1KSUA

Crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHYTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords flavocytochrome c
publication title Role of His505 in the soluble fumarate reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 196
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1ksuA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1ksuA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1ksuA01
1XANA 4CRTA 2RGJA 1QLBA 4OPUA 4GCMA 2JB1A 1H6VA 1PXAA 3HZLA 4RSLA 2JBVA 4XXGA 2V3AA 4AT2A 2YG7A 2YLRA 1NAAA 2H89A 3NHOX 3AYJA 4U8JA 1FS9A 1CJ2A 2YVJA 1GRHA 4L3YA 3H4KA 2BACA 4Q5BA 3AECA 3OWMA 2GRTA 1FEBA 4U8MA 4BK3A 1TDNA 2B7SA 2WP6A 4OPCA 2AR8A 3KD9A 1TDFA 3PO7A 4X4JA 2TMDA 5U1OA 4OPIA 1DOEA 4YTNA 2R0CA 1BVBA 3CGBA 4YWOA 2YLZA 1ZKQA 1F6MA 3ICTA 1E1KA 3LOVA 3QJ4A 4J31A 4JNAA 3IC9A 2QAEA 3LGQA 2GR0A 3BNUA 5ER0A 3G5QA 5IQ1A 4Z44A 3CGEA 4NTDA 4YSYA 4XWZA 2C76A 2GV8A 2BXSA 3D1CA 4B63A 1KSUA 3BNHA 3QVRA 2VZ2A 3FIMB 5HXIA 1IUVA 3C4AA 2JKCA 4BURA 2BXRA 4EM3A 4J2WA 3I3LA 1BF3A 2YG4A 1VDCA 2GH5A 3KU9A 3R9UA 3SQPA 1F8RA 2NPXA 4Z2TA 3BNFA 2YG3A 1JNIA 3LADA 3K7QX 4REKA 4UDPA 3V3OA 1E1NA 3UBRA 5JCIA 3CPHG 4CY8A 4CBQA 4DSGA 3EANA 3UKLA 4WCTA 1GESA 4X9MA 1PJ5A 3VRBA 2DKIA 4B1BA 3V76A 3ATQA 1IUUA 2OT4A 4GUVA 3UKPA 2LFCA 1NDAA 4YSXA 1CC4A 3DJEA 5GRTA 3II4A 1F8SA 1KFYA 1Z6LA 1ZOVA 1OJAA 2C3DA 4H4VA 4LA1A 2OA1A 1ZDLA 2BYBA 1KF6A 2WETA 5KWFA 4Y4NA 4Z25A 4U2TA 1OJCA 1L9CA 1S3EA 3QSEA 4C3YA 2BK5A 4NEWA 1SP3A 2YLWA 3DMEA 3IHMA 3GYXA 2Q6UA 2Y6RA 1IUSA 1D5TA 3M13A 3NLCA 5FS9A 3BI2A 2XYOA 1DXLA 1YQ4A 3UTGA 2XLUA 2GMJA 2WS3A 5FS8A 4YKGA 1TDKA 3RHAA 1LQTA 2EQ8A 4RG3A 1Y0PA 3UKAA 1IUWA 2C66A 2WOIA 4U8NA 1B8SA 4C74A 4YTPA 2BC0A 2OLOA 3GDNA 2WESA 2QCUA 3G5RA 3G5SA 4J34A 3DA1A 2GR1A 3UKFA 1LTXR 1NHSA 3KLJA 1DOBA 2Q7VA 1CC6A 1S3BA 2I0ZA 1ZY8A 5TR3A 3S61A 3NN6X 4AP3A 2C67A 3AE4A 5EB5A 5DBJA 3GWFA 3GDPA 3FMWA 2ZZBA 2CVJA 3ALLA 3NYEA 4A7AA 1LVLA 3KVEA 2YVFA 5HYMA 1NG4A 5EBKA 1O94A 2GB0A 3ITJA 5CKUA 2WHDA 3NG7X 3M0OA 2V60A 1CBOA 3CN8A 2YR6A 2C3CA 4J57A 1GOSA 2JB3A 5FS6A 3PS9A 2Q0LA 3ADAB 1COYA 1JNRA 3ZYXA 1GXFA 1CL0A 1KNPA 3OZ2A 1M1RA 1N4UA 2J7AA 2EQ7A 2HQMA 4U8IA 3NK1X 3SXQA 2R0GA 2XLPA 3LXDA 3CNTA 2RGOA 2VRMA 1FS7A 1PBCA 3FO3A 1ZOYA 4Z26A 1CJ3A 2R9ZA 3UKQA 3UTFA 4Q1OA 3IHGA 1UKVG 4A9WA 3SGLA 4H2QA 4H4RA 1ONFA 5M10A 1GETA 3AB1A 1Q1WA 3LZWA 4H50A 3CNDA 1H7WA 2V5ZA 1P2EA 4YKFA 5HY5A 1H82A 2BK4A 3F8PA 3DGZA 4FDCB 4Y4MA 4OCGA 2YG5A 4EQWA 3SFDA 4WJYA 2C73A 4IA5A 3ISHA 3KPFA 3D1IA 2XVIA 1O5WA 4TLXA 1HYUA 2R45A 2X8CA 4C3XA 2AQJA 2GVCA 1XDIA 3B3RA 1LV0A 1PBBA 3LJPA 3NK0X 1D4CA 1K0JA 5U25A 3AE7A 2X99A 2XFNA 3UOYA 1B5QA 3NIXA 4CCQA 4JNQA 2RF7A 4H4WA 4JDRA 5C2TA 3RKHA 5JCLA 4H4SA 3QSMA 1Y56B 3AD8B 1FCDA 4CNJA 1N4WA 2BABA 4DGKA 2C7GA 3UOXA 1PDHA 4B69A 1QDBA 4U2LA 3DK4A 1TYPA 4U8LA 2RDZA 1EL9A 2YM2A 4AP1A 4K5RA 1GRBA 3GD3A 5EOWA 1ZMDA 3CTYA 4TM1A 1ZK7A 3CNJA 3GSIA 2XDOA 1K0LA 2RGHA 2E1MA 1B37A 4DNAA 2XLSA 4EMWA 2F5ZA 3P4QA 4L3XA 4Q4UA 4B64A 3I6DA 2V61A 2CDUA 4H4UA 1XHCA 2WU2A 3NRNA 4L3ZA 2VQ7A 4DSHA 2GQWA 1NG3A 1NHQA 2AAQA 2V3BA 1DNCA 3UTHA 3EPTA 2IVDA 1NENA 4P9SA 2GEWA 3DJGX 5EB4A 1FT6A 5BRTA 1P2HA 1PJ7A 2A8XA 1CJCA 2XLTA 4HB9A 4Z2UA 2WPCA 3RP7A 2Q0KA 1H84A 2B9XA 4I58A 1IUXA 2B7RA 3UU9A 3L1TA 3RNMA 2XVFA 3CIRA 2JAEA 2BK3A 3C4NA 1JRZA 3F8DA 5J60A 3LG1A 1JOAA 1MXTA 1D4EA 4MJWA 2BS4A 2IVEA 4H4YA 2ACZA 1IUTA 1KNRA 1FS8A 1GRAA 3ALMA 3COXA 1PBDA 2A87A 2E5VA 2V6OA 3K7MX 2XCGA 4TM4A 4EM4A 4AT0A 2VVMA 3SM8A 4B68A 5KVIA 1EL7A 2GQFA 2YWLA 4JY3A 2GMHA 2YAUA 1DJNA 1LPFA 3AD7B 4HA6A 4I59A 1OJ9A 3AEFA 3BI5A 2CULA 1OJTA 3KKJA 5LV9A 2EQ9A 2XFOA 1CJ4A 4GR1A 3M12A 3P4PA 1GEUA 5L46A 1VRQB 1FEAA 1GERA 3KA7A 2XFUA 4KPRA 3NT6A 3PVCA 1D7LA 2VQBA 3Q6JA 2WEUA 2WP5A 3AYIA 3WE0A 1BWCA 1F3PA 1RSGA 3BI4A 3FG2P 2RABA 4XWRA 1DJQA 4J33A 3AE9A 5KXJA 1F8WA 3AEEA 3AE3A 1JU2A 2ZBWA 4TM0A 3RP8A 2YM1A 2GR2A 4NTCA 2YVGA 3S7WA 2BC1A 1GRFA 1VG0A 2J3NA 5JCNA 3DGHA 4O5UA 3VR9A 4BK2A 4AOXA 1BGJA 2TPRA 4Z2RA 2GR3A 3IWAA 3AE6A 2QA1A 2X3NA 1PHHA 2R4EA 2VOUA 5U63A 4EIQA 1D7YA 3NKSA 1AOGA 3S5WA 4E0VA 4U8PA 3AEGA 3AXBA 4LIIA 2XFPA 3UOZA 4H4XA 2FBWA 2GAGB 4CCRA 3UP5A 1TDOA 1Q9IA 3UKHA 3AE2A 1IJHA 4YT0A 1E1MA 1H83A 4J56A 3H8IA 3BNJA 2WP9A 4ZCDA 4K22A 2YG6A 4A79A 4YSHA 2X50A 3AWIA 4A99A 4EMIA 1PS9A 4TM3A 3UKKA 4IA6A 5BUKA 3L8KA 1K0IA 4H4QA 4OPTA 4Q17A 1NHRA 4N9XA 4IVMB 2FJEA 5GSNA 5J7XA 4Z24A 2ARDA 4APNA 1DOCA 1JEHA 4K5SA 5KRQA 2WU5A 3NK2X 4EIPA 1GREA 1GTEA 4OVIA 5BVAA 2C70A 3CPJG 2XFQA 3CNSA 3D8XA 2BA9A 2R0PA 5C3JA 2BCGG 3P1WA 2WPEA 3BNGA 3AD9B 4YTMA 1YKJA 4USRA 4K7ZA 1K4QA 3EF6A 3LZXA 1EBDA 3QFAA 1OJDA 4Z43A 2YR5A 4UDRA 3CPIG 3T37A 4EQXA 1S2QA 3GD4A 1RYIA 5JCMA 1L0VA 1YQ3A 3AE1A 3F29A 3TTBA 2W0HA 2XLRA 2YR4A 3ABVA 3CGCA 1Q1RA 3NYCA 4GDPA 4JY2A 4NZHA 3RP6A 1GRGA 1VG9A 4GDEA 4J36A 1GT8A 3VR8A 2BCPA 1D4DA 2WDRA 5CQFA 3NTAA 4Q5CA 1PJ6A 3BHKA 4ADWA 4C77A 1B4VA 1E1LA 2DKHA 3V3NA 3NGCX 5KOXA 2ZO5A 2IIDA 4USQA 1TRBA 3OC4A 5BULA 1GTHA 1XPQA 4A65A 1M64A 3B6DA 1RP0A 1GV4A 4K8DA 3URHA 3ALJA 2VVLG 1GALA 2FJAA 3REDA 3P4RA 3GRSA 4FK1C 4AOSA 4ZN0A 4GF7A 1H81A 1YQZA 2JB2A 5FS7A 1SEZA 1GPEA 2GAHB 3FPZA 4ZCCA 4B66A 4B67A 4BJZA 1M6IA 3NN0X 4EMJA 1DODA 1M1QA 2BS3A 3NNEA 4D03A 5JCKA 2YLSA 4OPLA 4OPGA 1L9EA 1ELIA 3GWDA 4YXDA 1S2YA 4JN9A 4H2NA 4H2RA 2UZZA 4UDQA 1EL8A 1QO8A 3VQRA 1NEKA 1E7PA 3ICRA 1PBEA 4Q0TA 1MO9A 4GRTA 4TLZA 3GM6A 1X31B 1L9DA 1OAHA 3IF9A 2CFYA 5IQ4A 3NTDA 4KX6A 1YY5A 3AEAA 1BKWA 2FJBA 2VR0A 4FK1A 3ATRA 4YSZA 5KVHA 2OLNA 1O95A 1M1PA 4NTEA 3SFEA 4D04A 1GSNA 3MMOA 4U8OA 2E80A 4CY6A 5FMHA 4A6NA 3VRDB 1PXBA 3GYJA 3BNMA 3GRTA 1MOKA 3UOVA 3EAOA 4CNKA 2E81A 1H7XA 1N4VA 2O9ZA 2VRLA 1NPXA 1KSSA 4BJYA 3VRAA 2EQ6A 2WBAA 2VVLA 5M0ZA 2OALA 2BS2A 1W4XA 3F8RA 4O5QA 3DK8A 4WX1A 1PXCA 2PHHA 1FECA 4H4ZA 4PAAA 2WQYA 3P9UA 3GMCA 3Q9TA 4L38A 1CHUA 1KDGA 2XVEA 3DH9A 4UP3A 1PN0A 2WDQA 1ZMCA 4Y4LA 3BHFA 1PBFA 4ECHA 1QJDA 1ZP0A 2XVJA 1FT5A 2WOVA 4RG4A 1V59A 3O0HA 1GRTA 3JSKA 2A89A 4H7UA 2YLTA 3ICSA 1N1PA 2X8HA 4ICYA 4OPDA 3UTEA 2GF3A 4PABA 3FBSA 4IVOB 5IPYA 1REOA 3NYFA 1JRXA 3QFBA 2E4GA 2Y6QA 3QVPA 2C72A 2C75A 2WDVA 3AEDA 3QSSA 1GU6A 2B76A 3K30A 1GNDA 3GYIA 3GMBA 2Z5YA 1Y56A 4H4TA 4BK1A 4C5OA 1E6EA 3AE8A 2C64A 1CC2A 3DJDA 2K3VA 4FX9A 2NVKX 1TYTA 2R4JA 4K2XA 3L1RA 3LB8A 1H86A 4IV9A 2FJDA 2ZZ0A 1EL5A 1TDEA 4U8KA 2OAMA 3AYLA 2WOWA 4BV6A 4H4PA 4U2SA 4M52A 3CGDA 4H2PA 3E1TA 1VQWA 3AEBA 1BGNA 3NH3X 5HHFA 2YQUA 3SCEA 2ZZCA 4NEVA 3AE5A 2QA2A 3P4SA 1BZLA 3UCLA 4B65A 4A6NB 1NHPA 1LQUA 2JK6A 3CNPA 4EQSA 1FL2A 1JRYA 3TORA 4LU6A 4X9NA 3DJJA 2WPFA 3UP4A 4A5LA 2B9YA 2R46A 2C65A 1JNZA 1ZX9A 2Z5XA 2H88A 3K7TA 4JQ9A 2YLXA 3C96A 2APGA 2B9WA 2XVHA 4EQRA 1CF3A 1LJ1A 1FOHA 1E39A 2X8GA 5KOWA 3ZDNA 3DK9A 2PYXA 3H8LA
chains in the Genus database with same CATH superfamily
1XANA 4CRTA 2RGJA 1QLBA 4OPUA 4GCMA 2JB1A 3KPKA 1H6VA 1PXAA 3HZLA 4RSLA 2JBVA 4XXGA 2V3AA 4AT2A 2YG7A 2YLRA 1NAAA 2H89A 3NHOX 3AYJA 4U8JA 1FS9A 1CJ2A 2YVJA 1GRHA 4L3YA 3H4KA 5KMRA 2BACA 4Q5BA 3AECA 3OWMA 2GRTA 1FEBA 4U8MA 4BK3A 1TDNA 2B7SA 2WP6A 4OPCA 2AR8A 3KD9A 1TDFA 3PO7A 4X4JA 2TMDA 5U1OA 4G6HA 4OPIA 1DOEA 4YTNA 2R0CA 1BVBA 3CGBA 4YWOA 2YLZA 1ZKQA 1F6MA 3ICTA 1E1KA 3LOVA 3QJ4A 4J31A 4JNAA 4II3A 3IC9A 2QAEA 3LGQA 2GR0A 3BNUA 5ER0A 3G5QA 5IQ1A 4Z44A 3CGEA 4NTDA 4YSYA 4XWZA 2C76A 2GV8A 2BXSA 3D1CA 4B63A 1KSUA 3BNHA 3QVRA 2VZ2A 3FIMB 5HXIA 1IUVA 3C4AA 2JKCA 4BURA 2BXRA 4G9KA 4EM3A 4J2WA 3I3LA 1BF3A 2YG4A 1VDCA 2GH5A 3KU9A 4G73A 3R9UA 1F8RA 2NPXA 3SQPA 4Z2TA 3BNFA 2YG3A 1JNIA 3LADA 3K7QX 4REKA 4UDPA 3V3OA 1E1NA 3UBRA 5JCIA 3CPHG 4CY8A 4CBQA 4DSGA 3EANA 3UKLA 4WCTA 1GESA 4X9MA 1PJ5A 3VRBA 2DKIA 4B1BA 3SY4A 3ATQA 1IUUA 2OT4A 4GUVA 3UKPA 3V76A 2LFCA 1NDAA 4YSXA 1CC4A 3DJEA 5GRTA 3II4A 5KMPA 1F8SA 1KFYA 1Z6LA 1ZOVA 1OJAA 2C3DA 3T14A 4H4VA 4LA1A 3T2KA 2OA1A 1ZDLA 2BYBA 1KF6A 2WETA 5KWFA 4Y4NA 4Z25A 4U2TA 1OJCA 1L9CA 1S3EA 3QSEA 4C3YA 2BK5A 4NEWA 1SP3A 2YLWA 3DMEA 3IHMA 3GYXA 2Q6UA 2Y6RA 1IUSA 1D5TA 3M13A 3NLCA 5FS9A 3BI2A 2XYOA 1DXLA 1YQ4A 3UTGA 2XLUA 2GMJA 2WS3A 5FS8A 4YKGA 1TDKA 3RHAA 1LQTA 2EQ8A 4RG3A 1Y0PA 3UKAA 1IUWA 2C66A 2WOIA 4GAPA 1B8SA 4U8NA 4C74A 2BC0A 2OLOA 4YTPA 3GDNA 2WESA 2QCUA 3G5RA 3G5SA 4J34A 3DA1A 4NNJA 2GR1A 3UKFA 1LTXR 1NHSA 3KLJA 1DOBA 2Q7VA 1CC6A 1S3BA 2I0ZA 1ZY8A 5TR3A 3S61A 3NN6X 4AP3A 2C67A 3AE4A 5EB5A 5DBJA 3GWFA 3GDPA 3FMWA 2ZZBA 2CVJA 3ALLA 3NYEA 4A7AA 1LVLA 3KVEA 2YVFA 5HYMA 1NG4A 5EBKA 1O94A 2GB0A 3ITJA 5CKUA 2WHDA 3NG7X 3M0OA 2V60A 1CBOA 3CN8A 2YR6A 2C3CA 4J57A 1GOSA 2JB3A 5FS6A 3PS9A 2Q0LA 3ADAB 1COYA 1JNRA 3ZYXA 1GXFA 1CL0A 1KNPA 3OZ2A 1M1RA 1N4UA 2J7AA 2EQ7A 2HQMA 4U8IA 3NK1X 3SXQA 2R0GA 2XLPA 3LXDA 3CNTA 2RGOA 2VRMA 1FS7A 1PBCA 3FO3A 1ZOYA 4G74A 1CJ3A 2R9ZA 3UKQA 3UTFA 4Z26A 4Q1OA 3IHGA 1UKVG 3SZCA 4A9WA 3SGLA 4H2QA 4H4RA 1ONFA 5M10A 1GETA 3AB1A 1Q1WA 3LZWA 4H50A 3CNDA 1H7WA 2V5ZA 1P2EA 4YKFA 5HY5A 1H82A 2BK4A 3F8PA 3DGZA 4FDCB 4Y4MA 4OCGA 2YG5A 4EQWA 3SFDA 4WJYA 2C73A 4IA5A 3ISHA 3KPFA 3D1IA 2XVIA 1O5WA 4TLXA 1HYUA 2R45A 2X8CA 4C3XA 2AQJA 2GVCA 1XDIA 3B3RA 1LV0A 1PBBA 3LJPA 3NK0X 1D4CA 1K0JA 5U25A 3AE7A 2X99A 2XFNA 3UOYA 1B5QA 3NIXA 4CCQA 4JNQA 2RF7A 4H4WA 4JDRA 5C2TA 3RKHA 5JCLA 4H4SA 3QSMA 1Y56B 3AD8B 1FCDA 4CNJA 1N4WA 2BABA 4DGKA 3SZWA 2C7GA 3UOXA 1PDHA 4B69A 1QDBA 4U2LA 3DK4A 1TYPA 4U8LA 2RDZA 1EL9A 2YM2A 4AP1A 4K5RA 1GRBA 3GD3A 5EOWA 1ZMDA 3CTYA 4TM1A 1ZK7A 3CNJA 3GSIA 2XDOA 1K0LA 2RGHA 2E1MA 1B37A 4DNAA 2XLSA 4EMWA 2F5ZA 3P4QA 4L3XA 4Q4UA 4B64A 3I6DA 2V61A 2CDUA 4H4UA 1XHCA 2WU2A 3NRNA 4L3ZA 2VQ7A 4DSHA 2BRAA 5KNLA 2GQWA 1NG3A 1NHQA 2AAQA 2V3BA 1DNCA 3UTHA 3EPTA 2IVDA 1NENA 4P9SA 2GEWA 3DJGX 5EB4A 1FT6A 5BRTA 1P2HA 1PJ7A 2A8XA 1CJCA 2XLTA 4HB9A 4Z2UA 2WPCA 3RP7A 2Q0KA 1H84A 2B9XA 4I58A 1IUXA 2B7RA 3UU9A 3L1TA 3RNMA 2XVFA 3CIRA 2JAEA 2BK3A 3C4NA 1JRZA 3F8DA 5J60A 3LG1A 1JOAA 1MXTA 1D4EA 4MJWA 2BS4A 5KMSA 2IVEA 4H4YA 2ACZA 1IUTA 1KNRA 1FS8A 1GRAA 3ALMA 3COXA 1PBDA 2A87A 2E5VA 2V6OA 3K7MX 2XCGA 4TM4A 4EM4A 4AT0A 2VVMA 3SM8A 4B68A 5KVIA 1EL7A 2GQFA 2C4CA 2YWLA 4JY3A 2GMHA 2YAUA 1DJNA 1LPFA 3AD7B 4HA6A 4I59A 1OJ9A 3AEFA 3BI5A 2CULA 1OJTA 3KKJA 5LV9A 2EQ9A 2XFOA 3CMMA 1CJ4A 4GR1A 3M12A 3P4PA 1GEUA 5L46A 1VRQB 1FEAA 1GERA 3KA7A 2XFUA 4KPRA 3NT6A 3PVCA 1D7LA 2VQBA 3Q6JA 2WEUA 2WP5A 3AYIA 3WE0A 1BWCA 1F3PA 1RSGA 3BI4A 3FG2P 3T2YA 2RABA 4XWRA 1DJQA 4J33A 3AE9A 5KXJA 1F8WA 3AEEA 3SZFA 3AE3A 1JU2A 2ZBWA 4TM0A 3RP8A 2YM1A 2GR2A 4NTCA 3HYWA 2YVGA 3S7WA 2BC1A 1GRFA 1VG0A 2J3NA 5JCNA 3DGHA 4O5UA 3VR9A 4BK2A 4AOXA 1BGJA 2TPRA 4Z2RA 2GR3A 3IWAA 3AE6A 2QA1A 2X3NA 1PHHA 2R4EA 2VOUA 5U63A 4EIQA 1D7YA 3NKSA 1AOGA 3S5WA 4E0VA 4U8PA 3AEGA 3AXBA 4LIIA 2XFPA 3UOZA 4H4XA 2FBWA 2GAGB 4CCRA 3UP5A 1TDOA 1Q9IA 3UKHA 3AE2A 1IJHA 4YT0A 1E1MA 1H83A 4J56A 3H8IA 2CZSA 3BNJA 2WP9A 3T2ZA 4ZCDA 4II2A 4K22A 2YG6A 4A79A 4YSHA 2X50A 3AWIA 4A99A 4EMIA 1PS9A 4TM3A 3UKKA 4IA6A 5BUKA 3L8KA 1K0IA 4H4QA 4OPTA 4Q17A 1NHRA 4N9XA 4IVMB 2FJEA 5GSNA 5J7XA 4Z24A 2ARDA 4APNA 1DOCA 1JEHA 4K5SA 5KRQA 2WU5A 3NK2X 4EIPA 1GREA 1GTEA 4OVIA 5BVAA 2C70A 3CPJG 2XFQA 3CNSA 3D8XA 2BA9A 2R0PA 5C3JA 2BCGG 3P1WA 2WPEA 3BNGA 3AD9B 4YTMA 2BRYA 1YKJA 4USRA 4K7ZA 1K4QA 3EF6A 3LZXA 1EBDA 3QFAA 1OJDA 4Z43A 2YR5A 4UDRA 3CPIG 3T37A 4EQXA 1S2QA 3GD4A 1RYIA 5JCMA 1L0VA 1YQ3A 3AE1A 3F29A 3TTBA 2W0HA 2XLRA 2YR4A 3ABVA 3CGCA 1Q1RA 3NYCA 4GDPA 4JY2A 4NZHA 3RP6A 1GRGA 1VG9A 4GDEA 4J36A 1GT8A 3VR8A 2BCPA 1D4DA 2WDRA 5CQFA 3NTAA 4Q5CA 1PJ6A 3BHKA 4ADWA 4C77A 1B4VA 1E1LA 2DKHA 3SXIA 3SX6A 3NGCX 3V3NA 2ZO5A 2IIDA 4USQA 5KOXA 1TRBA 3OC4A 5BULA 1GTHA 1XPQA 3T0KA 4A65A 1M64A 3B6DA 1RP0A 1GV4A 4K8DA 3URHA 3ALJA 2VVLG 1GALA 2FJAA 3REDA 3P4RA 3GRSA 4FK1C 4AOSA 4ZN0A 4GF7A 1H81A 1YQZA 2JB2A 5FS7A 1SEZA 1GPEA 2GAHB 3FPZA 4ZCCA 4B66A 4B67A 4BJZA 1M6IA 3NN0X 4EMJA 1DODA 1M1QA 2BS3A 3NNEA 4D03A 5JCKA 2YLSA 4OPLA 4OPGA 1L9EA 1ELIA 3GWDA 4YXDA 1S2YA 4JN9A 4H2NA 4H2RA 2UZZA 4UDQA 1EL8A 1QO8A 3VQRA 1NEKA 1E7PA 3ICRA 1PBEA 4Q0TA 1MO9A 4GRTA 4TLZA 3GM6A 1X31B 5KMQA 1L9DA 1OAHA 3IF9A 2CFYA 5IQ4A 3NTDA 4KX6A 1YY5A 3AEAA 1BKWA 2FJBA 2VR0A 4FK1A 3ATRA 4YSZA 5KVHA 2OLNA 1O95A 1M1PA 4NTEA 3SFEA 4D04A 1GSNA 3MMOA 4U8OA 2E80A 4CY6A 5FMHA 4A6NA 3VRDB 1PXBA 3GYJA 3BNMA 3GRTA 1MOKA 3UOVA 3EAOA 4CNKA 2E81A 1H7XA 1N4VA 2O9ZA 2VRLA 1NPXA 1KSSA 4BJYA 3VRAA 2EQ6A 3HYXA 2WBAA 2VVLA 3SYIA 5M0ZA 2OALA 2BS2A 1W4XA 3F8RA 4O5QA 3DK8A 4WX1A 3HYVA 1PXCA 2PHHA 1FECA 4H4ZA 4PAAA 4NWZA 2WQYA 3P9UA 3GMCA 3Q9TA 4L38A 1CHUA 1KDGA 2XVEA 3DH9A 4UP3A 1PN0A 2WDQA 1ZMCA 4GAVA 4Y4LA 3BHFA 1PBFA 4ECHA 1QJDA 1ZP0A 2XVJA 1FT5A 2WOVA 4RG4A 1V59A 3O0HA 1GRTA 3JSKA 2A89A 4H7UA 2YLTA 3ICSA 1N1PA 2X8HA 4ICYA 4OPDA 3T31A 2GF3A 4PABA 3FBSA 4IVOB 3UTEA 1REOA 5IPYA 3NYFA 1JRXA 3QFBA 2E4GA 2Y6QA 3QVPA 2C72A 2C75A 2WDVA 3AEDA 3QSSA 1GU6A 2B76A 3K30A 1GNDA 3GYIA 3GMBA 2Z5YA 1Y56A 4H4TA 4BK1A 4C5OA 1E6EA 3AE8A 2C64A 1CC2A 3DJDA 2K3VA 4FX9A 2NVKX 1TYTA 4G6GA 2R4JA 4K2XA 3L1RA 3LB8A 1H86A 4IV9A 2FJDA 2ZZ0A 1EL5A 1TDEA 4U8KA 2OAMA 3AYLA 2WOWA 4BV6A 4H4PA 4U2SA 4M52A 3CGDA 4H2PA 3E1TA 1VQWA 3AEBA 1BGNA 3NH3X 5HHFA 2YQUA 3SCEA 2ZZCA 4NEVA 3AE5A 2QA2A 3P4SA 1BZLA 3UCLA 4B65A 4A6NB 1NHPA 1LQUA 2JK6A 3CNPA 4EQSA 1FL2A 1JRYA 3TORA 4LU6A 4X9NA 3DJJA 2WPFA 3UP4A 4A5LA 2B9YA 2R46A 2C65A 1JNZA 1ZX9A 2Z5XA 2H88A 3K7TA 4JQ9A 2YLXA 3C96A 2APGA 2B9WA 2XVHA 3SZ0A 4EQRA 1CF3A 1LJ1A 1FOHA 1E39A 2X8GA 5KOWA 3ZDNA 3DK9A 2PYXA 3H8LA
chains in the Genus database with same CATH topology
1XANA 4CRTA 2RGJA 1QLBA 4OPUA 4GCMA 2JB1A 3KPKA 1H6VA 1PXAA 3HZLA 4RSLA 2JBVA 4XXGA 2V3AA 4AT2A 2YG7A 2YLRA 1NAAA 2H89A 3NHOX 3AYJA 4U8JA 1FS9A 1CJ2A 2YVJA 1GRHA 4L3YA 3H4KA 5KMRA 2BACA 4Q5BA 3AECA 3OWMA 2GRTA 1FEBA 4U8MA 4BK3A 1TDNA 2B7SA 2WP6A 4OPCA 2AR8A 3KD9A 1TDFA 3PO7A 4X4JA 2TMDA 5U1OA 4G6HA 4OPIA 1DOEA 4YTNA 2R0CA 1BVBA 3CGBA 4YWOA 2YLZA 1ZKQA 1F6MA 3ICTA 1E1KA 3LOVA 3QJ4A 4J31A 4JNAA 4II3A 3IC9A 2QAEA 3LGQA 2GR0A 3BNUA 5ER0A 3G5QA 5IQ1A 4Z44A 3CGEA 4NTDA 4YSYA 4XWZA 2C76A 2GV8A 2BXSA 3D1CA 4B63A 1KSUA 3BNHA 3QVRA 2VZ2A 3FIMB 5HXIA 1IUVA 3C4AA 2JKCA 4BURA 2BXRA 4G9KA 4EM3A 4J2WA 3I3LA 1BF3A 2YG4A 1VDCA 2GH5A 3KU9A 4G73A 3R9UA 1F8RA 2NPXA 3SQPA 4Z2TA 3BNFA 2YG3A 1JNIA 3LADA 3K7QX 4REKA 4UDPA 3V3OA 1E1NA 3UBRA 5JCIA 3CPHG 4CY8A 4CBQA 4DSGA 3EANA 3UKLA 4WCTA 1GESA 4X9MA 1PJ5A 3VRBA 2DKIA 4B1BA 3SY4A 3ATQA 1IUUA 2OT4A 4GUVA 3UKPA 3V76A 2LFCA 1NDAA 4YSXA 1CC4A 3DJEA 5GRTA 3II4A 5KMPA 1F8SA 1KFYA 1Z6LA 1ZOVA 1OJAA 2C3DA 3T14A 4H4VA 4LA1A 3T2KA 2OA1A 1ZDLA 2BYBA 1KF6A 2WETA 5KWFA 4Y4NA 4Z25A 4U2TA 1OJCA 1L9CA 1S3EA 3QSEA 4C3YA 2BK5A 4NEWA 1SP3A 2YLWA 3DMEA 3IHMA 3GYXA 2Q6UA 2Y6RA 1IUSA 1D5TA 3M13A 3NLCA 5FS9A 3BI2A 2XYOA 1DXLA 1YQ4A 3UTGA 2XLUA 2GMJA 2WS3A 5FS8A 4YKGA 1TDKA 3RHAA 1LQTA 2EQ8A 4RG3A 1Y0PA 3UKAA 1IUWA 2C66A 2WOIA 4GAPA 1B8SA 4U8NA 4C74A 2BC0A 2OLOA 4YTPA 3GDNA 2WESA 2QCUA 3G5RA 3G5SA 4J34A 3DA1A 4NNJA 2GR1A 3UKFA 1LTXR 1NHSA 3KLJA 1DOBA 2Q7VA 1CC6A 1S3BA 2I0ZA 1ZY8A 5TR3A 3S61A 3NN6X 4AP3A 2C67A 3AE4A 5EB5A 5DBJA 3GWFA 3GDPA 3FMWA 2ZZBA 2CVJA 3ALLA 3NYEA 4A7AA 1LVLA 3KVEA 2YVFA 5HYMA 1NG4A 5EBKA 1O94A 2GB0A 3ITJA 5CKUA 2WHDA 3NG7X 3M0OA 2V60A 1CBOA 3CN8A 2YR6A 2C3CA 4J57A 1GOSA 2JB3A 5FS6A 3PS9A 2Q0LA 3ADAB 1COYA 1JNRA 3ZYXA 1GXFA 1CL0A 1KNPA 3OZ2A 1M1RA 1N4UA 2J7AA 2EQ7A 2HQMA 4U8IA 3NK1X 3SXQA 2R0GA 2XLPA 3LXDA 3CNTA 2RGOA 2VRMA 1FS7A 1PBCA 3FO3A 1ZOYA 4G74A 1CJ3A 2R9ZA 3UKQA 3UTFA 4Z26A 4Q1OA 3IHGA 1UKVG 3SZCA 4A9WA 3SGLA 4H2QA 4H4RA 1ONFA 5M10A 1GETA 3AB1A 1Q1WA 3LZWA 4H50A 3CNDA 1H7WA 2V5ZA 1P2EA 4YKFA 5HY5A 1H82A 2BK4A 3F8PA 3DGZA 4FDCB 4Y4MA 4OCGA 2YG5A 4EQWA 3SFDA 4WJYA 2C73A 4IA5A 3ISHA 3KPFA 3D1IA 2XVIA 1O5WA 4TLXA 1HYUA 2R45A 2X8CA 4C3XA 2AQJA 2GVCA 1XDIA 3B3RA 1LV0A 1PBBA 3LJPA 3NK0X 1D4CA 1K0JA 5U25A 3AE7A 2X99A 2XFNA 3UOYA 1B5QA 3NIXA 4CCQA 4JNQA 2RF7A 4H4WA 4JDRA 5C2TA 3RKHA 5JCLA 4H4SA 3QSMA 1Y56B 3AD8B 1FCDA 4CNJA 1N4WA 2BABA 4DGKA 3SZWA 2C7GA 3UOXA 1PDHA 4B69A 1QDBA 4U2LA 3DK4A 1TYPA 4U8LA 2RDZA 1EL9A 2YM2A 4AP1A 4K5RA 1GRBA 3GD3A 5EOWA 1ZMDA 3CTYA 4TM1A 1ZK7A 3CNJA 3GSIA 2XDOA 1K0LA 2RGHA 2E1MA 1B37A 4DNAA 2XLSA 4EMWA 2F5ZA 3P4QA 4L3XA 4Q4UA 4B64A 3I6DA 2V61A 2CDUA 4H4UA 1XHCA 2WU2A 3NRNA 4L3ZA 2VQ7A 4DSHA 2BRAA 5KNLA 2GQWA 1NG3A 1NHQA 2AAQA 2V3BA 1DNCA 3UTHA 3EPTA 2IVDA 1NENA 4P9SA 2GEWA 3DJGX 5EB4A 1FT6A 5BRTA 1P2HA 1PJ7A 2A8XA 1CJCA 2XLTA 4HB9A 4Z2UA 2WPCA 3RP7A 2Q0KA 1H84A 2B9XA 4I58A 1IUXA 2B7RA 3UU9A 3L1TA 3RNMA 2XVFA 3CIRA 2JAEA 2BK3A 3C4NA 1JRZA 3F8DA 5J60A 3LG1A 1JOAA 1MXTA 1D4EA 4MJWA 2BS4A 5KMSA 2IVEA 4H4YA 2ACZA 1IUTA 1KNRA 1FS8A 1GRAA 3ALMA 3COXA 1PBDA 2A87A 2E5VA 2V6OA 3K7MX 2XCGA 4TM4A 4EM4A 4AT0A 2VVMA 3SM8A 4B68A 5KVIA 1EL7A 2GQFA 2C4CA 2YWLA 4JY3A 2GMHA 2YAUA 1DJNA 1LPFA 3AD7B 4HA6A 4I59A 1OJ9A 3AEFA 3BI5A 2CULA 1OJTA 3KKJA 5LV9A 2EQ9A 2XFOA 3CMMA 1CJ4A 4GR1A 3M12A 3P4PA 1GEUA 5L46A 1VRQB 1FEAA 1GERA 3KA7A 2XFUA 4KPRA 3NT6A 3PVCA 1D7LA 2VQBA 3Q6JA 2WEUA 2WP5A 3AYIA 3WE0A 1BWCA 1F3PA 1RSGA 3BI4A 3FG2P 3T2YA 2RABA 4XWRA 1DJQA 4J33A 3AE9A 5KXJA 1F8WA 3AEEA 3SZFA 3AE3A 1JU2A 2ZBWA 4TM0A 3RP8A 2YM1A 2GR2A 4NTCA 3HYWA 2YVGA 3S7WA 2BC1A 1GRFA 1VG0A 2J3NA 5JCNA 3DGHA 4O5UA 3VR9A 4BK2A 4AOXA 1BGJA 2TPRA 4Z2RA 2GR3A 3IWAA 3AE6A 2QA1A 2X3NA 1PHHA 2R4EA 2VOUA 5U63A 4EIQA 1D7YA 3NKSA 1AOGA 3S5WA 4E0VA 4U8PA 3AEGA 3AXBA 4LIIA 2XFPA 3UOZA 4H4XA 2FBWA 2GAGB 4CCRA 3UP5A 1TDOA 1Q9IA 3UKHA 3AE2A 1IJHA 4YT0A 1E1MA 1H83A 4J56A 3H8IA 3BNJA 2WP9A 3T2ZA 4ZCDA 4II2A 4K22A 2YG6A 4A79A 4YSHA 2X50A 3AWIA 4A99A 4EMIA 1PS9A 4TM3A 3UKKA 4IA6A 5BUKA 3L8KA 1K0IA 4H4QA 4OPTA 4Q17A 1NHRA 4N9XA 4IVMB 2FJEA 5GSNA 5J7XA 4Z24A 2ARDA 4APNA 1DOCA 1JEHA 4K5SA 5KRQA 2WU5A 3NK2X 4EIPA 1GREA 1GTEA 4OVIA 5BVAA 2C70A 3CPJG 2XFQA 3CNSA 3D8XA 2BA9A 2R0PA 5C3JA 2BCGG 3P1WA 2WPEA 3BNGA 3AD9B 4YTMA 2BRYA 1YKJA 4USRA 4K7ZA 1K4QA 3EF6A 3LZXA 1EBDA 3QFAA 1OJDA 4Z43A 2YR5A 4UDRA 3CPIG 3T37A 4EQXA 1S2QA 3GD4A 1RYIA 5JCMA 1L0VA 1YQ3A 3AE1A 3F29A 3TTBA 2W0HA 2XLRA 2YR4A 3ABVA 3CGCA 1Q1RA 3NYCA 4GDPA 4JY2A 4NZHA 3RP6A 1GRGA 1VG9A 4GDEA 4J36A 1GT8A 3VR8A 2BCPA 1D4DA 2WDRA 5CQFA 3NTAA 4Q5CA 1PJ6A 3BHKA 4ADWA 4C77A 1B4VA 1E1LA 2DKHA 3SXIA 3SX6A 3NGCX 3V3NA 2ZO5A 2IIDA 4USQA 5KOXA 1TRBA 3OC4A 5BULA 1GTHA 1XPQA 3T0KA 4A65A 1M64A 3B6DA 1RP0A 1GV4A 4K8DA 3URHA 3ALJA 2VVLG 1GALA 2FJAA 3REDA 3P4RA 3GRSA 4FK1C 4AOSA 4ZN0A 4GF7A 1H81A 1YQZA 2JB2A 5FS7A 1SEZA 1GPEA 2GAHB 3FPZA 4ZCCA 4B66A 4B67A 4BJZA 1M6IA 3NN0X 4EMJA 1DODA 1M1QA 2BS3A 3NNEA 4D03A 5JCKA 2YLSA 4OPLA 4OPGA 1L9EA 1ELIA 3GWDA 4YXDA 1S2YA 4JN9A 4H2NA 4H2RA 2UZZA 4UDQA 1EL8A 1QO8A 3VQRA 1NEKA 1E7PA 3ICRA 1PBEA 4Q0TA 1MO9A 4GRTA 4TLZA 3GM6A 1X31B 5KMQA 1L9DA 1OAHA 3IF9A 2CFYA 5IQ4A 3NTDA 4KX6A 1YY5A 3AEAA 1BKWA 2FJBA 2VR0A 4FK1A 3ATRA 4YSZA 5KVHA 2OLNA 1O95A 1M1PA 4NTEA 3SFEA 4D04A 1GSNA 3MMOA 4U8OA 2E80A 4CY6A 5FMHA 4A6NA 3VRDB 1PXBA 3GYJA 3BNMA 3GRTA 1MOKA 3UOVA 3EAOA 4CNKA 2E81A 1H7XA 1N4VA 2O9ZA 2VRLA 1NPXA 1KSSA 4BJYA 3VRAA 2EQ6A 3HYXA 2WBAA 2VVLA 3SYIA 5M0ZA 2OALA 2BS2A 1W4XA 3F8RA 4O5QA 3DK8A 4WX1A 3HYVA 1PXCA 2PHHA 1FECA 4H4ZA 4PAAA 4NWZA 2WQYA 3P9UA 3GMCA 3Q9TA 4L38A 1CHUA 1KDGA 2XVEA 3DH9A 4UP3A 1PN0A 2WDQA 1ZMCA 4GAVA 4Y4LA 3BHFA 1PBFA 4ECHA 1QJDA 1ZP0A 2XVJA 1FT5A 2WOVA 4RG4A 1V59A 3O0HA 1GRTA 3JSKA 2A89A 4H7UA 2YLTA 3ICSA 1N1PA 2X8HA 4ICYA 4OPDA 3T31A 2GF3A 4PABA 3FBSA 4IVOB 3UTEA 1REOA 5IPYA 3NYFA 1JRXA 3QFBA 2E4GA 2Y6QA 3QVPA 2C72A 2C75A 2WDVA 3AEDA 3QSSA 1GU6A 2B76A 3K30A 1GNDA 3GYIA 3GMBA 2Z5YA 1Y56A 4H4TA 4BK1A 4C5OA 1E6EA 3AE8A 2C64A 1CC2A 3DJDA 2K3VA 4FX9A 2NVKX 1TYTA 4G6GA 2R4JA 4K2XA 3L1RA 3LB8A 1H86A 4IV9A 2FJDA 2ZZ0A 1EL5A 1TDEA 4U8KA 2OAMA 3AYLA 2WOWA 4BV6A 4H4PA 4U2SA 4M52A 3CGDA 4H2PA 3E1TA 1VQWA 3AEBA 1BGNA 3NH3X 5HHFA 2YQUA 3SCEA 2ZZCA 4NEVA 3AE5A 2QA2A 3P4SA 1BZLA 3UCLA 4B65A 4A6NB 1NHPA 1LQUA 2JK6A 3CNPA 4EQSA 1FL2A 1JRYA 3TORA 4LU6A 4X9NA 3DJJA 2WPFA 3UP4A 4A5LA 2B9YA 2R46A 2C65A 1JNZA 1ZX9A 2Z5XA 2H88A 3K7TA 4JQ9A 2YLXA 3C96A 2APGA 2B9WA 2XVHA 3SZ0A 4EQRA 1CF3A 1LJ1A 1FOHA 1E39A 2X8GA 5KOWA 3ZDNA 3DK9A 2PYXA 3H8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XAN A;  4CRT A;  2RGJ A;  1QLB A;  4OPU A;  4GCM A;  2JB1 A;  1H6V A;  1PXA A;  3HZL A;  4RSL A;  2JBV A;  4XXG A;  2V3A A;  4AT2 A;  2YG7 A;  2YLR A;  1NAA A;  2H89 A;  3NHO X;  3AYJ A;  4U8J A;  1FS9 A;  1CJ2 A;  2YVJ A;  1GRH A;  4L3Y A;  3H4K A;  2BAC A;  4Q5B A;  3AEC A;  3OWM A;  2GRT A;  1FEB A;  4U8M A;  4BK3 A;  1TDN A;  2B7S A;  2WP6 A;  4OPC A;  2AR8 A;  3KD9 A;  1TDF A;  3PO7 A;  4X4J A;  2TMD A;  5U1O A;  4OPI A;  1DOE A;  4YTN A;  2R0C A;  1BVB A;  3CGB A;  4YWO A;  2YLZ A;  1ZKQ A;  1F6M A;  3ICT A;  1E1K A;  3LOV A;  3QJ4 A;  4J31 A;  4JNA A;  3IC9 A;  2QAE A;  3LGQ A;  2GR0 A;  3BNU A;  5ER0 A;  3G5Q A;  5IQ1 A;  4Z44 A;  3CGE A;  4NTD A;  4YSY A;  4XWZ A;  2C76 A;  2GV8 A;  2BXS A;  3D1C A;  4B63 A;  1KSU A;  3BNH A;  3QVR A;  2VZ2 A;  3FIM B;  5HXI A;  1IUV A;  3C4A A;  2JKC A;  4BUR A;  2BXR A;  4EM3 A;  4J2W A;  3I3L A;  1BF3 A;  2YG4 A;  1VDC A;  2GH5 A;  3KU9 A;  3R9U A;  3SQP A;  1F8R A;  2NPX A;  4Z2T A;  3BNF A;  2YG3 A;  1JNI A;  3LAD A;  3K7Q X;  4REK A;  4UDP A;  3V3O A;  1E1N A;  3UBR A;  5JCI A;  3CPH G;  4CY8 A;  4CBQ A;  4DSG A;  3EAN A;  3UKL A;  4WCT A;  1GES A;  4X9M A;  1PJ5 A;  3VRB A;  2DKI A;  4B1B A;  3V76 A;  3ATQ A;  1IUU A;  2OT4 A;  4GUV A;  3UKP A;  2LFC A;  1NDA A;  4YSX A;  1CC4 A;  3DJE A;  5GRT A;  3II4 A;  1F8S A;  1KFY A;  1Z6L A;  1ZOV A;  1OJA A;  2C3D A;  4H4V A;  4LA1 A;  2OA1 A;  1ZDL A;  2BYB A;  1KF6 A;  2WET A;  5KWF A;  4Y4N A;  4Z25 A;  4U2T A;  1OJC A;  1L9C A;  1S3E A;  3QSE A;  4C3Y A;  2BK5 A;  4NEW A;  1SP3 A;  2YLW A;  3DME A;  3IHM A;  3GYX A;  2Q6U A;  2Y6R A;  1IUS A;  1D5T A;  3M13 A;  3NLC A;  5FS9 A;  3BI2 A;  2XYO A;  1DXL A;  1YQ4 A;  3UTG A;  2XLU A;  2GMJ A;  2WS3 A;  5FS8 A;  4YKG A;  1TDK A;  3RHA A;  1LQT A;  2EQ8 A;  4RG3 A;  1Y0P A;  3UKA A;  1IUW A;  2C66 A;  2WOI A;  4U8N A;  1B8S A;  4C74 A;  4YTP A;  2BC0 A;  2OLO A;  3GDN A;  2WES A;  2QCU A;  3G5R A;  3G5S A;  4J34 A;  3DA1 A;  2GR1 A;  3UKF A;  1LTX R;  1NHS A;  3KLJ A;  1DOB A;  2Q7V A;  1CC6 A;  1S3B A;  2I0Z A;  1ZY8 A;  5TR3 A;  3S61 A;  3NN6 X;  4AP3 A;  2C67 A;  3AE4 A;  5EB5 A;  5DBJ A;  3GWF A;  3GDP A;  3FMW A;  2ZZB A;  2CVJ A;  3ALL A;  3NYE A;  4A7A A;  1LVL A;  3KVE A;  2YVF A;  5HYM A;  1NG4 A;  5EBK A;  1O94 A;  2GB0 A;  3ITJ A;  5CKU A;  2WHD A;  3NG7 X;  3M0O A;  2V60 A;  1CBO A;  3CN8 A;  2YR6 A;  2C3C A;  4J57 A;  1GOS A;  2JB3 A;  5FS6 A;  3PS9 A;  2Q0L A;  3ADA B;  1COY A;  1JNR A;  3ZYX A;  1GXF A;  1CL0 A;  1KNP A;  3OZ2 A;  1M1R A;  1N4U A;  2J7A A;  2EQ7 A;  2HQM A;  4U8I A;  3NK1 X;  3SXQ A;  2R0G A;  2XLP A;  3LXD A;  3CNT A;  2RGO A;  2VRM A;  1FS7 A;  1PBC A;  3FO3 A;  1ZOY A;  4Z26 A;  1CJ3 A;  2R9Z A;  3UKQ A;  3UTF A;  4Q1O A;  3IHG A;  1UKV G;  4A9W A;  3SGL A;  4H2Q A;  4H4R A;  1ONF A;  5M10 A;  1GET A;  3AB1 A;  1Q1W A;  3LZW A;  4H50 A;  3CND A;  1H7W A;  2V5Z A;  1P2E A;  4YKF A;  5HY5 A;  1H82 A;  2BK4 A;  3F8P A;  3DGZ A;  4FDC B;  4Y4M A;  4OCG A;  2YG5 A;  4EQW A;  3SFD A;  4WJY A;  2C73 A;  4IA5 A;  3ISH A;  3KPF A;  3D1I A;  2XVI A;  1O5W A;  4TLX A;  1HYU A;  2R45 A;  2X8C A;  4C3X A;  2AQJ A;  2GVC A;  1XDI A;  3B3R A;  1LV0 A;  1PBB A;  3LJP A;  3NK0 X;  1D4C A;  1K0J A;  5U25 A;  3AE7 A;  2X99 A;  2XFN A;  3UOY A;  1B5Q A;  3NIX A;  4CCQ A;  4JNQ A;  2RF7 A;  4H4W A;  4JDR A;  5C2T A;  3RKH A;  5JCL A;  4H4S A;  3QSM A;  1Y56 B;  3AD8 B;  1FCD A;  4CNJ A;  1N4W A;  2BAB A;  4DGK A;  2C7G A;  3UOX A;  1PDH A;  4B69 A;  1QDB A;  4U2L A;  3DK4 A;  1TYP A;  4U8L A;  2RDZ A;  1EL9 A;  2YM2 A;  4AP1 A;  4K5R A;  1GRB A;  3GD3 A;  5EOW A;  1ZMD A;  3CTY A;  4TM1 A;  1ZK7 A;  3CNJ A;  3GSI A;  2XDO A;  1K0L A;  2RGH A;  2E1M A;  1B37 A;  4DNA A;  2XLS A;  4EMW A;  2F5Z A;  3P4Q A;  4L3X A;  4Q4U A;  4B64 A;  3I6D A;  2V61 A;  2CDU A;  4H4U A;  1XHC A;  2WU2 A;  3NRN A;  4L3Z A;  2VQ7 A;  4DSH A;  2GQW A;  1NG3 A;  1NHQ A;  2AAQ A;  2V3B A;  1DNC A;  3UTH A;  3EPT A;  2IVD A;  1NEN A;  4P9S A;  2GEW A;  3DJG X;  5EB4 A;  1FT6 A;  5BRT A;  1P2H A;  1PJ7 A;  2A8X A;  1CJC A;  2XLT A;  4HB9 A;  4Z2U A;  2WPC A;  3RP7 A;  2Q0K A;  1H84 A;  2B9X A;  4I58 A;  1IUX A;  2B7R A;  3UU9 A;  3L1T A;  3RNM A;  2XVF A;  3CIR A;  2JAE A;  2BK3 A;  3C4N A;  1JRZ A;  3F8D A;  5J60 A;  3LG1 A;  1JOA A;  1MXT A;  1D4E A;  4MJW A;  2BS4 A;  2IVE A;  4H4Y A;  2ACZ A;  1IUT A;  1KNR A;  1FS8 A;  1GRA A;  3ALM A;  3COX A;  1PBD A;  2A87 A;  2E5V A;  2V6O A;  3K7M X;  2XCG A;  4TM4 A;  4EM4 A;  4AT0 A;  2VVM A;  3SM8 A;  4B68 A;  5KVI A;  1EL7 A;  2GQF A;  2YWL A;  4JY3 A;  2GMH A;  2YAU A;  1DJN A;  1LPF A;  3AD7 B;  4HA6 A;  4I59 A;  1OJ9 A;  3AEF A;  3BI5 A;  2CUL A;  1OJT A;  3KKJ A;  5LV9 A;  2EQ9 A;  2XFO A;  1CJ4 A;  4GR1 A;  3M12 A;  3P4P A;  1GEU A;  5L46 A;  1VRQ B;  1FEA A;  1GER A;  3KA7 A;  2XFU A;  4KPR A;  3NT6 A;  3PVC A;  1D7L A;  2VQB A;  3Q6J A;  2WEU A;  2WP5 A;  3AYI A;  3WE0 A;  1BWC A;  1F3P A;  1RSG A;  3BI4 A;  3FG2 P;  2RAB A;  4XWR A;  1DJQ A;  4J33 A;  3AE9 A;  5KXJ A;  1F8W A;  3AEE A;  3AE3 A;  1JU2 A;  2ZBW A;  4TM0 A;  3RP8 A;  2YM1 A;  2GR2 A;  4NTC A;  2YVG A;  3S7W A;  2BC1 A;  1GRF A;  1VG0 A;  2J3N A;  5JCN A;  3DGH A;  4O5U A;  3VR9 A;  4BK2 A;  4AOX A;  1BGJ A;  2TPR A;  4Z2R A;  2GR3 A;  3IWA A;  3AE6 A;  2QA1 A;  2X3N A;  1PHH A;  2R4E A;  2VOU A;  5U63 A;  4EIQ A;  1D7Y A;  3NKS A;  1AOG A;  3S5W A;  4E0V A;  4U8P A;  3AEG A;  3AXB A;  4LII A;  2XFP A;  3UOZ A;  4H4X A;  2FBW A;  2GAG B;  4CCR A;  3UP5 A;  1TDO A;  1Q9I A;  3UKH A;  3AE2 A;  1IJH A;  4YT0 A;  1E1M A;  1H83 A;  4J56 A;  3H8I A;  3BNJ A;  2WP9 A;  4ZCD A;  4K22 A;  2YG6 A;  4A79 A;  4YSH A;  2X50 A;  3AWI A;  4A99 A;  4EMI A;  1PS9 A;  4TM3 A;  3UKK A;  4IA6 A;  5BUK A;  3L8K A;  1K0I A;  4H4Q A;  4OPT A;  4Q17 A;  1NHR A;  4N9X A;  4IVM B;  2FJE A;  5GSN A;  5J7X A;  4Z24 A;  2ARD A;  4APN A;  1DOC A;  1JEH A;  4K5S A;  5KRQ A;  2WU5 A;  3NK2 X;  4EIP A;  1GRE A;  1GTE A;  4OVI A;  5BVA A;  2C70 A;  3CPJ G;  2XFQ A;  3CNS A;  3D8X A;  2BA9 A;  2R0P A;  5C3J A;  2BCG G;  3P1W A;  2WPE A;  3BNG A;  3AD9 B;  4YTM A;  1YKJ A;  4USR A;  4K7Z A;  1K4Q A;  3EF6 A;  3LZX A;  1EBD A;  3QFA A;  1OJD A;  4Z43 A;  2YR5 A;  4UDR A;  3CPI G;  3T37 A;  4EQX A;  1S2Q A;  3GD4 A;  1RYI A;  5JCM A;  1L0V A;  1YQ3 A;  3AE1 A;  3F29 A;  3TTB A;  2W0H A;  2XLR A;  2YR4 A;  3ABV A;  3CGC A;  1Q1R A;  3NYC A;  4GDP A;  4JY2 A;  4NZH A;  3RP6 A;  1GRG A;  1VG9 A;  4GDE A;  4J36 A;  1GT8 A;  3VR8 A;  2BCP A;  1D4D A;  2WDR A;  5CQF A;  3NTA A;  4Q5C A;  1PJ6 A;  3BHK A;  4ADW A;  4C77 A;  1B4V A;  1E1L A;  2DKH A;  3V3N A;  3NGC X;  5KOX A;  2ZO5 A;  2IID A;  4USQ A;  1TRB A;  3OC4 A;  5BUL A;  1GTH A;  1XPQ A;  4A65 A;  1M64 A;  3B6D A;  1RP0 A;  1GV4 A;  4K8D A;  3URH A;  3ALJ A;  2VVL G;  1GAL A;  2FJA A;  3RED A;  3P4R A;  3GRS A;  4FK1 C;  4AOS A;  4ZN0 A;  4GF7 A;  1H81 A;  1YQZ A;  2JB2 A;  5FS7 A;  1SEZ A;  1GPE A;  2GAH B;  3FPZ A;  4ZCC A;  4B66 A;  4B67 A;  4BJZ A;  1M6I A;  3NN0 X;  4EMJ A;  1DOD A;  1M1Q A;  2BS3 A;  3NNE A;  4D03 A;  5JCK A;  2YLS A;  4OPL A;  4OPG A;  1L9E A;  1ELI A;  3GWD A;  4YXD A;  1S2Y A;  4JN9 A;  4H2N A;  4H2R A;  2UZZ A;  4UDQ A;  1EL8 A;  1QO8 A;  3VQR A;  1NEK A;  1E7P A;  3ICR A;  1PBE A;  4Q0T A;  1MO9 A;  4GRT A;  4TLZ A;  3GM6 A;  1X31 B;  1L9D A;  1OAH A;  3IF9 A;  2CFY A;  5IQ4 A;  3NTD A;  4KX6 A;  1YY5 A;  3AEA A;  1BKW A;  2FJB A;  2VR0 A;  4FK1 A;  3ATR A;  4YSZ A;  5KVH A;  2OLN A;  1O95 A;  1M1P A;  4NTE A;  3SFE A;  4D04 A;  1GSN A;  3MMO A;  4U8O A;  2E80 A;  4CY6 A;  5FMH A;  4A6N A;  3VRD B;  1PXB A;  3GYJ A;  3BNM A;  3GRT A;  1MOK A;  3UOV A;  3EAO A;  4CNK A;  2E81 A;  1H7X A;  1N4V A;  2O9Z A;  2VRL A;  1NPX A;  1KSS A;  4BJY A;  3VRA A;  2EQ6 A;  2WBA A;  2VVL A;  5M0Z A;  2OAL A;  2BS2 A;  1W4X A;  3F8R A;  4O5Q A;  3DK8 A;  4WX1 A;  1PXC A;  2PHH A;  1FEC A;  4H4Z A;  4PAA A;  2WQY A;  3P9U A;  3GMC A;  3Q9T A;  4L38 A;  1CHU A;  1KDG A;  2XVE A;  3DH9 A;  4UP3 A;  1PN0 A;  2WDQ A;  1ZMC A;  4Y4L A;  3BHF A;  1PBF A;  4ECH A;  1QJD A;  1ZP0 A;  2XVJ A;  1FT5 A;  2WOV A;  4RG4 A;  1V59 A;  3O0H A;  1GRT A;  3JSK A;  2A89 A;  4H7U A;  2YLT A;  3ICS A;  1N1P A;  2X8H A;  4ICY A;  4OPD A;  3UTE A;  2GF3 A;  4PAB A;  3FBS A;  4IVO B;  5IPY A;  1REO A;  3NYF A;  1JRX A;  3QFB A;  2E4G A;  2Y6Q A;  3QVP A;  2C72 A;  2C75 A;  2WDV A;  3AED A;  3QSS A;  1GU6 A;  2B76 A;  3K30 A;  1GND A;  3GYI A;  3GMB A;  2Z5Y A;  1Y56 A;  4H4T A;  4BK1 A;  4C5O A;  1E6E A;  3AE8 A;  2C64 A;  1CC2 A;  3DJD A;  2K3V A;  4FX9 A;  2NVK X;  1TYT A;  2R4J A;  4K2X A;  3L1R A;  3LB8 A;  1H86 A;  4IV9 A;  2FJD A;  2ZZ0 A;  1EL5 A;  1TDE A;  4U8K A;  2OAM A;  3AYL A;  2WOW A;  4BV6 A;  4H4P A;  4U2S A;  4M52 A;  3CGD A;  4H2P A;  3E1T A;  1VQW A;  3AEB A;  1BGN A;  3NH3 X;  5HHF A;  2YQU A;  3SCE A;  2ZZC A;  4NEV A;  3AE5 A;  2QA2 A;  3P4S A;  1BZL A;  3UCL A;  4B65 A;  4A6N B;  1NHP A;  1LQU A;  2JK6 A;  3CNP A;  4EQS A;  1FL2 A;  1JRY A;  3TOR A;  4LU6 A;  4X9N A;  3DJJ A;  2WPF A;  3UP4 A;  4A5L A;  2B9Y A;  2R46 A;  2C65 A;  1JNZ A;  1ZX9 A;  2Z5X A;  2H88 A;  3K7T A;  4JQ9 A;  2YLX A;  3C96 A;  2APG A;  2B9W A;  2XVH A;  4EQR A;  1CF3 A;  1LJ1 A;  1FOH A;  1E39 A;  2X8G A;  5KOW A;  3ZDN A;  3DK9 A;  2PYX A;  3H8L A; 
#chains in the Genus database with same CATH topology
 1XAN A;  4CRT A;  2RGJ A;  1QLB A;  4OPU A;  4GCM A;  2JB1 A;  3KPK A;  1H6V A;  1PXA A;  3HZL A;  4RSL A;  2JBV A;  4XXG A;  2V3A A;  4AT2 A;  2YG7 A;  2YLR A;  1NAA A;  2H89 A;  3NHO X;  3AYJ A;  4U8J A;  1FS9 A;  1CJ2 A;  2YVJ A;  1GRH A;  4L3Y A;  3H4K A;  5KMR A;  2BAC A;  4Q5B A;  3AEC A;  3OWM A;  2GRT A;  1FEB A;  4U8M A;  4BK3 A;  1TDN A;  2B7S A;  2WP6 A;  4OPC A;  2AR8 A;  3KD9 A;  1TDF A;  3PO7 A;  4X4J A;  2TMD A;  5U1O A;  4G6H A;  4OPI A;  1DOE A;  4YTN A;  2R0C A;  1BVB A;  3CGB A;  4YWO A;  2YLZ A;  1ZKQ A;  1F6M A;  3ICT A;  1E1K A;  3LOV A;  3QJ4 A;  4J31 A;  4JNA A;  4II3 A;  3IC9 A;  2QAE A;  3LGQ A;  2GR0 A;  3BNU A;  5ER0 A;  3G5Q A;  5IQ1 A;  4Z44 A;  3CGE A;  4NTD A;  4YSY A;  4XWZ A;  2C76 A;  2GV8 A;  2BXS A;  3D1C A;  4B63 A;  1KSU A;  3BNH A;  3QVR A;  2VZ2 A;  3FIM B;  5HXI A;  1IUV A;  3C4A A;  2JKC A;  4BUR A;  2BXR A;  4G9K A;  4EM3 A;  4J2W A;  3I3L A;  1BF3 A;  2YG4 A;  1VDC A;  2GH5 A;  3KU9 A;  4G73 A;  3R9U A;  1F8R A;  2NPX A;  3SQP A;  4Z2T A;  3BNF A;  2YG3 A;  1JNI A;  3LAD A;  3K7Q X;  4REK A;  4UDP A;  3V3O A;  1E1N A;  3UBR A;  5JCI A;  3CPH G;  4CY8 A;  4CBQ A;  4DSG A;  3EAN A;  3UKL A;  4WCT A;  1GES A;  4X9M A;  1PJ5 A;  3VRB A;  2DKI A;  4B1B A;  3SY4 A;  3ATQ A;  1IUU A;  2OT4 A;  4GUV A;  3UKP A;  3V76 A;  2LFC A;  1NDA A;  4YSX A;  1CC4 A;  3DJE A;  5GRT A;  3II4 A;  5KMP A;  1F8S A;  1KFY A;  1Z6L A;  1ZOV A;  1OJA A;  2C3D A;  3T14 A;  4H4V A;  4LA1 A;  3T2K A;  2OA1 A;  1ZDL A;  2BYB A;  1KF6 A;  2WET A;  5KWF A;  4Y4N A;  4Z25 A;  4U2T A;  1OJC A;  1L9C A;  1S3E A;  3QSE A;  4C3Y A;  2BK5 A;  4NEW A;  1SP3 A;  2YLW A;  3DME A;  3IHM A;  3GYX A;  2Q6U A;  2Y6R A;  1IUS A;  1D5T A;  3M13 A;  3NLC A;  5FS9 A;  3BI2 A;  2XYO A;  1DXL A;  1YQ4 A;  3UTG A;  2XLU A;  2GMJ A;  2WS3 A;  5FS8 A;  4YKG A;  1TDK A;  3RHA A;  1LQT A;  2EQ8 A;  4RG3 A;  1Y0P A;  3UKA A;  1IUW A;  2C66 A;  2WOI A;  4GAP A;  1B8S A;  4U8N A;  4C74 A;  2BC0 A;  2OLO A;  4YTP A;  3GDN A;  2WES A;  2QCU A;  3G5R A;  3G5S A;  4J34 A;  3DA1 A;  4NNJ A;  2GR1 A;  3UKF A;  1LTX R;  1NHS A;  3KLJ A;  1DOB A;  2Q7V A;  1CC6 A;  1S3B A;  2I0Z A;  1ZY8 A;  5TR3 A;  3S61 A;  3NN6 X;  4AP3 A;  2C67 A;  3AE4 A;  5EB5 A;  5DBJ A;  3GWF A;  3GDP A;  3FMW A;  2ZZB A;  2CVJ A;  3ALL A;  3NYE A;  4A7A A;  1LVL A;  3KVE A;  2YVF A;  5HYM A;  1NG4 A;  5EBK A;  1O94 A;  2GB0 A;  3ITJ A;  5CKU A;  2WHD A;  3NG7 X;  3M0O A;  2V60 A;  1CBO A;  3CN8 A;  2YR6 A;  2C3C A;  4J57 A;  1GOS A;  2JB3 A;  5FS6 A;  3PS9 A;  2Q0L A;  3ADA B;  1COY A;  1JNR A;  3ZYX A;  1GXF A;  1CL0 A;  1KNP A;  3OZ2 A;  1M1R A;  1N4U A;  2J7A A;  2EQ7 A;  2HQM A;  4U8I A;  3NK1 X;  3SXQ A;  2R0G A;  2XLP A;  3LXD A;  3CNT A;  2RGO A;  2VRM A;  1FS7 A;  1PBC A;  3FO3 A;  1ZOY A;  4G74 A;  1CJ3 A;  2R9Z A;  3UKQ A;  3UTF A;  4Z26 A;  4Q1O A;  3IHG A;  1UKV G;  3SZC A;  4A9W A;  3SGL A;  4H2Q A;  4H4R A;  1ONF A;  5M10 A;  1GET A;  3AB1 A;  1Q1W A;  3LZW A;  4H50 A;  3CND A;  1H7W A;  2V5Z A;  1P2E A;  4YKF A;  5HY5 A;  1H82 A;  2BK4 A;  3F8P A;  3DGZ A;  4FDC B;  4Y4M A;  4OCG A;  2YG5 A;  4EQW A;  3SFD A;  4WJY A;  2C73 A;  4IA5 A;  3ISH A;  3KPF A;  3D1I A;  2XVI A;  1O5W A;  4TLX A;  1HYU A;  2R45 A;  2X8C A;  4C3X A;  2AQJ A;  2GVC A;  1XDI A;  3B3R A;  1LV0 A;  1PBB A;  3LJP A;  3NK0 X;  1D4C A;  1K0J A;  5U25 A;  3AE7 A;  2X99 A;  2XFN A;  3UOY A;  1B5Q A;  3NIX A;  4CCQ A;  4JNQ A;  2RF7 A;  4H4W A;  4JDR A;  5C2T A;  3RKH A;  5JCL A;  4H4S A;  3QSM A;  1Y56 B;  3AD8 B;  1FCD A;  4CNJ A;  1N4W A;  2BAB A;  4DGK A;  3SZW A;  2C7G A;  3UOX A;  1PDH A;  4B69 A;  1QDB A;  4U2L A;  3DK4 A;  1TYP A;  4U8L A;  2RDZ A;  1EL9 A;  2YM2 A;  4AP1 A;  4K5R A;  1GRB A;  3GD3 A;  5EOW A;  1ZMD A;  3CTY A;  4TM1 A;  1ZK7 A;  3CNJ A;  3GSI A;  2XDO A;  1K0L A;  2RGH A;  2E1M A;  1B37 A;  4DNA A;  2XLS A;  4EMW A;  2F5Z A;  3P4Q A;  4L3X A;  4Q4U A;  4B64 A;  3I6D A;  2V61 A;  2CDU A;  4H4U A;  1XHC A;  2WU2 A;  3NRN A;  4L3Z A;  2VQ7 A;  4DSH A;  2BRA A;  5KNL A;  2GQW A;  1NG3 A;  1NHQ A;  2AAQ A;  2V3B A;  1DNC A;  3UTH A;  3EPT A;  2IVD A;  1NEN A;  4P9S A;  2GEW A;  3DJG X;  5EB4 A;  1FT6 A;  5BRT A;  1P2H A;  1PJ7 A;  2A8X A;  1CJC A;  2XLT A;  4HB9 A;  4Z2U A;  2WPC A;  3RP7 A;  2Q0K A;  1H84 A;  2B9X A;  4I58 A;  1IUX A;  2B7R A;  3UU9 A;  3L1T A;  3RNM A;  2XVF A;  3CIR A;  2JAE A;  2BK3 A;  3C4N A;  1JRZ A;  3F8D A;  5J60 A;  3LG1 A;  1JOA A;  1MXT A;  1D4E A;  4MJW A;  2BS4 A;  5KMS A;  2IVE A;  4H4Y A;  2ACZ A;  1IUT A;  1KNR A;  1FS8 A;  1GRA A;  3ALM A;  3COX A;  1PBD A;  2A87 A;  2E5V A;  2V6O A;  3K7M X;  2XCG A;  4TM4 A;  4EM4 A;  4AT0 A;  2VVM A;  3SM8 A;  4B68 A;  5KVI A;  1EL7 A;  2GQF A;  2C4C A;  2YWL A;  4JY3 A;  2GMH A;  2YAU A;  1DJN A;  1LPF A;  3AD7 B;  4HA6 A;  4I59 A;  1OJ9 A;  3AEF A;  3BI5 A;  2CUL A;  1OJT A;  3KKJ A;  5LV9 A;  2EQ9 A;  2XFO A;  3CMM A;  1CJ4 A;  4GR1 A;  3M12 A;  3P4P A;  1GEU A;  5L46 A;  1VRQ B;  1FEA A;  1GER A;  3KA7 A;  2XFU A;  4KPR A;  3NT6 A;  3PVC A;  1D7L A;  2VQB A;  3Q6J A;  2WEU A;  2WP5 A;  3AYI A;  3WE0 A;  1BWC A;  1F3P A;  1RSG A;  3BI4 A;  3FG2 P;  3T2Y A;  2RAB A;  4XWR A;  1DJQ A;  4J33 A;  3AE9 A;  5KXJ A;  1F8W A;  3AEE A;  3SZF A;  3AE3 A;  1JU2 A;  2ZBW A;  4TM0 A;  3RP8 A;  2YM1 A;  2GR2 A;  4NTC A;  3HYW A;  2YVG A;  3S7W A;  2BC1 A;  1GRF A;  1VG0 A;  2J3N A;  5JCN A;  3DGH A;  4O5U A;  3VR9 A;  4BK2 A;  4AOX A;  1BGJ A;  2TPR A;  4Z2R A;  2GR3 A;  3IWA A;  3AE6 A;  2QA1 A;  2X3N A;  1PHH A;  2R4E A;  2VOU A;  5U63 A;  4EIQ A;  1D7Y A;  3NKS A;  1AOG A;  3S5W A;  4E0V A;  4U8P A;  3AEG A;  3AXB A;  4LII A;  2XFP A;  3UOZ A;  4H4X A;  2FBW A;  2GAG B;  4CCR A;  3UP5 A;  1TDO A;  1Q9I A;  3UKH A;  3AE2 A;  1IJH A;  4YT0 A;  1E1M A;  1H83 A;  4J56 A;  3H8I A;  2CZS A;  3BNJ A;  2WP9 A;  3T2Z A;  4ZCD A;  4II2 A;  4K22 A;  2YG6 A;  4A79 A;  4YSH A;  2X50 A;  3AWI A;  4A99 A;  4EMI A;  1PS9 A;  4TM3 A;  3UKK A;  4IA6 A;  5BUK A;  3L8K A;  1K0I A;  4H4Q A;  4OPT A;  4Q17 A;  1NHR A;  4N9X A;  4IVM B;  2FJE A;  5GSN A;  5J7X A;  4Z24 A;  2ARD A;  4APN A;  1DOC A;  1JEH A;  4K5S A;  5KRQ A;  2WU5 A;  3NK2 X;  4EIP A;  1GRE A;  1GTE A;  4OVI A;  5BVA A;  2C70 A;  3CPJ G;  2XFQ A;  3CNS A;  3D8X A;  2BA9 A;  2R0P A;  5C3J A;  2BCG G;  3P1W A;  2WPE A;  3BNG A;  3AD9 B;  4YTM A;  2BRY A;  1YKJ A;  4USR A;  4K7Z A;  1K4Q A;  3EF6 A;  3LZX A;  1EBD A;  3QFA A;  1OJD A;  4Z43 A;  2YR5 A;  4UDR A;  3CPI G;  3T37 A;  4EQX A;  1S2Q A;  3GD4 A;  1RYI A;  5JCM A;  1L0V A;  1YQ3 A;  3AE1 A;  3F29 A;  3TTB A;  2W0H A;  2XLR A;  2YR4 A;  3ABV A;  3CGC A;  1Q1R A;  3NYC A;  4GDP A;  4JY2 A;  4NZH A;  3RP6 A;  1GRG A;  1VG9 A;  4GDE A;  4J36 A;  1GT8 A;  3VR8 A;  2BCP A;  1D4D A;  2WDR A;  5CQF A;  3NTA A;  4Q5C A;  1PJ6 A;  3BHK A;  4ADW A;  4C77 A;  1B4V A;  1E1L A;  2DKH A;  3SXI A;  3SX6 A;  3NGC X;  3V3N A;  2ZO5 A;  2IID A;  4USQ A;  5KOX A;  1TRB A;  3OC4 A;  5BUL A;  1GTH A;  1XPQ A;  3T0K A;  4A65 A;  1M64 A;  3B6D A;  1RP0 A;  1GV4 A;  4K8D A;  3URH A;  3ALJ A;  2VVL G;  1GAL A;  2FJA A;  3RED A;  3P4R A;  3GRS A;  4FK1 C;  4AOS A;  4ZN0 A;  4GF7 A;  1H81 A;  1YQZ A;  2JB2 A;  5FS7 A;  1SEZ A;  1GPE A;  2GAH B;  3FPZ A;  4ZCC A;  4B66 A;  4B67 A;  4BJZ A;  1M6I A;  3NN0 X;  4EMJ A;  1DOD A;  1M1Q A;  2BS3 A;  3NNE A;  4D03 A;  5JCK A;  2YLS A;  4OPL A;  4OPG A;  1L9E A;  1ELI A;  3GWD A;  4YXD A;  1S2Y A;  4JN9 A;  4H2N A;  4H2R A;  2UZZ A;  4UDQ A;  1EL8 A;  1QO8 A;  3VQR A;  1NEK A;  1E7P A;  3ICR A;  1PBE A;  4Q0T A;  1MO9 A;  4GRT A;  4TLZ A;  3GM6 A;  1X31 B;  5KMQ A;  1L9D A;  1OAH A;  3IF9 A;  2CFY A;  5IQ4 A;  3NTD A;  4KX6 A;  1YY5 A;  3AEA A;  1BKW A;  2FJB A;  2VR0 A;  4FK1 A;  3ATR A;  4YSZ A;  5KVH A;  2OLN A;  1O95 A;  1M1P A;  4NTE A;  3SFE A;  4D04 A;  1GSN A;  3MMO A;  4U8O A;  2E80 A;  4CY6 A;  5FMH A;  4A6N A;  3VRD B;  1PXB A;  3GYJ A;  3BNM A;  3GRT A;  1MOK A;  3UOV A;  3EAO A;  4CNK A;  2E81 A;  1H7X A;  1N4V A;  2O9Z A;  2VRL A;  1NPX A;  1KSS A;  4BJY A;  3VRA A;  2EQ6 A;  3HYX A;  2WBA A;  2VVL A;  3SYI A;  5M0Z A;  2OAL A;  2BS2 A;  1W4X A;  3F8R A;  4O5Q A;  3DK8 A;  4WX1 A;  3HYV A;  1PXC A;  2PHH A;  1FEC A;  4H4Z A;  4PAA A;  4NWZ A;  2WQY A;  3P9U A;  3GMC A;  3Q9T A;  4L38 A;  1CHU A;  1KDG A;  2XVE A;  3DH9 A;  4UP3 A;  1PN0 A;  2WDQ A;  1ZMC A;  4GAV A;  4Y4L A;  3BHF A;  1PBF A;  4ECH A;  1QJD A;  1ZP0 A;  2XVJ A;  1FT5 A;  2WOV A;  4RG4 A;  1V59 A;  3O0H A;  1GRT A;  3JSK A;  2A89 A;  4H7U A;  2YLT A;  3ICS A;  1N1P A;  2X8H A;  4ICY A;  4OPD A;  3T31 A;  2GF3 A;  4PAB A;  3FBS A;  4IVO B;  3UTE A;  1REO A;  5IPY A;  3NYF A;  1JRX A;  3QFB A;  2E4G A;  2Y6Q A;  3QVP A;  2C72 A;  2C75 A;  2WDV A;  3AED A;  3QSS A;  1GU6 A;  2B76 A;  3K30 A;  1GND A;  3GYI A;  3GMB A;  2Z5Y A;  1Y56 A;  4H4T A;  4BK1 A;  4C5O A;  1E6E A;  3AE8 A;  2C64 A;  1CC2 A;  3DJD A;  2K3V A;  4FX9 A;  2NVK X;  1TYT A;  4G6G A;  2R4J A;  4K2X A;  3L1R A;  3LB8 A;  1H86 A;  4IV9 A;  2FJD A;  2ZZ0 A;  1EL5 A;  1TDE A;  4U8K A;  2OAM A;  3AYL A;  2WOW A;  4BV6 A;  4H4P A;  4U2S A;  4M52 A;  3CGD A;  4H2P A;  3E1T A;  1VQW A;  3AEB A;  1BGN A;  3NH3 X;  5HHF A;  2YQU A;  3SCE A;  2ZZC A;  4NEV A;  3AE5 A;  2QA2 A;  3P4S A;  1BZL A;  3UCL A;  4B65 A;  4A6N B;  1NHP A;  1LQU A;  2JK6 A;  3CNP A;  4EQS A;  1FL2 A;  1JRY A;  3TOR A;  4LU6 A;  4X9N A;  3DJJ A;  2WPF A;  3UP4 A;  4A5L A;  2B9Y A;  2R46 A;  2C65 A;  1JNZ A;  1ZX9 A;  2Z5X A;  2H88 A;  3K7T A;  4JQ9 A;  2YLX A;  3C96 A;  2APG A;  2B9W A;  2XVH A;  3SZ0 A;  4EQR A;  1CF3 A;  1LJ1 A;  1FOH A;  1E39 A;  2X8G A;  5KOW A;  3ZDN A;  3DK9 A;  2PYX A;  3H8L A; 
#chains in the Genus database with same CATH homology
 1XAN A;  4CRT A;  2RGJ A;  1QLB A;  4OPU A;  4GCM A;  2JB1 A;  3KPK A;  1H6V A;  1PXA A;  3HZL A;  4RSL A;  2JBV A;  4XXG A;  2V3A A;  4AT2 A;  2YG7 A;  2YLR A;  1NAA A;  2H89 A;  3NHO X;  3AYJ A;  4U8J A;  1FS9 A;  1CJ2 A;  2YVJ A;  1GRH A;  4L3Y A;  3H4K A;  5KMR A;  2BAC A;  4Q5B A;  3AEC A;  3OWM A;  2GRT A;  1FEB A;  4U8M A;  4BK3 A;  1TDN A;  2B7S A;  2WP6 A;  4OPC A;  2AR8 A;  3KD9 A;  1TDF A;  3PO7 A;  4X4J A;  2TMD A;  5U1O A;  4G6H A;  4OPI A;  1DOE A;  4YTN A;  2R0C A;  1BVB A;  3CGB A;  4YWO A;  2YLZ A;  1ZKQ A;  1F6M A;  3ICT A;  1E1K A;  3LOV A;  3QJ4 A;  4J31 A;  4JNA A;  4II3 A;  3IC9 A;  2QAE A;  3LGQ A;  2GR0 A;  3BNU A;  5ER0 A;  3G5Q A;  5IQ1 A;  4Z44 A;  3CGE A;  4NTD A;  4YSY A;  4XWZ A;  2C76 A;  2GV8 A;  2BXS A;  3D1C A;  4B63 A;  1KSU A;  3BNH A;  3QVR A;  2VZ2 A;  3FIM B;  5HXI A;  1IUV A;  3C4A A;  2JKC A;  4BUR A;  2BXR A;  4G9K A;  4EM3 A;  4J2W A;  3I3L A;  1BF3 A;  2YG4 A;  1VDC A;  2GH5 A;  3KU9 A;  4G73 A;  3R9U A;  1F8R A;  2NPX A;  3SQP A;  4Z2T A;  3BNF A;  2YG3 A;  1JNI A;  3LAD A;  3K7Q X;  4REK A;  4UDP A;  3V3O A;  1E1N A;  3UBR A;  5JCI A;  3CPH G;  4CY8 A;  4CBQ A;  4DSG A;  3EAN A;  3UKL A;  4WCT A;  1GES A;  4X9M A;  1PJ5 A;  3VRB A;  2DKI A;  4B1B A;  3SY4 A;  3ATQ A;  1IUU A;  2OT4 A;  4GUV A;  3UKP A;  3V76 A;  2LFC A;  1NDA A;  4YSX A;  1CC4 A;  3DJE A;  5GRT A;  3II4 A;  5KMP A;  1F8S A;  1KFY A;  1Z6L A;  1ZOV A;  1OJA A;  2C3D A;  3T14 A;  4H4V A;  4LA1 A;  3T2K A;  2OA1 A;  1ZDL A;  2BYB A;  1KF6 A;  2WET A;  5KWF A;  4Y4N A;  4Z25 A;  4U2T A;  1OJC A;  1L9C A;  1S3E A;  3QSE A;  4C3Y A;  2BK5 A;  4NEW A;  1SP3 A;  2YLW A;  3DME A;  3IHM A;  3GYX A;  2Q6U A;  2Y6R A;  1IUS A;  1D5T A;  3M13 A;  3NLC A;  5FS9 A;  3BI2 A;  2XYO A;  1DXL A;  1YQ4 A;  3UTG A;  2XLU A;  2GMJ A;  2WS3 A;  5FS8 A;  4YKG A;  1TDK A;  3RHA A;  1LQT A;  2EQ8 A;  4RG3 A;  1Y0P A;  3UKA A;  1IUW A;  2C66 A;  2WOI A;  4GAP A;  1B8S A;  4U8N A;  4C74 A;  2BC0 A;  2OLO A;  4YTP A;  3GDN A;  2WES A;  2QCU A;  3G5R A;  3G5S A;  4J34 A;  3DA1 A;  4NNJ A;  2GR1 A;  3UKF A;  1LTX R;  1NHS A;  3KLJ A;  1DOB A;  2Q7V A;  1CC6 A;  1S3B A;  2I0Z A;  1ZY8 A;  5TR3 A;  3S61 A;  3NN6 X;  4AP3 A;  2C67 A;  3AE4 A;  5EB5 A;  5DBJ A;  3GWF A;  3GDP A;  3FMW A;  2ZZB A;  2CVJ A;  3ALL A;  3NYE A;  4A7A A;  1LVL A;  3KVE A;  2YVF A;  5HYM A;  1NG4 A;  5EBK A;  1O94 A;  2GB0 A;  3ITJ A;  5CKU A;  2WHD A;  3NG7 X;  3M0O A;  2V60 A;  1CBO A;  3CN8 A;  2YR6 A;  2C3C A;  4J57 A;  1GOS A;  2JB3 A;  5FS6 A;  3PS9 A;  2Q0L A;  3ADA B;  1COY A;  1JNR A;  3ZYX A;  1GXF A;  1CL0 A;  1KNP A;  3OZ2 A;  1M1R A;  1N4U A;  2J7A A;  2EQ7 A;  2HQM A;  4U8I A;  3NK1 X;  3SXQ A;  2R0G A;  2XLP A;  3LXD A;  3CNT A;  2RGO A;  2VRM A;  1FS7 A;  1PBC A;  3FO3 A;  1ZOY A;  4G74 A;  1CJ3 A;  2R9Z A;  3UKQ A;  3UTF A;  4Z26 A;  4Q1O A;  3IHG A;  1UKV G;  3SZC A;  4A9W A;  3SGL A;  4H2Q A;  4H4R A;  1ONF A;  5M10 A;  1GET A;  3AB1 A;  1Q1W A;  3LZW A;  4H50 A;  3CND A;  1H7W A;  2V5Z A;  1P2E A;  4YKF A;  5HY5 A;  1H82 A;  2BK4 A;  3F8P A;  3DGZ A;  4FDC B;  4Y4M A;  4OCG A;  2YG5 A;  4EQW A;  3SFD A;  4WJY A;  2C73 A;  4IA5 A;  3ISH A;  3KPF A;  3D1I A;  2XVI A;  1O5W A;  4TLX A;  1HYU A;  2R45 A;  2X8C A;  4C3X A;  2AQJ A;  2GVC A;  1XDI A;  3B3R A;  1LV0 A;  1PBB A;  3LJP A;  3NK0 X;  1D4C A;  1K0J A;  5U25 A;  3AE7 A;  2X99 A;  2XFN A;  3UOY A;  1B5Q A;  3NIX A;  4CCQ A;  4JNQ A;  2RF7 A;  4H4W A;  4JDR A;  5C2T A;  3RKH A;  5JCL A;  4H4S A;  3QSM A;  1Y56 B;  3AD8 B;  1FCD A;  4CNJ A;  1N4W A;  2BAB A;  4DGK A;  3SZW A;  2C7G A;  3UOX A;  1PDH A;  4B69 A;  1QDB A;  4U2L A;  3DK4 A;  1TYP A;  4U8L A;  2RDZ A;  1EL9 A;  2YM2 A;  4AP1 A;  4K5R A;  1GRB A;  3GD3 A;  5EOW A;  1ZMD A;  3CTY A;  4TM1 A;  1ZK7 A;  3CNJ A;  3GSI A;  2XDO A;  1K0L A;  2RGH A;  2E1M A;  1B37 A;  4DNA A;  2XLS A;  4EMW A;  2F5Z A;  3P4Q A;  4L3X A;  4Q4U A;  4B64 A;  3I6D A;  2V61 A;  2CDU A;  4H4U A;  1XHC A;  2WU2 A;  3NRN A;  4L3Z A;  2VQ7 A;  4DSH A;  2BRA A;  5KNL A;  2GQW A;  1NG3 A;  1NHQ A;  2AAQ A;  2V3B A;  1DNC A;  3UTH A;  3EPT A;  2IVD A;  1NEN A;  4P9S A;  2GEW A;  3DJG X;  5EB4 A;  1FT6 A;  5BRT A;  1P2H A;  1PJ7 A;  2A8X A;  1CJC A;  2XLT A;  4HB9 A;  4Z2U A;  2WPC A;  3RP7 A;  2Q0K A;  1H84 A;  2B9X A;  4I58 A;  1IUX A;  2B7R A;  3UU9 A;  3L1T A;  3RNM A;  2XVF A;  3CIR A;  2JAE A;  2BK3 A;  3C4N A;  1JRZ A;  3F8D A;  5J60 A;  3LG1 A;  1JOA A;  1MXT A;  1D4E A;  4MJW A;  2BS4 A;  5KMS A;  2IVE A;  4H4Y A;  2ACZ A;  1IUT A;  1KNR A;  1FS8 A;  1GRA A;  3ALM A;  3COX A;  1PBD A;  2A87 A;  2E5V A;  2V6O A;  3K7M X;  2XCG A;  4TM4 A;  4EM4 A;  4AT0 A;  2VVM A;  3SM8 A;  4B68 A;  5KVI A;  1EL7 A;  2GQF A;  2C4C A;  2YWL A;  4JY3 A;  2GMH A;  2YAU A;  1DJN A;  1LPF A;  3AD7 B;  4HA6 A;  4I59 A;  1OJ9 A;  3AEF A;  3BI5 A;  2CUL A;  1OJT A;  3KKJ A;  5LV9 A;  2EQ9 A;  2XFO A;  3CMM A;  1CJ4 A;  4GR1 A;  3M12 A;  3P4P A;  1GEU A;  5L46 A;  1VRQ B;  1FEA A;  1GER A;  3KA7 A;  2XFU A;  4KPR A;  3NT6 A;  3PVC A;  1D7L A;  2VQB A;  3Q6J A;  2WEU A;  2WP5 A;  3AYI A;  3WE0 A;  1BWC A;  1F3P A;  1RSG A;  3BI4 A;  3FG2 P;  3T2Y A;  2RAB A;  4XWR A;  1DJQ A;  4J33 A;  3AE9 A;  5KXJ A;  1F8W A;  3AEE A;  3SZF A;  3AE3 A;  1JU2 A;  2ZBW A;  4TM0 A;  3RP8 A;  2YM1 A;  2GR2 A;  4NTC A;  3HYW A;  2YVG A;  3S7W A;  2BC1 A;  1GRF A;  1VG0 A;  2J3N A;  5JCN A;  3DGH A;  4O5U A;  3VR9 A;  4BK2 A;  4AOX A;  1BGJ A;  2TPR A;  4Z2R A;  2GR3 A;  3IWA A;  3AE6 A;  2QA1 A;  2X3N A;  1PHH A;  2R4E A;  2VOU A;  5U63 A;  4EIQ A;  1D7Y A;  3NKS A;  1AOG A;  3S5W A;  4E0V A;  4U8P A;  3AEG A;  3AXB A;  4LII A;  2XFP A;  3UOZ A;  4H4X A;  2FBW A;  2GAG B;  4CCR A;  3UP5 A;  1TDO A;  1Q9I A;  3UKH A;  3AE2 A;  1IJH A;  4YT0 A;  1E1M A;  1H83 A;  4J56 A;  3H8I A;  3BNJ A;  2WP9 A;  3T2Z A;  4ZCD A;  4II2 A;  4K22 A;  2YG6 A;  4A79 A;  4YSH A;  2X50 A;  3AWI A;  4A99 A;  4EMI A;  1PS9 A;  4TM3 A;  3UKK A;  4IA6 A;  5BUK A;  3L8K A;  1K0I A;  4H4Q A;  4OPT A;  4Q17 A;  1NHR A;  4N9X A;  4IVM B;  2FJE A;  5GSN A;  5J7X A;  4Z24 A;  2ARD A;  4APN A;  1DOC A;  1JEH A;  4K5S A;  5KRQ A;  2WU5 A;  3NK2 X;  4EIP A;  1GRE A;  1GTE A;  4OVI A;  5BVA A;  2C70 A;  3CPJ G;  2XFQ A;  3CNS A;  3D8X A;  2BA9 A;  2R0P A;  5C3J A;  2BCG G;  3P1W A;  2WPE A;  3BNG A;  3AD9 B;  4YTM A;  2BRY A;  1YKJ A;  4USR A;  4K7Z A;  1K4Q A;  3EF6 A;  3LZX A;  1EBD A;  3QFA A;  1OJD A;  4Z43 A;  2YR5 A;  4UDR A;  3CPI G;  3T37 A;  4EQX A;  1S2Q A;  3GD4 A;  1RYI A;  5JCM A;  1L0V A;  1YQ3 A;  3AE1 A;  3F29 A;  3TTB A;  2W0H A;  2XLR A;  2YR4 A;  3ABV A;  3CGC A;  1Q1R A;  3NYC A;  4GDP A;  4JY2 A;  4NZH A;  3RP6 A;  1GRG A;  1VG9 A;  4GDE A;  4J36 A;  1GT8 A;  3VR8 A;  2BCP A;  1D4D A;  2WDR A;  5CQF A;  3NTA A;  4Q5C A;  1PJ6 A;  3BHK A;  4ADW A;  4C77 A;  1B4V A;  1E1L A;  2DKH A;  3SXI A;  3SX6 A;  3NGC X;  3V3N A;  2ZO5 A;  2IID A;  4USQ A;  5KOX A;  1TRB A;  3OC4 A;  5BUL A;  1GTH A;  1XPQ A;  3T0K A;  4A65 A;  1M64 A;  3B6D A;  1RP0 A;  1GV4 A;  4K8D A;  3URH A;  3ALJ A;  2VVL G;  1GAL A;  2FJA A;  3RED A;  3P4R A;  3GRS A;  4FK1 C;  4AOS A;  4ZN0 A;  4GF7 A;  1H81 A;  1YQZ A;  2JB2 A;  5FS7 A;  1SEZ A;  1GPE A;  2GAH B;  3FPZ A;  4ZCC A;  4B66 A;  4B67 A;  4BJZ A;  1M6I A;  3NN0 X;  4EMJ A;  1DOD A;  1M1Q A;  2BS3 A;  3NNE A;  4D03 A;  5JCK A;  2YLS A;  4OPL A;  4OPG A;  1L9E A;  1ELI A;  3GWD A;  4YXD A;  1S2Y A;  4JN9 A;  4H2N A;  4H2R A;  2UZZ A;  4UDQ A;  1EL8 A;  1QO8 A;  3VQR A;  1NEK A;  1E7P A;  3ICR A;  1PBE A;  4Q0T A;  1MO9 A;  4GRT A;  4TLZ A;  3GM6 A;  1X31 B;  5KMQ A;  1L9D A;  1OAH A;  3IF9 A;  2CFY A;  5IQ4 A;  3NTD A;  4KX6 A;  1YY5 A;  3AEA A;  1BKW A;  2FJB A;  2VR0 A;  4FK1 A;  3ATR A;  4YSZ A;  5KVH A;  2OLN A;  1O95 A;  1M1P A;  4NTE A;  3SFE A;  4D04 A;  1GSN A;  3MMO A;  4U8O A;  2E80 A;  4CY6 A;  5FMH A;  4A6N A;  3VRD B;  1PXB A;  3GYJ A;  3BNM A;  3GRT A;  1MOK A;  3UOV A;  3EAO A;  4CNK A;  2E81 A;  1H7X A;  1N4V A;  2O9Z A;  2VRL A;  1NPX A;  1KSS A;  4BJY A;  3VRA A;  2EQ6 A;  3HYX A;  2WBA A;  2VVL A;  3SYI A;  5M0Z A;  2OAL A;  2BS2 A;  1W4X A;  3F8R A;  4O5Q A;  3DK8 A;  4WX1 A;  3HYV A;  1PXC A;  2PHH A;  1FEC A;  4H4Z A;  4PAA A;  4NWZ A;  2WQY A;  3P9U A;  3GMC A;  3Q9T A;  4L38 A;  1CHU A;  1KDG A;  2XVE A;  3DH9 A;  4UP3 A;  1PN0 A;  2WDQ A;  1ZMC A;  4GAV A;  4Y4L A;  3BHF A;  1PBF A;  4ECH A;  1QJD A;  1ZP0 A;  2XVJ A;  1FT5 A;  2WOV A;  4RG4 A;  1V59 A;  3O0H A;  1GRT A;  3JSK A;  2A89 A;  4H7U A;  2YLT A;  3ICS A;  1N1P A;  2X8H A;  4ICY A;  4OPD A;  3T31 A;  2GF3 A;  4PAB A;  3FBS A;  4IVO B;  3UTE A;  1REO A;  5IPY A;  3NYF A;  1JRX A;  3QFB A;  2E4G A;  2Y6Q A;  3QVP A;  2C72 A;  2C75 A;  2WDV A;  3AED A;  3QSS A;  1GU6 A;  2B76 A;  3K30 A;  1GND A;  3GYI A;  3GMB A;  2Z5Y A;  1Y56 A;  4H4T A;  4BK1 A;  4C5O A;  1E6E A;  3AE8 A;  2C64 A;  1CC2 A;  3DJD A;  2K3V A;  4FX9 A;  2NVK X;  1TYT A;  4G6G A;  2R4J A;  4K2X A;  3L1R A;  3LB8 A;  1H86 A;  4IV9 A;  2FJD A;  2ZZ0 A;  1EL5 A;  1TDE A;  4U8K A;  2OAM A;  3AYL A;  2WOW A;  4BV6 A;  4H4P A;  4U2S A;  4M52 A;  3CGD A;  4H2P A;  3E1T A;  1VQW A;  3AEB A;  1BGN A;  3NH3 X;  5HHF A;  2YQU A;  3SCE A;  2ZZC A;  4NEV A;  3AE5 A;  2QA2 A;  3P4S A;  1BZL A;  3UCL A;  4B65 A;  4A6N B;  1NHP A;  1LQU A;  2JK6 A;  3CNP A;  4EQS A;  1FL2 A;  1JRY A;  3TOR A;  4LU6 A;  4X9N A;  3DJJ A;  2WPF A;  3UP4 A;  4A5L A;  2B9Y A;  2R46 A;  2C65 A;  1JNZ A;  1ZX9 A;  2Z5X A;  2H88 A;  3K7T A;  4JQ9 A;  2YLX A;  3C96 A;  2APG A;  2B9W A;  2XVH A;  3SZ0 A;  4EQR A;  1CF3 A;  1LJ1 A;  1FOH A;  1E39 A;  2X8G A;  5KOW A;  3ZDN A;  3DK9 A;  2PYX A;  3H8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...