3Z A;  3NK1 X;  2TMD A;  5FS9 A;  3LB8 A;  2QA2 A;  4U2S A;  1CJC A;  1NG4 A;  4CY6 A;  1GEU A;  2JKC A;  2B76 A;  4Y4M A;  1H82 A;  4B64 A;  5JCI A;  2YLR A;  3GYX A;  2NPX A;  2CUL A;  4OPL A;  4EIQ A;  4C3Y A;  1LV0 A;  3SM8 A;  4EMW A;  1GND A;  4J57 A;  3UKK A;  2GQF A;  2GR1 A;  1H84 A;  1FEB A;  2E1M A;  2UZZ A;  3CPJ G;  4A6N B;  5J7X A;  3UKH A;  4I58 A;  4B63 A;  3RP8 A;  1PBB A;  3DGH A;  4WCT A;  3AE6 A;  3FPZ A;  1JU2 A;  3IWA A;  1ZP0 A;  1GRF A;  1O5W A;  3SQP A;  1JRZ A;  2WOI A;  3AD7 B;  3ALJ A;  3AE7 A;  3M0O A;  4AOS A;  3F8P A;  5CQF A;  2YG5 A;  4M52 A;  3R9U A;  1VG0 A;  3QJ4 A;  3AEG A;  1FL2 A;  3P4Q A;  2Q0K A;  3JSK A;  4NTD A;  4L38 A;  5JCM A;  4C5O A;  1PN0 A;  1KSS A;  4DGK A;  1KDG A;  3DJJ A;  2DKH A;  3GYI A;  1TYP A;  4XWR A;  3CGE A;  4TLZ A;  4Z25 A;  3P1W A;  3NG7 X;  5GRT A;  2NVK X;  4OPU A;  4Q5C A;  3GM6 A;  1F3P A;  1LQT A;  2YLS A;  4IA5 A;  1EL9 A;  1CC6 A;  2Q0L A;  2WPF A;  1B4V A;  4AP3 A;  4U8P A;  1YY5 A;  4J36 A;  2TPR A;  3NK2 X;  3P4S A;  4AT2 A;  2IVE A;  1LQU A;  1VG9 A;  2GAG B;  5EBK A;  1GXF A;  1ZK7 A;  2RGH A;  3GSI A;  1D5T A;  4DSH A;  5KOX A;  2GF3 A;  3KKJ A;  1PJ6 A;  2XDO A;  4Z2U A;  1D7Y A;  4KX6 A;  2C70 A;  2XVH A;  3G5R A;  1L0V A;  2BXR A;  4BJY A;  2BC1 A;  1FEC A;  4AT0 A;  1FT5 A;  2C66 A;  2XLT A;  4U8I A;  3H8I A;  1E1K A;  3AE2 A;  2XFP A;  3UTF A;  3ALM A;  2VVL G;  1W4X A;  3I6D A;  1Z6L A;  4RG4 A;  1NHP A;  1VQW A;  3FG2 P;  1MOK A;  3UKF A;  4B66 A;  1E1N A;  4B67 A;  4FK1 C;  4YSZ A;  2AR8 A;  2Y6R A;  3M12 A;  2JAE A;  1EL7 A;  2C76 A;  1GAL A;  3BNJ A;  1JNR A;  3V3O A;  3VRA A;  4YXD A;  2GR2 A;  3SCE A;  1QLB A;  4OPI A;  3S7W A;  1JOA A;  4Z24 A;  3ICT A;  3UKL A;  4YSH A;  1LPF A;  4Z43 A;  2YG3 A;  2XFQ A;  1LVL A;  5GSN A;  4BK1 A;  2WPC A;  4B69 A;  4Z26 A;  4X4J A;  3KD9 A;  4LA1 A;  3QSM A;  1XHC A;  1GER A;  4CY8 A;  4YTN A;  2GMH A;  2XVI A;  4H2Q A;  2WP5 A;  1N4W A;  4EQR A;  1IUU A;  1IUW A;  3CIR A;  1MO9 A;  2WEU A;  2A87 A;  3BI2 A;  2C72 A;  2XLS A;  4GUV A;  3ALL A;  5C3J A;  3K30 A;  1TDF A;  3AEA A;  3DME A;  2HQM A;  1DOB A;  3AE4 A;  4IVO B;  3VR9 A;  2B7S A;  2YVG A;  1VRQ B;  1M1P A;  3AEE A;  4JY2 A;  4GRT A;  3QVR A;  3NRN A;  2GAH B;  2XFN A;  4U8K A;  3UOY A;  3BHF A;  1S2Y A;  5JCN A;  4GF7 A;  2X99 A;  2XFO A;  5U1O A;  2DKI A;  2F5Z A;  2WES A;  1S3E A;  3O0H A;  2A8X A;  4U8J A;  4D03 A;  2YM2 A;  1NHR A;  5HHF A;  2C73 A;  2EQ8 A;  1GRG A;  1QDB A;  1Y0P A;  1JRX A;  2RF7 A;  2YG4 A;  1SEZ A;  1ZDL A;  3F8D A;  4FK1 A;  1FS7 A;  2PHH A;  1BVB A;  3LGQ A;  2EQ6 A;  2VZ2 A;  1ELI A;  4Z44 A;  3SXQ A;  3UU9 A;  1S3B A;  4BJZ A;  3VQR A;  4E0V A;  1PBD A;  1COY A;  4U8L A;  2BAB A;  2ZZ0 A;  1GT8 A;  2BAC A;  3COX A;  4P9S A;  3DJD A;  1H7X A;  2GV8 A;  3II4 A;  3AYI A;  3UOV A;  1PXB A;  3Q9T A;  3VR8 A;  2YLZ A;  5M10 A;  1CHU A;  1JNI A;  1FCD A;  3ICS A;  4XXG A;  4JY3 A;  1CC4 A;  1RYI A;  2WDQ A;  2WET A;  3SFD A;  2OLO A;  3EAN A;  3ICR A;  5BUL A;  1B8S A;  1NAA A;  2ZO5 A;  2X8G A;  2R0P A;  1OJT A;  2WPE A;  3HZL A;  3NT6 A;  1CJ2 A;  2YVF A;  1EL5 A;  2BCG G;  2YR4 A;  3P4R A;  4CCR A;  4O5Q A;  4EIP A;  2H89 A;  4Q1O A;  4A5L A;  5KOW A;  1E39 A;  3BHK A;  1QO8 A;  2VOU A;  2B9X A;  2QAE A;  4OPG A;  3NTD A;  2C65 A;  1CBO A;  2X3N A;  4H4U A;  4A79 A;  2Y6Q A;  3CNJ A;  1QJD A;  3LJP A;  4H4W A;  1H7W A;  4Q17 A;  1RSG A;  3AEB A;  3H8L A;  2WDR A;  3ISH A;  4CNK A;  3BNU A;  3V3N A;  1LTX R;  1BKW A;  4UDQ A;  1D4D A;  3GDP A;  4K7Z A;  1K0J A;  2V61 A;  3C96 A;  4ZCC A;  3RP7 A;  4BK2 A;  3QFB A;  4EM3 A;  4H4X A;  4NZH A;  2OAL A;  5BRT A;  3QSE A;  2RGJ A;  3VRD B;  3AB1 A;  3NGC X;  1NEN A;  2RGO A;  1YQZ A;  5L46 A;  1XDI A;  3C4A A;  4GCM A;  5JCK A;  3LAD A;  2CFY A;  2WU2 A;  2X8H A;  3M13 A;  1TDO A;  2X8C A;  1NEK A;  3IHM A;  1REO A;  4GR1 A;  4U2L A;  4B68 A;  4H4Z A;  4A9W A;  4YSY A;  1KNR A;  4YSX A;  3GD3 A;  4J56 A;  1BGN A;  4Q0T A;  1L9E A;  1E6E A;  2XVE A;  3CNS A;  3VRB A;  1PBE A;  3QSS A;  1NDA A;  2A89 A;  2BS4 A;  2YG6 A;  3NK0 X;  1PXA A;  3G5Q A;  4UP3 A;  4Y4L A;  2OT4 A;  4X9N A;  3UCL A;  3K7M X;  3CGB A;  4N9X A;  4OCG A;  3SGL A;  3V76 A;  3DA1 A;  3LZW A;  4JN9 A;  3GD4 A;  2XLR A;  3AD9 B;  2Z5Y A;  2OAM A;  1F8S A;  1F8R A;  3PS9 A;  4C74 A;  4Z2R A;  3UOZ A;  3UBR A;  2C75 A;  4Z2T A;  5LV9 A;  2VR0 A;  4FX9 A;  3DK8 A;  5BUK A;  3DJE A;  3TTB A;  1FEA A;  3GRS A;  5KVH A;  4LU6 A;  2GQW A;  3UOX A;  1IUX A;  4J31 A;  4H4P A;  3AED A;  2YG7 A;  2WHD A;  4U8O A;  4YTM A;  5TR3 A;  2BK4 A;  3CND A;  3I3L A;  2JB2 A;  3BNM A;  3P9U A;  5U63 A;  2YLT A;  5EOW A;  1NHS A;  1B37 A;  2GR3 A;  2R4J A;  4H4S A;  4L3Y A;  3LXD A;  4IVM B;  4MJW A;  1GET A;  1GV4 A;  3UP5 A;  3F29 A;  1N1P A;  2XYO A;  2YLX A;  2QA1 A;  3GMB A;  2BCP A;  2VRL A;  1H83 A;  1H81 A;  4GDE A;  2FJE A;  1TDK A;  5IQ1 A;  3NLC A;  3OC4 A;  3KLJ A;  2RAB A;  4CBQ A;  1CL0 A;  2JBV A;  3IHG A;  4B1B A;  4DNA A;  1UKV G;  2WS3 A;  4FDC B;  2Z5X A;  5BVA A;  1NG3 A;  4ICY A;  2VQB A;  3PVC A;  3UKP A;  2YR5 A;  1IUT A;  2E4G A;  2V3A A;  4APN A;  4TM4 A;  4EMI A;  4K22 A;  3WE0 A;  1KFY A;  1NPX A;  3SFE A;  3ZDN A;  1IUV A;  1N4V A;  3L1R A;  1CJ3 A;  1EL8 A;  4JDR A;  3RED A;  1DOC A;  3T37 A;  1S2Q A;  2FBW A;  4RG3 A;  4C3X A;  3UKA A;  4IV9 A;  4CCQ A;  2V5Z A;  3EF6 A;  3NYE A;  4REK A;  2C3C A;  3BNF A;  3G5S A;  1ZMC A;  5JCL A;  4Q5B A;  3BNH A;  3QVP A;  1XPQ A;  3URH A;  1H86 A;  2XVJ A;  3UP4 A;  2WQY A;  4H50 A;  1K0I A;  1D4C A;  1OJA A;  2XVF A;  5FMH A;  4BV6 A;  2R0G A;  4OPC A;  2V6O A;  4RSL A;  2XLU A;  2GEW A;  1DJN A;  3AE1 A;  3NNE A;  3EPT A;  1DJQ A;  2VVL A;  2WP6 A;  3K7T A;  1RP0 A;  4K5R A;  3RKH A;  4BK3 A;  4H4Y A;  1FT6 A;  1DOE A;  1PJ5 A;  4DSG A;  4LII A;  3D8X A;  4EQW A;  1B5Q A;  1GRB A;  2GRT A;  2BC0 A;  2I0Z A;  2YLW A;  1JEH A;  3CNP A;  4U8M A;  3GRT A;  4H4R A;  4H7U A;  3Q6J A;  3D1I A;  3LG1 A;  5HXI A;  2APG A;  3H4K A;  2AAQ A;  2LFC A;  3DK4 A;  4EM4 A;  1GRE A;  3GWF A;  2ZZB A;  2V3B A;  4NTE A;  4YT0 A;  3S61 A;  3PO7 A;  1PXC A;  1PBF A;  1HYU A;  1CJ4 A;  1IJH A;  2E5V A;  4JQ9 A;  3ATQ A;  5C2T A;  4I59 A;  4H4T A;  2RDZ A;  1BGJ A;  1NHQ A;  1DXL A;  1YQ4 A;  1TRB A;  2JB3 A;  4HA6 A;  4U8N A;  2C3D A;  1D4E A;  3CN8 A;  1KNP A;  3ADA B;  4YKG A;  3NKS A;  2WBA A;  3CPI G;  3EAO A;  3LOV A;  3AE3 A;  3NHO X;  1JRY A;  2JB1 A;  1ZMD A;  2YQU A;  4B65 A;  3CPH G;  2WOW A;  1E1M A;  2CVJ A;  1AOG A;  3UKQ A;  2R46 A;  4NTC A;  4CRT A;  4OPT A;  1GOS A;  2WU5 A;  3NTA A;  2YR6 A;  1VDC A;  5M0Z A;  3IF9 A;  4X9M A;  1YKJ A;  3DGZ A;  2VRM A;  3LZX A;  3AE5 A;  1P2E A;  2ZZC A;  2E80 A;  2Q6U A;  3P4P A;  2OLN A;  1BF3 A;  1CF3 A;  1E7P A;  1H6V A;  3BI5 A;  3L8K A;  2JK6 A;  3AD8 B;  3ITJ A;  4TM0 A;  3IC9 A;  1BWC A;  1PHH A;  3S5W A;  4ECH A;  4EQX A;  3CGD A;  2W0H A;  2YWL A;  1K4Q A;  1V59 A;  2R45 A;  2R4E A;  3NN0 X;  3GWD A;  1GTH A;  5ER0 A;  1PDH A;  4D04 A;  3C4N A;  2C67 A; 
#chains in the Genus database with same CATH topology
 1OJC A;  2GB0 A;  1M64 A;  1GTE A;  4EQS A;  4OPD A;  3GDN A;  3NYC A;  3OZ2 A;  4OVI A;  3UTH A;  1KF6 A;  5J60 A;  4YWO A;  1PS9 A;  2IVD A;  5KMP A;  3AE8 A;  3DJG X;  4GDP A;  3T2Z A;  4KPR A;  5EB4 A;  1ZX9 A;  1E1L A;  3B3R A;  4TM1 A;  1TYT A;  3NN6 X;  4EMJ A;  1IUS A;  1X31 B;  2AQJ A;  4O5U A;  2XLP A;  3OWM A;  1GPE A;  4USR A;  2B7R A;  2K3V A;  1Q9I A;  1TDN A;  2CDU A;  1ZY8 A;  2B9W A;  2VVM A;  3KU9 A;  1CC2 A;  1YQ3 A;  2FJD A;  1MXT A;  2GR0 A;  4H2R A;  3RP6 A;  4C77 A;  4WJY A;  2BA9 A;  4WX1 A;  5IQ4 A;  3MMO A;  3DK9 A;  3DH9 A;  3FIM B;  3F8R A;  1GU6 A;  5U25 A;  2E81 A;  3B6D A;  4ZN0 A;  4HB9 A;  4GAV A;  5DBJ A;  4ZCD A;  5FS8 A;  4H2N A;  3D1C A;  3AYJ A;  5EB5 A;  1F8W A;  5HY5 A;  4USQ A;  3GMC A;  2ZBW A;  3SZ0 A;  4K2X A;  3QFA A;  2B9Y A;  2J3N A;  2BK5 A;  3ATR A;  1Y56 B;  3KVE A;  1KSU A;  2X50 A;  2XCG A;  1ZKQ A;  2C7G A;  1FOH A;  2WP9 A;  4NEV A;  1GRH A;  5KXJ A;  1PBC A;  2O9Z A;  3AE9 A;  1M1R A;  1XAN A;  4K8D A;  4H2P A;  4H4V A;  1M1Q A;  5FS7 A;  3FMW A;  1JNZ A;  1GES A;  1O95 A;  3ZYX A;  4PAA A;  4AP1 A;  1GSN A;  1L9C A;  1TDE A;  4A65 A;  4CNJ A;  2ARD A;  2V60 A;  4XWZ A;  5KWF A;  4H4Q A;  3SXI A;  4G73 A;  4YTP A;  2GMJ A;  2BYB A;  3BNG A;  3CGC A;  4UDR A;  3AWI A;  3T14 A;  2VQ7 A;  3L1T A;  1P2H A;  1GRT A;  3SZW A;  4K5S A;  3NYF A;  4A99 A;  2QCU A;  1OAH A;  4A6N A;  2BS3 A;  3AEC A;  5CKU A;  1Q1W A;  4Y4N A;  1LJ1 A;  2YAU A;  2BK3 A;  5KVI A;  2PYX A;  1F6M A;  2WDV A;  1D7L A;  3AEF A;  3K7Q X;  3NH3 X;  3KA7 A;  5IPY A;  3KPF A;  4TLX A;  3AYL A;  4UDP A;  4TM3 A;  2BXS A;  4JNQ A;  1GRA A;  3UTG A;  2OA1 A;  4BUR A;  2GVC A;  1OJD A;  1ONF A;  1ZOY A;  4A7A A;  2Q7V A;  1K0L A;  4NEW A;  4PAB A;  1FS8 A;  3RHA A;  3AXB A;  3NIX A;  3FO3 A;  4AOX A;  1DNC A;  2FJB A;  2YVJ A;  3FBS A;  4Q4U A;  2R9Z A;  3RNM A;  5HYM A;  2EQ9 A;  4ADW A;  2BRA A;  3SYI A;  1Q1R A;  2ACZ A;  2EQ7 A;  2WOV A;  1BZL A;  1L9D A;  4J34 A;  4IA6 A;  4J33 A;  1EBD A;  1M6I A;  1O94 A;  3E1T A;  1DOD A;  2YM1 A;  3TOR A;  4J2W A;  2BS2 A;  4JNA A;  4NNJ A;  2GH5 A;  3GYJ A;  4YKF A;  2FJA A;  1SP3 A;  1Y56 A;  4U2T A;  5KRQ A;  2IID A;  3UTE A;  1OJ9 A;  3ABV A;  1ZOV A;  3CNT A;  3BI4 A;  2XFU A;  2J7A A;  1PJ7 A;  5FS6 A;  4L3X A;  2R0C A;  2C64 A;  1N4U A;  1FS9 A;  2H88 A;  3CTY A;  4L3Z A;  3NK1 X;  2TMD A;  5FS9 A;  3LB8 A;  2QA2 A;  4U2S A;  1CJC A;  1NG4 A;  4CY6 A;  1GEU A;  2JKC A;  2B76 A;  4Y4M A;  1H82 A;  4B64 A;  5JCI A;  2YLR A;  3GYX A;  2NPX A;  2CUL A;  4OPL A;  4EIQ A;  4C3Y A;  1LV0 A;  3SZF A;  3SM8 A;  4EMW A;  1GND A;  4J57 A;  3UKK A;  2GQF A;  2GR1 A;  1H84 A;  1FEB A;  2E1M A;  2UZZ A;  3CPJ G;  4A6N B;  5J7X A;  3UKH A;  4I58 A;  4B63 A;  3RP8 A;  1PBB A;  3DGH A;  4WCT A;  3AE6 A;  3FPZ A;  1JU2 A;  3IWA A;  1ZP0 A;  1GRF A;  1O5W A;  3SQP A;  1JRZ A;  2WOI A;  3AD7 B;  3ALJ A;  3AE7 A;  3M0O A;  4AOS A;  3F8P A;  5CQF A;  2YG5 A;  3HYX A;  4M52 A;  3R9U A;  1VG0 A;  3QJ4 A;  3AEG A;  1FL2 A;  3P4Q A;  2Q0K A;  3JSK A;  4NTD A;  4L38 A;  5JCM A;  4C5O A;  1PN0 A;  1KSS A;  4DGK A;  1KDG A;  3DJJ A;  2DKH A;  3GYI A;  1TYP A;  4XWR A;  3SX6 A;  3CGE A;  4TLZ A;  4Z25 A;  3P1W A;  3NG7 X;  5GRT A;  2NVK X;  4OPU A;  4Q5C A;  4II3 A;  3GM6 A;  1F3P A;  1LQT A;  2YLS A;  4IA5 A;  1EL9 A;  1CC6 A;  2Q0L A;  2WPF A;  1B4V A;  4AP3 A;  4U8P A;  1YY5 A;  4J36 A;  2TPR A;  3NK2 X;  3P4S A;  4AT2 A;  2IVE A;  1LQU A;  1VG9 A;  2GAG B;  5EBK A;  1GXF A;  3T2Y A;  1ZK7 A;  2RGH A;  3GSI A;  1D5T A;  4DSH A;  5KOX A;  2GF3 A;  3KKJ A;  1PJ6 A;  2XDO A;  4Z2U A;  1D7Y A;  4KX6 A;  2C70 A;  2XVH A;  3G5R A;  1L0V A;  2BXR A;  4BJY A;  2BC1 A;  1FEC A;  4AT0 A;  1FT5 A;  2C66 A;  2XLT A;  4U8I A;  3H8I A;  1E1K A;  3AE2 A;  2XFP A;  3UTF A;  3ALM A;  2VVL G;  1W4X A;  3I6D A;  1Z6L A;  4RG4 A;  1NHP A;  1VQW A;  3FG2 P;  1MOK A;  3UKF A;  4B66 A;  1E1N A;  4B67 A;  4FK1 C;  4YSZ A;  2AR8 A;  2Y6R A;  3M12 A;  2JAE A;  1EL7 A;  2C76 A;  1GAL A;  3BNJ A;  1JNR A;  3V3O A;  3VRA A;  4YXD A;  2GR2 A;  3SCE A;  1QLB A;  4OPI A;  3S7W A;  1JOA A;  4Z24 A;  3ICT A;  3UKL A;  4YSH A;  1LPF A;  4Z43 A;  2YG3 A;  2XFQ A;  1LVL A;  5GSN A;  4BK1 A;  2WPC A;  4B69 A;  4Z26 A;  4X4J A;  3KD9 A;  4LA1 A;  3QSM A;  4G74 A;  1XHC A;  1GER A;  4CY8 A;  4YTN A;  2GMH A;  2XVI A;  5KMQ A;  4H2Q A;  2WP5 A;  1N4W A;  4EQR A;  1IUU A;  1IUW A;  3CIR A;  1MO9 A;  2WEU A;  2A87 A;  3BI2 A;  2C72 A;  2XLS A;  4GUV A;  3ALL A;  5C3J A;  3K30 A;  1TDF A;  3AEA A;  3DME A;  2HQM A;  1DOB A;  3AE4 A;  4IVO B;  3VR9 A;  2B7S A;  2YVG A;  1VRQ B;  1M1P A;  3AEE A;  4JY2 A;  4GRT A;  3QVR A;  3NRN A;  2GAH B;  2XFN A;  4U8K A;  3UOY A;  3BHF A;  1S2Y A;  5JCN A;  4GF7 A;  2X99 A;  2XFO A;  5U1O A;  2DKI A;  2F5Z A;  2WES A;  1S3E A;  3O0H A;  2A8X A;  4U8J A;  4D03 A;  2YM2 A;  1NHR A;  3HYW A;  5HHF A;  4GAP A;  4II2 A;  2C73 A;  2EQ8 A;  1GRG A;  1QDB A;  1Y0P A;  1JRX A;  2RF7 A;  2C4C A;  2YG4 A;  1SEZ A;  4G6H A;  1ZDL A;  3F8D A;  4FK1 A;  1FS7 A;  2PHH A;  1BVB A;  3LGQ A;  2EQ6 A;  2VZ2 A;  1ELI A;  4Z44 A;  3SXQ A;  3UU9 A;  1S3B A;  4BJZ A;  3VQR A;  4E0V A;  1PBD A;  1COY A;  4U8L A;  2BAB A;  2ZZ0 A;  1GT8 A;  2BAC A;  3COX A;  4P9S A;  3DJD A;  1H7X A;  2GV8 A;  3II4 A;  3AYI A;  3HYV A;  1PXB A;  3Q9T A;  3UOV A;  2YLZ A;  3VR8 A;  1CHU A;  5M10 A;  1JNI A;  1FCD A;  3ICS A;  4XXG A;  4JY3 A;  1CC4 A;  1RYI A;  2WDQ A;  2WET A;  3SFD A;  2OLO A;  3EAN A;  3ICR A;  5BUL A;  1B8S A;  1NAA A;  2ZO5 A;  2X8G A;  3T0K A;  2R0P A;  1OJT A;  2WPE A;  3HZL A;  3NT6 A;  1CJ2 A;  2YVF A;  1EL5 A;  2BCG G;  2YR4 A;  3P4R A;  4CCR A;  4O5Q A;  4EIP A;  2H89 A;  4Q1O A;  4A5L A;  5KOW A;  1E39 A;  3BHK A;  4NWZ A;  1QO8 A;  2VOU A;  2B9X A;  2QAE A;  4OPG A;  3NTD A;  2C65 A;  1CBO A;  2X3N A;  4H4U A;  4A79 A;  2Y6Q A;  3CNJ A;  1QJD A;  3LJP A;  4H4W A;  1H7W A;  4Q17 A;  1RSG A;  3AEB A;  3H8L A;  2WDR A;  3ISH A;  4CNK A;  3BNU A;  3V3N A;  1LTX R;  1BKW A;  4UDQ A;  1D4D A;  3GDP A;  4K7Z A;  1K0J A;  3KPK A;  2V61 A;  3C96 A;  4ZCC A;  3RP7 A;  4BK2 A;  3QFB A;  4EM3 A;  4H4X A;  4NZH A;  2OAL A;  5BRT A;  3QSE A;  2RGJ A;  3VRD B;  3AB1 A;  3NGC X;  1NEN A;  2RGO A;  1YQZ A;  5L46 A;  5KMR A;  1XDI A;  3C4A A;  4GCM A;  5JCK A;  3LAD A;  2CFY A;  2WU2 A;  2X8H A;  3M13 A;  1TDO A;  2X8C A;  1NEK A;  3IHM A;  1REO A;  4GR1 A;  4U2L A;  4B68 A;  4H4Z A;  4A9W A;  4YSY A;  1KNR A;  4YSX A;  3GD3 A;  4J56 A;  3T2K A;  1BGN A;  4Q0T A;  1L9E A;  1E6E A;  2XVE A;  3CNS A;  3VRB A;  1PBE A;  3QSS A;  1NDA A;  2A89 A;  2BS4 A;  2YG6 A;  3NK0 X;  1PXA A;  3G5Q A;  4UP3 A;  4Y4L A;  2OT4 A;  4X9N A;  3UCL A;  3SZC A;  3K7M X;  3CGB A;  4N9X A;  4OCG A;  3SGL A;  3V76 A;  3DA1 A;  3LZW A;  4JN9 A;  3GD4 A;  2XLR A;  3AD9 B;  2Z5Y A;  2OAM A;  1F8S A;  1F8R A;  3PS9 A;  4C74 A;  4Z2R A;  3UOZ A;  3UBR A;  2C75 A;  4Z2T A;  5LV9 A;  2VR0 A;  4FX9 A;  3DK8 A;  5BUK A;  3DJE A;  3TTB A;  1FEA A;  3GRS A;  5KVH A;  4LU6 A;  2GQW A;  3UOX A;  1IUX A;  4J31 A;  4H4P A;  3AED A;  2YG7 A;  2WHD A;  4U8O A;  4YTM A;  5TR3 A;  2BK4 A;  3CND A;  3I3L A;  2JB2 A;  3BNM A;  3P9U A;  5U63 A;  2YLT A;  5EOW A;  1NHS A;  1B37 A;  2GR3 A;  2R4J A;  4H4S A;  4L3Y A;  3LXD A;  4IVM B;  4MJW A;  1GET A;  1GV4 A;  3UP5 A;  3F29 A;  1N1P A;  2XYO A;  2YLX A;  2QA1 A;  3GMB A;  2BCP A;  2VRL A;  5KNL A;  1H83 A;  1H81 A;  4GDE A;  2FJE A;  1TDK A;  5IQ1 A;  3NLC A;  3OC4 A;  3KLJ A;  2RAB A;  4CBQ A;  1CL0 A;  2JBV A;  3IHG A;  4B1B A;  4DNA A;  1UKV G;  2WS3 A;  4FDC B;  2Z5X A;  5BVA A;  1NG3 A;  4ICY A;  3SY4 A;  2BRY A;  2VQB A;  3PVC A;  3UKP A;  2YR5 A;  1IUT A;  2E4G A;  2V3A A;  4APN A;  4TM4 A;  4EMI A;  4K22 A;  3WE0 A;  1KFY A;  1NPX A;  3SFE A;  3ZDN A;  1IUV A;  1N4V A;  3L1R A;  1CJ3 A;  1EL8 A;  4JDR A;  3RED A;  1DOC A;  3T37 A;  1S2Q A;  2FBW A;  4G9K A;  4RG3 A;  4C3X A;  3UKA A;  4IV9 A;  4CCQ A;  2V5Z A;  3EF6 A;  3NYE A;  4REK A;  2C3C A;  3BNF A;  3G5S A;  1ZMC A;  5JCL A;  4Q5B A;  3BNH A;  3QVP A;  1XPQ A;  3URH A;  1H86 A;  2XVJ A;  3UP4 A;  2WQY A;  4H50 A;  1K0I A;  1D4C A;  1OJA A;  2XVF A;  5FMH A;  4BV6 A;  2R0G A;  4OPC A;  2V6O A;  4RSL A;  2XLU A;  2GEW A;  1DJN A;  3AE1 A;  3NNE A;  3EPT A;  1DJQ A;  2VVL A;  2WP6 A;  3K7T A;  1RP0 A;  4K5R A;  5KMS A;  3RKH A;  4BK3 A;  4H4Y A;  1FT6 A;  1DOE A;  1PJ5 A;  4DSG A;  4LII A;  3D8X A;  4EQW A;  1B5Q A;  1GRB A;  3T31 A;  2GRT A;  2BC0 A;  2I0Z A;  2YLW A;  1JEH A;  3CNP A;  4U8M A;  3GRT A;  4H4R A;  4H7U A;  3Q6J A;  3D1I A;  3LG1 A;  5HXI A;  2APG A;  3H4K A;  2AAQ A;  2LFC A;  3DK4 A;  4EM4 A;  1GRE A;  3GWF A;  2ZZB A;  2V3B A;  4NTE A;  4YT0 A;  3S61 A;  3PO7 A;  1PXC A;  1PBF A;  1HYU A;  1CJ4 A;  1IJH A;  2E5V A;  4JQ9 A;  3ATQ A;  5C2T A;  4I59 A;  4H4T A;  2RDZ A;  1BGJ A;  1NHQ A;  1DXL A;  1YQ4 A;  1TRB A;  2JB3 A;  4HA6 A;  2CZS A;  4U8N A;  2C3D A;  3CMM A;  1D4E A;  3CN8 A;  1KNP A;  3ADA B;  4YKG A;  3NKS A;  2WBA A;  3CPI G;  3EAO A;  3LOV A;  3AE3 A;  3NHO X;  1JRY A;  2JB1 A;  1ZMD A;  2YQU A;  4B65 A;  3CPH G;  2WOW A;  1E1M A;  2CVJ A;  1AOG A;  3UKQ A;  2R46 A;  4NTC A;  4CRT A;  4OPT A;  1GOS A;  2WU5 A;  3NTA A;  2YR6 A;  1VDC A;  5M0Z A;  3IF9 A;  4X9M A;  1YKJ A;  3DGZ A;  2VRM A;  3LZX A;  3AE5 A;  1P2E A;  2ZZC A;  2E80 A;  2Q6U A;  3P4P A;  2OLN A;  1BF3 A;  1CF3 A;  4G6G A;  1E7P A;  1H6V A;  3BI5 A;  3L8K A;  2JK6 A;  3AD8 B;  3ITJ A;  4TM0 A;  3IC9 A;  1BWC A;  1PHH A;  3S5W A;  4ECH A;  4EQX A;  3CGD A;  2W0H A;  2YWL A;  1K4Q A;  1V59 A;  2R45 A;  2R4E A;  3NN0 X;  3GWD A;  1GTH A;  5ER0 A;  1PDH A;  4D04 A;  3C4N A;  2C67 A; 
#chains in the Genus database with same CATH homology
 1OJC A;  2GB0 A;  1M64 A;  1GTE A;  4EQS A;  4OPD A;  3GDN A;  3NYC A;  3OZ2 A;  4OVI A;  3UTH A;  1KF6 A;  5J60 A;  4YWO A;  1PS9 A;  2IVD A;  5KMP A;  3AE8 A;  3DJG X;  4GDP A;  3T2Z A;  4KPR A;  5EB4 A;  1ZX9 A;  1E1L A;  3B3R A;  4TM1 A;  1TYT A;  3NN6 X;  4EMJ A;  1IUS A;  1X31 B;  2AQJ A;  4O5U A;  2XLP A;  3OWM A;  1GPE A;  4USR A;  2B7R A;  2K3V A;  1Q9I A;  1TDN A;  2CDU A;  1ZY8 A;  2B9W A;  2VVM A;  3KU9 A;  1CC2 A;  1YQ3 A;  2FJD A;  1MXT A;  2GR0 A;  4H2R A;  3RP6 A;  4C77 A;  4WJY A;  2BA9 A;  4WX1 A;  5IQ4 A;  3MMO A;  3DK9 A;  3DH9 A;  3FIM B;  3F8R A;  1GU6 A;  5U25 A;  2E81 A;  3B6D A;  4ZN0 A;  4HB9 A;  4GAV A;  5DBJ A;  4ZCD A;  5FS8 A;  4H2N A;  3D1C A;  3AYJ A;  5EB5 A;  1F8W A;  5HY5 A;  4USQ A;  3GMC A;  2ZBW A;  3SZ0 A;  4K2X A;  3QFA A;  2B9Y A;  2J3N A;  2BK5 A;  3ATR A;  1Y56 B;  3KVE A;  1KSU A;  2X50 A;  2XCG A;  1ZKQ A;  2C7G A;  1FOH A;  2WP9 A;  4NEV A;  1GRH A;  5KXJ A;  1PBC A;  2O9Z A;  3AE9 A;  1M1R A;  1XAN A;  4K8D A;  4H2P A;  4H4V A;  1M1Q A;  5FS7 A;  3FMW A;  1JNZ A;  1GES A;  1O95 A;  3ZYX A;  4PAA A;  4AP1 A;  1GSN A;  1L9C A;  1TDE A;  4A65 A;  4CNJ A;  2ARD A;  2V60 A;  4XWZ A;  5KWF A;  4H4Q A;  3SXI A;  4G73 A;  4YTP A;  2GMJ A;  2BYB A;  3BNG A;  3CGC A;  4UDR A;  3AWI A;  3T14 A;  2VQ7 A;  3L1T A;  1P2H A;  1GRT A;  3SZW A;  4K5S A;  3NYF A;  4A99 A;  2QCU A;  1OAH A;  4A6N A;  2BS3 A;  3AEC A;  5CKU A;  1Q1W A;  4Y4N A;  1LJ1 A;  2YAU A;  2BK3 A;  5KVI A;  2PYX A;  1F6M A;  2WDV A;  1D7L A;  3AEF A;  3K7Q X;  3NH3 X;  3KA7 A;  5IPY A;  3KPF A;  4TLX A;  3AYL A;  4UDP A;  4TM3 A;  2BXS A;  4JNQ A;  1GRA A;  3UTG A;  2OA1 A;  4BUR A;  2GVC A;  1OJD A;  1ONF A;  1ZOY A;  4A7A A;  2Q7V A;  1K0L A;  4NEW A;  4PAB A;  1FS8 A;  3RHA A;  3AXB A;  3NIX A;  3FO3 A;  4AOX A;  1DNC A;  2FJB A;  2YVJ A;  3FBS A;  4Q4U A;  2R9Z A;  3RNM A;  5HYM A;  2EQ9 A;  4ADW A;  2BRA A;  3SYI A;  1Q1R A;  2ACZ A;  2EQ7 A;  2WOV A;  1BZL A;  1L9D A;  4J34 A;  4IA6 A;  4J33 A;  1EBD A;  1M6I A;  1O94 A;  3E1T A;  1DOD A;  2YM1 A;  3TOR A;  4J2W A;  2BS2 A;  4JNA A;  4NNJ A;  2GH5 A;  3GYJ A;  4YKF A;  2FJA A;  1SP3 A;  1Y56 A;  4U2T A;  5KRQ A;  2IID A;  3UTE A;  1OJ9 A;  3ABV A;  1ZOV A;  3CNT A;  3BI4 A;  2XFU A;  2J7A A;  1PJ7 A;  5FS6 A;  4L3X A;  2R0C A;  2C64 A;  1N4U A;  1FS9 A;  2H88 A;  3CTY A;  4L3Z A;  3NK1 X;  2TMD A;  5FS9 A;  3LB8 A;  2QA2 A;  4U2S A;  1CJC A;  1NG4 A;  4CY6 A;  1GEU A;  2JKC A;  2B76 A;  4Y4M A;  1H82 A;  4B64 A;  5JCI A;  2YLR A;  3GYX A;  2NPX A;  2CUL A;  4OPL A;  4EIQ A;  4C3Y A;  1LV0 A;  3SZF A;  3SM8 A;  4EMW A;  1GND A;  4J57 A;  3UKK A;  2GQF A;  2GR1 A;  1H84 A;  1FEB A;  2E1M A;  2UZZ A;  3CPJ G;  4A6N B;  5J7X A;  3UKH A;  4I58 A;  4B63 A;  3RP8 A;  1PBB A;  3DGH A;  4WCT A;  3AE6 A;  3FPZ A;  1JU2 A;  3IWA A;  1ZP0 A;  1GRF A;  1O5W A;  3SQP A;  1JRZ A;  2WOI A;  3AD7 B;  3ALJ A;  3AE7 A;  3M0O A;  4AOS A;  3F8P A;  5CQF A;  2YG5 A;  3HYX A;  4M52 A;  3R9U A;  1VG0 A;  3QJ4 A;  3AEG A;  1FL2 A;  3P4Q A;  2Q0K A;  3JSK A;  4NTD A;  4L38 A;  5JCM A;  4C5O A;  1PN0 A;  1KSS A;  4DGK A;  1KDG A;  3DJJ A;  2DKH A;  3GYI A;  1TYP A;  4XWR A;  3SX6 A;  3CGE A;  4TLZ A;  4Z25 A;  3P1W A;  3NG7 X;  5GRT A;  2NVK X;  4OPU A;  4Q5C A;  4II3 A;  3GM6 A;  1F3P A;  1LQT A;  2YLS A;  4IA5 A;  1EL9 A;  1CC6 A;  2Q0L A;  2WPF A;  1B4V A;  4AP3 A;  4U8P A;  1YY5 A;  4J36 A;  2TPR A;  3NK2 X;  3P4S A;  4AT2 A;  2IVE A;  1LQU A;  1VG9 A;  2GAG B;  5EBK A;  1GXF A;  3T2Y A;  1ZK7 A;  2RGH A;  3GSI A;  1D5T A;  4DSH A;  5KOX A;  2GF3 A;  3KKJ A;  1PJ6 A;  2XDO A;  4Z2U A;  1D7Y A;  4KX6 A;  2C70 A;  2XVH A;  3G5R A;  1L0V A;  2BXR A;  4BJY A;  2BC1 A;  1FEC A;  4AT0 A;  1FT5 A;  2C66 A;  2XLT A;  4U8I A;  3H8I A;  1E1K A;  3AE2 A;  2XFP A;  3UTF A;  3ALM A;  2VVL G;  1W4X A;  3I6D A;  1Z6L A;  4RG4 A;  1NHP A;  1VQW A;  3FG2 P;  1MOK A;  3UKF A;  4B66 A;  1E1N A;  4B67 A;  4FK1 C;  4YSZ A;  2AR8 A;  2Y6R A;  3M12 A;  2JAE A;  1EL7 A;  2C76 A;  1GAL A;  3BNJ A;  1JNR A;  3V3O A;  3VRA A;  4YXD A;  2GR2 A;  3SCE A;  1QLB A;  4OPI A;  3S7W A;  1JOA A;  4Z24 A;  3ICT A;  3UKL A;  4YSH A;  1LPF A;  4Z43 A;  2YG3 A;  2XFQ A;  1LVL A;  5GSN A;  4BK1 A;  2WPC A;  4B69 A;  4Z26 A;  4X4J A;  3KD9 A;  4LA1 A;  3QSM A;  4G74 A;  1XHC A;  1GER A;  4CY8 A;  4YTN A;  2GMH A;  2XVI A;  5KMQ A;  4H2Q A;  2WP5 A;  1N4W A;  4EQR A;  1IUU A;  1IUW A;  3CIR A;  1MO9 A;  2WEU A;  2A87 A;  3BI2 A;  2C72 A;  2XLS A;  4GUV A;  3ALL A;  5C3J A;  3K30 A;  1TDF A;  3AEA A;  3DME A;  2HQM A;  1DOB A;  3AE4 A;  4IVO B;  3VR9 A;  2B7S A;  2YVG A;  1VRQ B;  1M1P A;  3AEE A;  4JY2 A;  4GRT A;  3QVR A;  3NRN A;  2GAH B;  2XFN A;  4U8K A;  3UOY A;  3BHF A;  1S2Y A;  5JCN A;  4GF7 A;  2X99 A;  2XFO A;  5U1O A;  2DKI A;  2F5Z A;  2WES A;  1S3E A;  3O0H A;  2A8X A;  4U8J A;  4D03 A;  2YM2 A;  1NHR A;  3HYW A;  5HHF A;  4GAP A;  4II2 A;  2C73 A;  2EQ8 A;  1GRG A;  1QDB A;  1Y0P A;  1JRX A;  2RF7 A;  2C4C A;  2YG4 A;  1SEZ A;  4G6H A;  1ZDL A;  3F8D A;  4FK1 A;  1FS7 A;  2PHH A;  1BVB A;  3LGQ A;  2EQ6 A;  2VZ2 A;  1ELI A;  4Z44 A;  3SXQ A;  3UU9 A;  1S3B A;  4BJZ A;  3VQR A;  4E0V A;  1PBD A;  1COY A;  4U8L A;  2BAB A;  2ZZ0 A;  1GT8 A;  2BAC A;  3COX A;  4P9S A;  3DJD A;  1H7X A;  2GV8 A;  3II4 A;  3AYI A;  3HYV A;  1PXB A;  3Q9T A;  3UOV A;  2YLZ A;  3VR8 A;  1CHU A;  5M10 A;  1JNI A;  1FCD A;  3ICS A;  4XXG A;  4JY3 A;  1CC4 A;  1RYI A;  2WDQ A;  2WET A;  3SFD A;  2OLO A;  3EAN A;  3ICR A;  5BUL A;  1B8S A;  1NAA A;  2ZO5 A;  2X8G A;  3T0K A;  2R0P A;  1OJT A;  2WPE A;  3HZL A;  3NT6 A;  1CJ2 A;  2YVF A;  1EL5 A;  2BCG G;  2YR4 A;  3P4R A;  4CCR A;  4O5Q A;  4EIP A;  2H89 A;  4Q1O A;  4A5L A;  5KOW A;  1E39 A;  3BHK A;  4NWZ A;  1QO8 A;  2VOU A;  2B9X A;  2QAE A;  4OPG A;  3NTD A;  2C65 A;  1CBO A;  2X3N A;  4H4U A;  4A79 A;  2Y6Q A;  3CNJ A;  1QJD A;  3LJP A;  4H4W A;  1H7W A;  4Q17 A;  1RSG A;  3AEB A;  3H8L A;  2WDR A;  3ISH A;  4CNK A;  3BNU A;  3V3N A;  1LTX R;  1BKW A;  4UDQ A;  1D4D A;  3GDP A;  4K7Z A;  1K0J A;  3KPK A;  2V61 A;  3C96 A;  4ZCC A;  3RP7 A;  4BK2 A;  3QFB A;  4EM3 A;  4H4X A;  4NZH A;  2OAL A;  5BRT A;  3QSE A;  2RGJ A;  3VRD B;  3AB1 A;  3NGC X;  1NEN A;  2RGO A;  1YQZ A;  5L46 A;  5KMR A;  1XDI A;  3C4A A;  4GCM A;  5JCK A;  3LAD A;  2CFY A;  2WU2 A;  2X8H A;  3M13 A;  1TDO A;  2X8C A;  1NEK A;  3IHM A;  1REO A;  4GR1 A;  4U2L A;  4B68 A;  4H4Z A;  4A9W A;  4YSY A;  1KNR A;  4YSX A;  3GD3 A;  4J56 A;  3T2K A;  1BGN A;  4Q0T A;  1L9E A;  1E6E A;  2XVE A;  3CNS A;  3VRB A;  1PBE A;  3QSS A;  1NDA A;  2A89 A;  2BS4 A;  2YG6 A;  3NK0 X;  1PXA A;  3G5Q A;  4UP3 A;  4Y4L A;  2OT4 A;  4X9N A;  3UCL A;  3SZC A;  3K7M X;  3CGB A;  4N9X A;  4OCG A;  3SGL A;  3V76 A;  3DA1 A;  3LZW A;  4JN9 A;  3GD4 A;  2XLR A;  3AD9 B;  2Z5Y A;  2OAM A;  1F8S A;  1F8R A;  3PS9 A;  4C74 A;  4Z2R A;  3UOZ A;  3UBR A;  2C75 A;  4Z2T A;  5LV9 A;  2VR0 A;  4FX9 A;  3DK8 A;  5BUK A;  3DJE A;  3TTB A;  1FEA A;  3GRS A;  5KVH A;  4LU6 A;  2GQW A;  3UOX A;  1IUX A;  4J31 A;  4H4P A;  3AED A;  2YG7 A;  2WHD A;  4U8O A;  4YTM A;  5TR3 A;  2BK4 A;  3CND A;  3I3L A;  2JB2 A;  3BNM A;  3P9U A;  5U63 A;  2YLT A;  5EOW A;  1NHS A;  1B37 A;  2GR3 A;  2R4J A;  4H4S A;  4L3Y A;  3LXD A;  4IVM B;  4MJW A;  1GET A;  1GV4 A;  3UP5 A;  3F29 A;  1N1P A;  2XYO A;  2YLX A;  2QA1 A;  3GMB A;  2BCP A;  2VRL A;  5KNL A;  1H83 A;  1H81 A;  4GDE A;  2FJE A;  1TDK A;  5IQ1 A;  3NLC A;  3OC4 A;  3KLJ A;  2RAB A;  4CBQ A;  1CL0 A;  2JBV A;  3IHG A;  4B1B A;  4DNA A;  1UKV G;  2WS3 A;  4FDC B;  2Z5X A;  5BVA A;  1NG3 A;  4ICY A;  3SY4 A;  2BRY A;  2VQB A;  3PVC A;  3UKP A;  2YR5 A;  1IUT A;  2E4G A;  2V3A A;  4APN A;  4TM4 A;  4EMI A;  4K22 A;  3WE0 A;  1KFY A;  1NPX A;  3SFE A;  3ZDN A;  1IUV A;  1N4V A;  3L1R A;  1CJ3 A;  1EL8 A;  4JDR A;  3RED A;  1DOC A;  3T37 A;  1S2Q A;  2FBW A;  4G9K A;  4RG3 A;  4C3X A;  3UKA A;  4IV9 A;  4CCQ A;  2V5Z A;  3EF6 A;  3NYE A;  4REK A;  2C3C A;  3BNF A;  3G5S A;  1ZMC A;  5JCL A;  4Q5B A;  3BNH A;  3QVP A;  1XPQ A;  3URH A;  1H86 A;  2XVJ A;  3UP4 A;  2WQY A;  4H50 A;  1K0I A;  1D4C A;  1OJA A;  2XVF A;  5FMH A;  4BV6 A;  2R0G A;  4OPC A;  2V6O A;  4RSL A;  2XLU A;  2GEW A;  1DJN A;  3AE1 A;  3NNE A;  3EPT A;  1DJQ A;  2VVL A;  2WP6 A;  3K7T A;  1RP0 A;  4K5R A;  5KMS A;  3RKH A;  4BK3 A;  4H4Y A;  1FT6 A;  1DOE A;  1PJ5 A;  4DSG A;  4LII A;  3D8X A;  4EQW A;  1B5Q A;  1GRB A;  3T31 A;  2GRT A;  2BC0 A;  2I0Z A;  2YLW A;  1JEH A;  3CNP A;  4U8M A;  3GRT A;  4H4R A;  4H7U A;  3Q6J A;  3D1I A;  3LG1 A;  5HXI A;  2APG A;  3H4K A;  2AAQ A;  2LFC A;  3DK4 A;  4EM4 A;  1GRE A;  3GWF A;  2ZZB A;  2V3B A;  4NTE A;  4YT0 A;  3S61 A;  3PO7 A;  1PXC A;  1PBF A;  1HYU A;  1CJ4 A;  1IJH A;  2E5V A;  4JQ9 A;  3ATQ A;  5C2T A;  4I59 A;  4H4T A;  2RDZ A;  1BGJ A;  1NHQ A;  1DXL A;  1YQ4 A;  1TRB A;  2JB3 A;  4HA6 A;  4U8N A;  2C3D A;  3CMM A;  1D4E A;  3CN8 A;  1KNP A;  3ADA B;  4YKG A;  3NKS A;  2WBA A;  3CPI G;  3EAO A;  3LOV A;  3AE3 A;  3NHO X;  1JRY A;  2JB1 A;  1ZMD A;  2YQU A;  4B65 A;  3CPH G;  2WOW A;  1E1M A;  2CVJ A;  1AOG A;  3UKQ A;  2R46 A;  4NTC A;  4CRT A;  4OPT A;  1GOS A;  2WU5 A;  3NTA A;  2YR6 A;  1VDC A;  5M0Z A;  3IF9 A;  4X9M A;  1YKJ A;  3DGZ A;  2VRM A;  3LZX A;  3AE5 A;  1P2E A;  2ZZC A;  2E80 A;  2Q6U A;  3P4P A;  2OLN A;  1BF3 A;  1CF3 A;  4G6G A;  1E7P A;  1H6V A;  3BI5 A;  3L8K A;  2JK6 A;  3AD8 B;  3ITJ A;  4TM0 A;  3IC9 A;  1BWC A;  1PHH A;  3S5W A;  4ECH A;  4EQX A;  3CGD A;  2W0H A;  2YWL A;  1K4Q A;  1V59 A;  2R45 A;  2R4E A;  3NN0 X;  3GWD A;  1GTH A;  5ER0 A;  1PDH A;  4D04 A;  3C4N A;  2C67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...