1KSUA

Crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHYTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c
publication title Role of His505 in the soluble fumarate reductase from Shewanella frigidimarina.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 196
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1ksuA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1ksuA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1ksuA01
3MMOA 4B66A 5GSNA 3HZLA 3C4NA 1CC2A 2VVLA 5FMHA 4IV9A 2TMDA 2QA1A 1MXTA 1ZOYA 3CNSA 4USQA 1H84A 3AD8B 4BURA 3SFEA 2C65A 2F5ZA 4JQ9A 4D03A 3AE2A 4HB9A 4P9SA 4Z25A 5KOXA 1ONFA 1PDHA 1S3BA 1EL8A 3URHA 1GV4A 1JNZA 2YLWA 2GQWA 3OWMA 3KD9A 3NYFA 4Y4MA 5M0ZA 4OCGA 4Z2RA 4YTNA 1M1QA 1OJ9A 3C96A 1ZOVA 5HYMA 2AQJA 1NEKA 2JAEA 2R4JA 4EQXA 4NEVA 2XLSA 3AD7B 2XVEA 3AE4A 1BWCA 2GR2A 3GM6A 1L9EA 1KFYA 1TDNA 4PABA 3NTDA 4U8NA 3UP5A 4DGKA 2E81A 1DOBA 1CL0A 5CKUA 1E1NA 3QFAA 3VR8A 2NVKX 3CIRA 1LPFA 3DA1A 2YLTA 3BI5A 2OA1A 3CPHG 3NK2X 2IVDA 2C72A 4B64A 1CJ2A 1N4VA 1ZX9A 1NHRA 2WQYA 3GD4A 3ZYXA 3DH9A 4H4TA 1O5WA 2WPCA 4JY3A 2GMHA 4UP3A 3I6DA 1GRFA 1KDGA 1H6VA 1N4WA 4ICYA 4EQSA 2BXRA 2WU5A 1NHSA 3BNMA 4REKA 2YWLA 1L0VA 1FL2A 3L8KA 1TDEA 1VG0A 3NT6A 3P4RA 2B9WA 3DK8A 4H4ZA 1LQTA 1Q1RA 3P1WA 1D4CA 1KSUA 1MO9A 4YKGA 4ZN0A 3D8XA 4C5OA 3LOVA 1H81A 4J31A 5HHFA 1D7YA 2YLXA 3P9UA 3AEFA 4TM0A 4USRA 1NHQA 3DGHA 4AP3A 2BK4A 1BGNA 2J7AA 5JCKA 3E1TA 3C4AA 4Y4NA 2WP6A 2EQ7A 1JNRA 4X4JA 2BS2A 2WESA 3CNJA 2ZBWA 3LADA 3NLCA 3AB1A 4BK3A 4GDPA 4AOSA 4A6NB 1XDIA 1NG4A 1D5TA 3AYJA 3RP6A 1COYA 1S3EA 4H4RA 3AYIA 4NTEA 1JRXA 2TPRA 1YQZA 2J3NA 4H7UA 4UDRA 5IQ1A 3SQPA 2V6OA 3EPTA 3UU9A 2FJAA 2WS3A 3UP4A 4KX6A 4U8KA 2ZZBA 4A7AA 2Q6UA 3V3OA 2K3VA 3RP7A 1ZP0A 1KF6A 2E80A 2I0ZA 5JCNA 1PXBA 2C76A 3ITJA 1M1RA 4EM4A 3GDPA 4U8MA 3UKHA 1TYPA 4YT0A 3CGDA 4NTDA 3UKLA 3UTGA 2E1MA 1PJ5A 1PBBA 2WP5A 2XVJA 2OAMA 3D1CA 3Q6JA 3M12A 3BI4A 3UKFA 1GRGA 1QLBA 3FMWA 2XFUA 3GRTA 3OZ2A 4B65A 4YSHA 4XWZA 3DK4A 3AE8A 2C70A 3PVCA 5IQ4A 3GYXA 1RP0A 4AT2A 1H7WA 2ZZ0A 1AOGA 1H82A 2BACA 3FBSA 4U8OA 1PXAA 2R0CA 2APGA 2GR1A 2H89A 2VVMA 2WDVA 4Z26A 1CBOA 3AEAA 5BRTA 2YG5A 2PHHA 2R4EA 2BK5A 4CY6A 1JRZA 1XHCA 2A87A 4ZCDA 2E4GA 3CGBA 2C3CA 3NN0X 4TLXA 4JNAA 4B68A 3GYJA 2VR0A 2FJDA 1KNRA 2C3DA 4U2TA 3BNHA 1GALA 2GR0A 3Q9TA 2RGOA 4KPRA 1EL5A 3V76A 1IUXA 2V61A 3LJPA 1DODA 1X31B 3AD9B 1FOHA 1TYTA 3KLJA 4H2NA 4K5RA 4K7ZA 3UCLA 4CRTA 2YM1A 5JCIA 3PS9A 3BNGA 1B37A 3ADAB 1JU2A 1OAHA 3O0HA 4I59A 1BF3A 1VQWA 2WETA 3ALLA 4TM4A 5C2TA 3CN8A 1LJ1A 1H83A 2IIDA 4HA6A 4I58A 5KRQA 1NENA 3AEGA 4H4UA 3IF9A 2LFCA 3BNUA 2V3BA 3I3LA 1O95A 3AE9A 4TLZA 4NEWA 3ISHA 1GETA 2VQ7A 3DJGX 4H4QA 3P4QA 2X3NA 4A6NA 1XPQA 3NK1X 1IJHA 4H4VA 2X8GA 4C3XA 1CC4A 4EIQA 3GRSA 4FX9A 2V60A 2WPFA 4LA1A 1D4DA 2BC0A 3G5RA 3LGQA 3KPFA 4OPGA 5BVAA 4H4SA 2CDUA 4Q1OA 4GDEA 1GSNA 2FJEA 2XVFA 4OPIA 2QA2A 3LB8A 2YVJA 4OPCA 1CC6A 4AOXA 4A9WA 4RG3A 3KVEA 3L1RA 1GRHA 3SGLA 1H86A 3QJ4A 1YKJA 3L1TA 1F3PA 2RDZA 3CGEA 1D4EA 3NGCX 3RHAA 1IUVA 2XFPA 1GRBA 1F8SA 3QVPA 1CHUA 3FO3A 2WBAA 4YSYA 4Q4UA 1MOKA 3NTAA 2BYBA 2B7SA 1GPEA 3IWAA 4LIIA 3ALMA 1Q9IA 3FPZA 3QSEA 1PS9A 5KOWA 3VR9A 1LQUA 3H4KA 5IPYA 4EMJA 1BZLA 2R0PA 3UKAA 1D7LA 4Q5BA 3UKKA 5JCLA 2GEWA 1PHHA 2WOVA 1K0IA 1IUSA 2XVHA 3GWFA 4J33A 2JKCA 2XLPA 3VRBA 3LZWA 2PYXA 1NDAA 2GMJA 2CULA 1IUTA 3KKJA 4GCMA 2C67A 3ATQA 1LV0A 4IVMB 1EL7A 3JSKA 4EM3A 1TDKA 3QVRA 4X9MA 5U25A 4H4WA 3IC9A 4O5QA 5DBJA 1ZMCA 1E1MA 5J7XA 4BK1A 4U2LA 4EQWA 2C75A 3GYIA 1O94A 3GSIA 4B67A 4XXGA 1K4QA 4CCQA 4Q17A 1E1KA 4OVIA 2RF7A 3CNTA 2Q0LA 2XDOA 4TM3A 1F8WA 1ELIA 4FK1C 2XLTA 4B1BA 4OPDA 2VRLA 2X8CA 3VQRA 2R9ZA 1IUUA 1XANA 1E39A 1OJAA 4J57A 1KSSA 1CJ4A 5EBKA 1K0LA 4Z43A 4TM1A 2YM2A 1PN0A 2CFYA 4GRTA 4L3XA 3UBRA 2RGHA 3BHKA 4NZHA 2OT4A 2Q7VA 3EAOA 5KVIA 1JOAA 2XYOA 3P4SA 5EOWA 1FS8A 3RKHA 1DJNA 2VOUA 2C64A 3CGCA 4J36A 2QAEA 5CQFA 4C3YA 2FJBA 2RABA 2BABA 3BNFA 4ZCCA 1EBDA 4JDRA 2JB1A 1GNDA 4UDQA 4OPUA 1GREA 4EIPA 3AECA 3BHFA 1QJDA 1JEHA 1K0JA 1BVBA 4H4XA 2ACZA 2GR3A 2BC1A 3TORA 3QSMA 3WE0A 2R46A 1LVLA 3VRDB 2BA9A 4YTPA 3CPJG 2QCUA 1PBFA 3AE1A 1PBEA 2EQ6A 3DJDA 4U8IA 4DSHA 2C7GA 1QO8A 1NAAA 4K8DA 3DGZA 3R9UA 4YSZA 1L9CA 3H8IA 2XVIA 3NN6X 1N1PA 2BK3A 1RSGA 5KVHA 2B76A 4A79A 4EQRA 1FT6A 3F8DA 1M64A 4RG4A 3DJEA 3FG2P 4NTCA 4L3YA 3K30A 3AE7A 3II4A 1CF3A 1GTHA 2B9XA 3K7MX 1VG9A 4B63A 2H88A 1F6MA 3AEBA 2DKIA 3OC4A 2YG6A 4YXDA 2X8HA 3ATRA 3UOXA 4WCTA 5FS7A 4APNA 2BCGG 3GWDA 2YLZA 1LTXR 2GRTA 1DOCA 4CNKA 5FS8A 2JB3A 2VQBA 4LU6A 4C74A 2YG7A 3ALJA 4L3ZA 1S2QA 1FT5A 2GVCA 1GTEA 1ZKQA 1HYUA 4OPLA 2YAUA 3H8LA 2OLNA 2ZZCA 4U8JA 1FEAA 3CTYA 1IUWA 4OPTA 3M0OA 4B69A 4YSXA 4GF7A 5EB5A 3S61A 5J60A 3G5SA 3KU9A 1CJ3A 4YWOA 2R45A 1KNPA 2GAGB 1DJQA 5LV9A 2XCGA 2RGJA 3K7QX 4GUVA 4DNAA 2YLRA 1ZY8A 2AR8A 3ICTA 4O5UA 1Y56B 1TRBA 2YG3A 2OLOA 4CY8A 5ER0A 3LG1A 1VDCA 1PBCA 2GV8A 4IA6A 3RP8A 3NNEA 3AYLA 3QSSA 3NH3X 4Z24A 2IVEA 1GOSA 4DSGA 1SEZA 2VZ2A 3UTEA 1GEUA 2YVGA 3CNDA 2WDQA 4JN9A 2V5ZA 4YKFA 3NIXA 4X9NA 3DMEA 4IVOB 5M10A 4BJZA 1FECA 4H2PA 5TR3A 3UTFA 1JRYA 1F8RA 1DXLA 4J56A 3K7TA 3AWIA 4UDPA 4Z2UA 2YR6A 4J2WA 1Z6LA 2BCPA 1E1LA 3S5WA 2WPEA 4H2QA 5U63A 2BS4A 2ARDA 4EMIA 3NG7X 4Z2TA 2FBWA 4ADWA 5BULA 2EQ8A 4CNJA 3T37A 1M6IA 1OJTA 2V3AA 3GMBA 1NG3A 1PBDA 1GU6A 3GD3A 2O9ZA 2GQFA 2Q0KA 2VVLG 2X99A 3M13A 4U8LA 1CJCA 2UZZA 3VRAA 5JCMA 1FCDA 4E0VA 2YR4A 3DJJA 4JNQA 3BNJA 3EF6A 1VRQB 3SM8A 3NKSA 4FK1A 4C77A 1DOEA 4WX1A 2GF3A 5L46A 1FEBA 2JB2A 4K2XA 3G5QA 2GAHB 1EL9A 3NYEA 4PAAA 3NRNA 4Z44A 4EMWA 1L9DA 4U8PA 3UOYA 1ZK7A 4A99A 4AT0A 4A5LA 3D1IA 2Z5XA 2WU2A 5HXIA 1JNIA 3RNMA 2GB0A 3LXDA 1GT8A 1ZMDA 1H7XA 2NPXA 3NHOX 2YVFA 1N4UA 2BXSA 2C66A 2JBVA 2DKHA 3CPIG 4A65A 4CCRA 4J34A 5KXJA 1QDBA 3UTHA 5FS9A 3AXBA 4M52A 4XWRA 1RYIA 2XFNA 3V3NA 3AEDA 2E5VA 4U2SA 1DNCA 1SP3A 1UKVG 1Y56A 2AAQA 3AEEA 1TDFA 3NYCA 1P2HA 4GR1A 3UKQA 1GRTA 1OJCA 4L38A 3QFBA 4BJYA 2GH5A 1W4XA 3DK9A 1GRAA 1FS9A 2WOWA 2HQMA 2YG4A 5HY5A 1B4VA 5GRTA 2XFOA 1TDOA 1FS7A 3ZDNA 2Y6RA 1V59A 3F8PA 4MJWA 3BI2A 2B9YA 1GERA 4D04A 3ABVA 5EB4A 1M1PA 2WDRA 5U1OA 4BV6A 3F8RA 4ECHA 1PJ6A 1PXCA 3P4PA 2XLUA 3ICSA 3TTBA 3F29A 1NHPA 3IHGA 4K5SA 3SCEA 1S2YA 3GDNA 4YTMA 3UKPA 5KWFA 1B5QA 3SFDA 1OJDA 2YLSA 3FIMB 4K22A 2Y6QA 2R0GA 2CVJA 5BUKA 3IHMA 1GESA 4H50A 3REDA 3CNPA 1BKWA 2XFQA 2YR5A 1B8SA 5C3JA 1YQ4A 3SXQA 2A8XA 1YQ3A 2BS3A 3LZXA 1PJ7A 1BGJA 4BK2A 2C73A 3EANA 1GXFA 4N9XA 3AE6A 3GMCA 4H2RA 3PO7A 4RSLA 2WHDA 3AE5A 4H4YA 3UOZA 2Z5YA 3B3RA 3COXA 4IA5A 1E6EA 2W0HA 4WJYA 1ZDLA 2WOIA 2ZO5A 2A89A 5FS6A 4AP1A 4Q5CA 3B6DA 3NK0X 2XLRA 2JK6A 4H4PA 1E7PA 2B7RA 1Y0PA 2VRMA 4JY2A 1P2EA 2YQUA 1NPXA 3UOVA 3S7WA 3ICRA 4Y4LA 1YY5A 2WEUA 2OALA 2X50A 3AE3A 4FDCB 2EQ9A 1Q1WA 3KA7A 4CBQA 4Q0TA 2WP9A 1REOA
chains in the Genus database with same CATH superfamily
3MMOA 4B66A 5GSNA 3HZLA 3C4NA 1CC2A 2VVLA 5FMHA 4IV9A 2TMDA 2QA1A 1MXTA 1ZOYA 3CNSA 4USQA 1H84A 3AD8B 4BURA 3SFEA 2C65A 2F5ZA 4JQ9A 4D03A 3AE2A 4HB9A 4P9SA 4Z25A 5KOXA 3SY4A 1ONFA 1PDHA 3SX6A 1S3BA 1EL8A 3URHA 1GV4A 1JNZA 2YLWA 2GQWA 3OWMA 3KD9A 3NYFA 4Y4MA 5M0ZA 4OCGA 4Z2RA 4G73A 4YTNA 1M1QA 1OJ9A 3C96A 1ZOVA 5HYMA 2AQJA 1NEKA 2JAEA 2R4JA 4EQXA 4NEVA 2XLSA 3AD7B 2XVEA 3AE4A 1BWCA 2GR2A 3GM6A 1L9EA 1KFYA 1TDNA 4PABA 3NTDA 4U8NA 3UP5A 4G9KA 4DGKA 2E81A 1DOBA 1CL0A 5CKUA 1E1NA 3QFAA 3VR8A 2NVKX 3CIRA 1LPFA 3DA1A 2YLTA 3BI5A 2OA1A 3CPHG 3NK2X 2IVDA 2C72A 3T0KA 1CJ2A 1N4VA 1ZX9A 1NHRA 2WQYA 3GD4A 4B64A 3ZYXA 3DH9A 4H4TA 1O5WA 2WPCA 4JY3A 2GMHA 4UP3A 3I6DA 1GRFA 1KDGA 1H6VA 1N4WA 4ICYA 4EQSA 2BXRA 2WU5A 1NHSA 3BNMA 4REKA 2YWLA 1L0VA 1FL2A 3L8KA 1TDEA 1VG0A 3NT6A 3P4RA 2B9WA 3DK8A 4H4ZA 1LQTA 1Q1RA 3P1WA 1D4CA 1KSUA 1MO9A 3SZCA 4YKGA 4ZN0A 3D8XA 4C5OA 3LOVA 1H81A 4J31A 5HHFA 1D7YA 2YLXA 3P9UA 3AEFA 4TM0A 4USRA 1NHQA 3DGHA 4AP3A 2BK4A 1BGNA 2J7AA 5JCKA 3E1TA 3C4AA 4Y4NA 2WP6A 2EQ7A 1JNRA 4X4JA 2BS2A 2WESA 3CNJA 2ZBWA 3LADA 3NLCA 3AB1A 4NWZA 4BK3A 4GDPA 4AOSA 4A6NB 1XDIA 1NG4A 1D5TA 3AYJA 3RP6A 1COYA 1S3EA 4H4RA 3AYIA 4NTEA 1JRXA 2TPRA 4GAPA 1YQZA 2J3NA 4H7UA 4UDRA 5IQ1A 3SQPA 2V6OA 3EPTA 3UU9A 2FJAA 2WS3A 3UP4A 4KX6A 4U8KA 2ZZBA 4A7AA 2Q6UA 3V3OA 2K3VA 3RP7A 1ZP0A 1KF6A 5KMPA 2E80A 2I0ZA 5JCNA 1PXBA 2C76A 3ITJA 1M1RA 4EM4A 3GDPA 4U8MA 3UKHA 1TYPA 4YT0A 3CGDA 4NTDA 3UKLA 3UTGA 2E1MA 1PJ5A 4NNJA 1PBBA 2WP5A 2XVJA 2OAMA 3D1CA 3Q6JA 3M12A 3BI4A 3UKFA 1GRGA 1QLBA 3FMWA 2XFUA 3GRTA 3OZ2A 4B65A 4YSHA 4XWZA 3DK4A 3AE8A 2C70A 3GYXA 3PVCA 5IQ4A 4G6HA 1RP0A 4AT2A 1H7WA 2ZZ0A 1AOGA 1H82A 2BACA 3FBSA 4U8OA 1PXAA 2R0CA 2APGA 2GR1A 2H89A 2VVMA 2WDVA 4Z26A 1CBOA 3AEAA 5BRTA 2YG5A 2PHHA 2R4EA 2BK5A 4CY6A 1JRZA 1XHCA 2A87A 4ZCDA 4II2A 2E4GA 3CGBA 2C3CA 3NN0X 4TLXA 4JNAA 4B68A 3GYJA 2VR0A 2FJDA 1KNRA 2C3DA 4U2TA 3BNHA 1GALA 2GR0A 3Q9TA 2RGOA 4GAVA 1EL5A 4KPRA 3V76A 1IUXA 2V61A 3LJPA 1DODA 1X31B 3AD9B 1FOHA 1TYTA 3KLJA 4H2NA 4K5RA 4K7ZA 3T14A 3UCLA 2YM1A 4CRTA 3PS9A 3BNGA 1B37A 3ADAB 1JU2A 1OAHA 3O0HA 4I59A 1BF3A 1VQWA 2WETA 3ALLA 4TM4A 5C2TA 3CN8A 3HYVA 1LJ1A 1H83A 2IIDA 4G6GA 4HA6A 4I58A 3SZ0A 5KRQA 1NENA 3AEGA 4H4UA 3IF9A 2LFCA 3BNUA 2V3BA 3I3LA 1O95A 3AE9A 3HYWA 4TLZA 4NEWA 3ISHA 1GETA 2VQ7A 3DJGX 4H4QA 3P4QA 2X3NA 4A6NA 1XPQA 3NK1X 1IJHA 4H4VA 2X8GA 4C3XA 1CC4A 4EIQA 3GRSA 4FX9A 2V60A 2WPFA 4LA1A 1D4DA 2BC0A 3G5RA 3LGQA 3KPFA 4OPGA 5BVAA 4H4SA 2CDUA 4Q1OA 4GDEA 1GSNA 2FJEA 2XVFA 4OPIA 2QA2A 3LB8A 2YVJA 4OPCA 3T31A 1CC6A 4AOXA 4A9WA 4RG3A 5KMQA 3KVEA 3L1RA 1GRHA 3SGLA 1H86A 3QJ4A 1YKJA 3L1TA 1F3PA 2RDZA 3CGEA 1D4EA 3NGCX 3RHAA 1IUVA 2XFPA 1GRBA 4II3A 1F8SA 3QVPA 1CHUA 3FO3A 2WBAA 4YSYA 4Q4UA 1MOKA 3NTAA 2BYBA 2B7SA 1GPEA 3IWAA 4LIIA 3ALMA 1Q9IA 3FPZA 3QSEA 1PS9A 5KOWA 3VR9A 1LQUA 3H4KA 5IPYA 4EMJA 1BZLA 2R0PA 3UKAA 1D7LA 4Q5BA 3UKKA 5JCLA 2GEWA 1PHHA 2WOVA 1K0IA 1IUSA 2XVHA 3GWFA 4J33A 2JKCA 2XLPA 3VRBA 3LZWA 2PYXA 1NDAA 2GMJA 2CULA 1IUTA 3KKJA 4GCMA 2C67A 3ATQA 1LV0A 4IVMB 1EL7A 3JSKA 4EM3A 1TDKA 3QVRA 2C4CA 4X9MA 4H4WA 3IC9A 4O5QA 5DBJA 1ZMCA 1E1MA 5J7XA 4BK1A 4U2LA 4EQWA 2C75A 3GYIA 1O94A 3GSIA 3T2KA 4XXGA 1K4QA 4B67A 4Q17A 4CCQA 1E1KA 5JCIA 4OVIA 2RF7A 3CNTA 2Q0LA 2XDOA 4TM3A 1F8WA 1ELIA 4FK1C 2XLTA 4B1BA 4OPDA 2VRLA 2X8CA 3VQRA 2R9ZA 1IUUA 1XANA 1E39A 1OJAA 4J57A 1KSSA 1CJ4A 5EBKA 1K0LA 4Z43A 4TM1A 2YM2A 1PN0A 2CFYA 4GRTA 4L3XA 3UBRA 2RGHA 3BHKA 4NZHA 2OT4A 2Q7VA 3EAOA 5KVIA 1JOAA 2XYOA 3P4SA 5EOWA 1FS8A 3RKHA 1DJNA 2VOUA 2C64A 3CGCA 4J36A 2QAEA 5CQFA 4C3YA 2FJBA 2RABA 2BABA 3BNFA 4ZCCA 1EBDA 4JDRA 2JB1A 1GNDA 4UDQA 4OPUA 1GREA 4EIPA 3AECA 3BHFA 1QJDA 1JEHA 1K0JA 1BVBA 4H4XA 2ACZA 2GR3A 2CZSA 2BC1A 3TORA 3QSMA 3WE0A 2R46A 1LVLA 3VRDB 2BA9A 4YTPA 3CPJG 2QCUA 1PBFA 3AE1A 1PBEA 2EQ6A 3DJDA 4U8IA 4DSHA 2C7GA 3SXIA 5U25A 1QO8A 1NAAA 4K8DA 3DGZA 3R9UA 4YSZA 1L9CA 3H8IA 2XVIA 3NN6X 1N1PA 2BK3A 1RSGA 5KVHA 2B76A 4A79A 4EQRA 1FT6A 3F8DA 1M64A 4RG4A 3DJEA 3FG2P 4NTCA 4L3YA 3K30A 3AE7A 3II4A 1CF3A 1GTHA 2B9XA 3K7MX 1VG9A 4B63A 2H88A 1F6MA 3AEBA 2DKIA 3OC4A 2YG6A 4YXDA 2X8HA 3ATRA 3UOXA 4WCTA 5FS7A 4APNA 2BCGG 3GWDA 2YLZA 1LTXR 2GRTA 1DOCA 4CNKA 5FS8A 2JB3A 3SYIA 2VQBA 4LU6A 4C74A 2YG7A 3ALJA 4L3ZA 1S2QA 1FT5A 2GVCA 1GTEA 1ZKQA 1HYUA 4OPLA 2YAUA 3H8LA 2OLNA 2ZZCA 4U8JA 1FEAA 3CTYA 1IUWA 4OPTA 3M0OA 4B69A 4YSXA 4GF7A 5EB5A 3S61A 5J60A 3G5SA 3KU9A 1CJ3A 4YWOA 2R45A 1KNPA 2GAGB 1DJQA 5LV9A 2XCGA 2RGJA 3K7QX 4GUVA 4DNAA 2YLRA 1ZY8A 2AR8A 3ICTA 4O5UA 1Y56B 1TRBA 2YG3A 2OLOA 4CY8A 5ER0A 3LG1A 1VDCA 1PBCA 2GV8A 4IA6A 3RP8A 3NNEA 3AYLA 3QSSA 3NH3X 4Z24A 2IVEA 3SZFA 1GOSA 4DSGA 1SEZA 2VZ2A 3UTEA 1GEUA 2YVGA 3CNDA 2WDQA 4JN9A 2V5ZA 4YKFA 5KNLA 3NIXA 4X9NA 3DMEA 4IVOB 5M10A 4BJZA 1FECA 4H2PA 5TR3A 3UTFA 1JRYA 5KMSA 1F8RA 1DXLA 4J56A 3K7TA 3AWIA 4UDPA 4Z2UA 2YR6A 4J2WA 1Z6LA 2BCPA 1E1LA 3S5WA 2WPEA 4H2QA 5U63A 2BS4A 2ARDA 4EMIA 3NG7X 4Z2TA 2FBWA 4ADWA 5BULA 2EQ8A 4CNJA 3T37A 1M6IA 1OJTA 2V3AA 3GMBA 1NG3A 1PBDA 1GU6A 3GD3A 2O9ZA 2GQFA 2Q0KA 2VVLG 2X99A 3M13A 4U8LA 3SZWA 1CJCA 2UZZA 3VRAA 5JCMA 1FCDA 4E0VA 2YR4A 3DJJA 4G74A 4JNQA 3BNJA 3EF6A 1VRQB 3SM8A 3NKSA 4FK1A 4C77A 1DOEA 4WX1A 2GF3A 5L46A 1FEBA 2JB2A 4K2XA 3G5QA 2GAHB 1EL9A 3NYEA 4PAAA 3NRNA 4Z44A 4EMWA 1L9DA 4U8PA 3UOYA 1ZK7A 4A99A 4AT0A 4A5LA 3D1IA 2Z5XA 2WU2A 5HXIA 1JNIA 3RNMA 2GB0A 3LXDA 1GT8A 1ZMDA 1H7XA 2NPXA 3NHOX 2YVFA 1N4UA 2BXSA 2C66A 2JBVA 2DKHA 3CPIG 4A65A 4CCRA 4J34A 5KXJA 1QDBA 3UTHA 5FS9A 3AXBA 4M52A 4XWRA 1RYIA 2XFNA 3V3NA 3AEDA 3HYXA 2E5VA 4U2SA 1DNCA 1SP3A 1UKVG 1Y56A 2AAQA 3AEEA 1TDFA 3NYCA 1P2HA 4GR1A 3UKQA 3T2ZA 1GRTA 1OJCA 4L38A 3CMMA 3QFBA 4BJYA 2GH5A 1W4XA 3DK9A 3KPKA 1GRAA 5KMRA 1FS9A 2WOWA 2HQMA 2YG4A 5HY5A 1B4VA 5GRTA 2XFOA 1TDOA 1FS7A 3ZDNA 2Y6RA 1V59A 3F8PA 4MJWA 3BI2A 2B9YA 1GERA 4D04A 3ABVA 5EB4A 1M1PA 2WDRA 5U1OA 4BV6A 3F8RA 4ECHA 1PJ6A 1PXCA 3P4PA 2XLUA 3ICSA 3TTBA 3F29A 1NHPA 3IHGA 4K5SA 3SCEA 1S2YA 3GDNA 4YTMA 3UKPA 5KWFA 1B5QA 3SFDA 1OJDA 2YLSA 3FIMB 4K22A 2Y6QA 2R0GA 2CVJA 5BUKA 3IHMA 1GESA 4H50A 3REDA 3CNPA 1BKWA 2XFQA 2YR5A 1B8SA 5C3JA 1YQ4A 3SXQA 2A8XA 1YQ3A 2BS3A 3LZXA 1PJ7A 1BGJA 4BK2A 2C73A 3EANA 1GXFA 4N9XA 3AE6A 3GMCA 4H2RA 3PO7A 4RSLA 2WHDA 3AE5A 4H4YA 3UOZA 2Z5YA 3B3RA 3COXA 4IA5A 1E6EA 2W0HA 4WJYA 1ZDLA 2WOIA 2ZO5A 2A89A 5FS6A 4AP1A 4Q5CA 3B6DA 3NK0X 2XLRA 3T2YA 2JK6A 4H4PA 1E7PA 2BRYA 2B7RA 1Y0PA 2VRMA 4JY2A 1P2EA 2YQUA 1NPXA 3UOVA 3S7WA 3ICRA 4Y4LA 1YY5A 2WEUA 2BRAA 2OALA 2X50A 3AE3A 4FDCB 2EQ9A 1Q1WA 3KA7A 4CBQA 4Q0TA 2WP9A 1REOA
chains in the Genus database with same CATH topology
3MMOA 4B66A 5GSNA 3HZLA 3C4NA 1CC2A 2VVLA 5FMHA 4IV9A 2TMDA 2QA1A 1MXTA 1ZOYA 3CNSA 4USQA 1H84A 3AD8B 4BURA 3SFEA 2C65A 2F5ZA 4JQ9A 4D03A 3AE2A 4HB9A 4P9SA 4Z25A 5KOXA 3SY4A 1ONFA 1PDHA 3SX6A 1S3BA 1EL8A 3URHA 1GV4A 1JNZA 2YLWA 2GQWA 3OWMA 3KD9A 3NYFA 4Y4MA 5M0ZA 4OCGA 4Z2RA 4G73A 4YTNA 1M1QA 1OJ9A 3C96A 1ZOVA 5HYMA 2AQJA 1NEKA 2JAEA 2R4JA 4EQXA 4NEVA 2XLSA 3AD7B 2XVEA 3AE4A 1BWCA 2GR2A 3GM6A 1L9EA 1KFYA 1TDNA 4PABA 3NTDA 4U8NA 3UP5A 4G9KA 4DGKA 2E81A 1DOBA 1CL0A 5CKUA 1E1NA 3QFAA 3VR8A 2NVKX 3CIRA 1LPFA 3DA1A 2YLTA 3BI5A 2OA1A 3CPHG 3NK2X 2IVDA 2C72A 3T0KA 1CJ2A 1N4VA 1ZX9A 1NHRA 2WQYA 3GD4A 4B64A 3ZYXA 3DH9A 4H4TA 1O5WA 2WPCA 4JY3A 2GMHA 4UP3A 3I6DA 1GRFA 1KDGA 1H6VA 1N4WA 4ICYA 4EQSA 2BXRA 2WU5A 1NHSA 3BNMA 4REKA 2YWLA 1L0VA 1FL2A 3L8KA 1TDEA 1VG0A 3NT6A 3P4RA 2B9WA 3DK8A 4H4ZA 1LQTA 1Q1RA 3P1WA 1D4CA 1KSUA 1MO9A 3SZCA 4YKGA 4ZN0A 3D8XA 4C5OA 3LOVA 1H81A 4J31A 5HHFA 1D7YA 2YLXA 3P9UA 3AEFA 4TM0A 4USRA 1NHQA 3DGHA 4AP3A 2BK4A 1BGNA 2J7AA 5JCKA 3E1TA 3C4AA 4Y4NA 2WP6A 2EQ7A 1JNRA 4X4JA 2BS2A 2WESA 3CNJA 2ZBWA 3LADA 3NLCA 3AB1A 4NWZA 4BK3A 4GDPA 4AOSA 4A6NB 1XDIA 1NG4A 1D5TA 3AYJA 3RP6A 1COYA 1S3EA 4H4RA 3AYIA 4NTEA 1JRXA 2TPRA 4GAPA 1YQZA 2J3NA 4H7UA 4UDRA 5IQ1A 3SQPA 2V6OA 3EPTA 3UU9A 2FJAA 2WS3A 3UP4A 4KX6A 4U8KA 2ZZBA 4A7AA 2Q6UA 3V3OA 2K3VA 3RP7A 1ZP0A 1KF6A 5KMPA 2E80A 2I0ZA 5JCNA 1PXBA 2C76A 3ITJA 1M1RA 4EM4A 3GDPA 4U8MA 3UKHA 1TYPA 4YT0A 3CGDA 4NTDA 3UKLA 3UTGA 2E1MA 1PJ5A 4NNJA 1PBBA 2WP5A 2XVJA 2OAMA 3D1CA 3Q6JA 3M12A 3BI4A 3UKFA 1GRGA 1QLBA 3FMWA 2XFUA 3GRTA 3OZ2A 4B65A 4YSHA 4XWZA 3DK4A 3AE8A 2C70A 3GYXA 3PVCA 5IQ4A 4G6HA 1RP0A 4AT2A 1H7WA 2ZZ0A 1AOGA 1H82A 2BACA 3FBSA 4U8OA 1PXAA 2R0CA 2APGA 2GR1A 2H89A 2VVMA 2WDVA 4Z26A 1CBOA 3AEAA 5BRTA 2YG5A 2PHHA 2R4EA 2BK5A 4CY6A 1JRZA 1XHCA 2A87A 4ZCDA 4II2A 2E4GA 3CGBA 2C3CA 3NN0X 4TLXA 4JNAA 4B68A 3GYJA 2VR0A 2FJDA 1KNRA 2C3DA 4U2TA 3BNHA 1GALA 2GR0A 3Q9TA 2RGOA 4GAVA 1EL5A 4KPRA 3V76A 1IUXA 2V61A 3LJPA 1DODA 1X31B 3AD9B 1FOHA 1TYTA 3KLJA 4H2NA 4K5RA 4K7ZA 3T14A 3UCLA 2YM1A 4CRTA 3PS9A 3BNGA 1B37A 3ADAB 1JU2A 1OAHA 3O0HA 4I59A 1BF3A 1VQWA 2WETA 3ALLA 4TM4A 5C2TA 3CN8A 3HYVA 1LJ1A 1H83A 2IIDA 4G6GA 4HA6A 4I58A 3SZ0A 5KRQA 1NENA 3AEGA 4H4UA 3IF9A 2LFCA 3BNUA 2V3BA 3I3LA 1O95A 3AE9A 3HYWA 4TLZA 4NEWA 3ISHA 1GETA 2VQ7A 3DJGX 4H4QA 3P4QA 2X3NA 4A6NA 1XPQA 3NK1X 1IJHA 4H4VA 2X8GA 4C3XA 1CC4A 4EIQA 3GRSA 4FX9A 2V60A 2WPFA 4LA1A 1D4DA 2BC0A 3G5RA 3LGQA 3KPFA 4OPGA 5BVAA 4H4SA 2CDUA 4Q1OA 4GDEA 1GSNA 2FJEA 2XVFA 4OPIA 2QA2A 3LB8A 2YVJA 4OPCA 3T31A 1CC6A 4AOXA 4A9WA 4RG3A 5KMQA 3KVEA 3L1RA 1GRHA 3SGLA 1H86A 3QJ4A 1YKJA 3L1TA 1F3PA 2RDZA 3CGEA 1D4EA 3NGCX 3RHAA 1IUVA 2XFPA 1GRBA 4II3A 1F8SA 3QVPA 1CHUA 3FO3A 2WBAA 4YSYA 4Q4UA 1MOKA 3NTAA 2BYBA 2B7SA 1GPEA 3IWAA 4LIIA 3ALMA 1Q9IA 3FPZA 3QSEA 1PS9A 5KOWA 3VR9A 1LQUA 3H4KA 5IPYA 4EMJA 1BZLA 2R0PA 3UKAA 1D7LA 4Q5BA 3UKKA 5JCLA 2GEWA 1PHHA 2WOVA 1K0IA 1IUSA 2XVHA 3GWFA 4J33A 2JKCA 2XLPA 3VRBA 3LZWA 2PYXA 1NDAA 2GMJA 2CULA 1IUTA 3KKJA 4GCMA 2C67A 3ATQA 1LV0A 4IVMB 1EL7A 3JSKA 4EM3A 1TDKA 3QVRA 2C4CA 4X9MA 4H4WA 3IC9A 4O5QA 5DBJA 1ZMCA 1E1MA 5J7XA 4BK1A 4U2LA 4EQWA 2C75A 3GYIA 1O94A 3GSIA 3T2KA 4XXGA 1K4QA 4B67A 4Q17A 4CCQA 1E1KA 5JCIA 4OVIA 2RF7A 3CNTA 2Q0LA 2XDOA 4TM3A 1F8WA 1ELIA 4FK1C 2XLTA 4B1BA 4OPDA 2VRLA 2X8CA 3VQRA 2R9ZA 1IUUA 1XANA 1E39A 1OJAA 4J57A 1KSSA 1CJ4A 5EBKA 1K0LA 4Z43A 4TM1A 2YM2A 1PN0A 2CFYA 4GRTA 4L3XA 3UBRA 2RGHA 3BHKA 4NZHA 2OT4A 2Q7VA 3EAOA 5KVIA 1JOAA 2XYOA 3P4SA 5EOWA 1FS8A 3RKHA 1DJNA 2VOUA 2C64A 3CGCA 4J36A 2QAEA 5CQFA 4C3YA 2FJBA 2RABA 2BABA 3BNFA 4ZCCA 1EBDA 4JDRA 2JB1A 1GNDA 4UDQA 4OPUA 1GREA 4EIPA 3AECA 3BHFA 1QJDA 1JEHA 1K0JA 1BVBA 4H4XA 2ACZA 2GR3A 2BC1A 3TORA 3QSMA 3WE0A 2R46A 1LVLA 3VRDB 2BA9A 4YTPA 3CPJG 2QCUA 1PBFA 3AE1A 1PBEA 2EQ6A 3DJDA 4U8IA 4DSHA 2C7GA 3SXIA 5U25A 1QO8A 1NAAA 4K8DA 3DGZA 3R9UA 4YSZA 1L9CA 3H8IA 2XVIA 3NN6X 1N1PA 2BK3A 1RSGA 5KVHA 2B76A 4A79A 4EQRA 1FT6A 3F8DA 1M64A 4RG4A 3DJEA 3FG2P 4NTCA 4L3YA 3K30A 3AE7A 3II4A 1CF3A 1GTHA 2B9XA 3K7MX 1VG9A 4B63A 2H88A 1F6MA 3AEBA 2DKIA 3OC4A 2YG6A 4YXDA 2X8HA 3ATRA 3UOXA 4WCTA 5FS7A 4APNA 2BCGG 3GWDA 2YLZA 1LTXR 2GRTA 1DOCA 4CNKA 5FS8A 2JB3A 3SYIA 2VQBA 4LU6A 4C74A 2YG7A 3ALJA 4L3ZA 1S2QA 1FT5A 2GVCA 1GTEA 1ZKQA 1HYUA 4OPLA 2YAUA 3H8LA 2OLNA 2ZZCA 4U8JA 1FEAA 3CTYA 1IUWA 4OPTA 3M0OA 4B69A 4YSXA 4GF7A 5EB5A 3S61A 5J60A 3G5SA 3KU9A 1CJ3A 4YWOA 2R45A 1KNPA 2GAGB 1DJQA 5LV9A 2XCGA 2RGJA 3K7QX 4GUVA 4DNAA 2YLRA 1ZY8A 2AR8A 3ICTA 4O5UA 1Y56B 1TRBA 2YG3A 2OLOA 4CY8A 5ER0A 3LG1A 1VDCA 1PBCA 2GV8A 4IA6A 3RP8A 3NNEA 3AYLA 3QSSA 3NH3X 4Z24A 2IVEA 3SZFA 1GOSA 4DSGA 1SEZA 2VZ2A 3UTEA 1GEUA 2YVGA 3CNDA 2WDQA 4JN9A 2V5ZA 4YKFA 5KNLA 3NIXA 4X9NA 3DMEA 4IVOB 5M10A 4BJZA 1FECA 4H2PA 5TR3A 3UTFA 1JRYA 5KMSA 1F8RA 1DXLA 4J56A 3K7TA 3AWIA 4UDPA 4Z2UA 2YR6A 4J2WA 1Z6LA 2BCPA 1E1LA 3S5WA 2WPEA 4H2QA 5U63A 2BS4A 2ARDA 4EMIA 3NG7X 4Z2TA 2FBWA 4ADWA 5BULA 2EQ8A 4CNJA 3T37A 1M6IA 1OJTA 2V3AA 3GMBA 1NG3A 1PBDA 1GU6A 3GD3A 2O9ZA 2GQFA 2Q0KA 2VVLG 2X99A 3M13A 4U8LA 3SZWA 1CJCA 2UZZA 3VRAA 5JCMA 1FCDA 4E0VA 2YR4A 3DJJA 4G74A 4JNQA 3BNJA 3EF6A 1VRQB 3SM8A 3NKSA 4FK1A 4C77A 1DOEA 4WX1A 2GF3A 5L46A 1FEBA 2JB2A 4K2XA 3G5QA 2GAHB 1EL9A 3NYEA 4PAAA 3NRNA 4Z44A 4EMWA 1L9DA 4U8PA 3UOYA 1ZK7A 4A99A 4AT0A 4A5LA 3D1IA 2Z5XA 2WU2A 5HXIA 1JNIA 3RNMA 2GB0A 3LXDA 1GT8A 1ZMDA 1H7XA 2NPXA 3NHOX 2YVFA 1N4UA 2BXSA 2C66A 2JBVA 2DKHA 3CPIG 4A65A 4CCRA 4J34A 5KXJA 1QDBA 3UTHA 5FS9A 3AXBA 4M52A 4XWRA 1RYIA 2XFNA 3V3NA 3AEDA 3HYXA 2E5VA 4U2SA 1DNCA 1SP3A 1UKVG 1Y56A 2AAQA 3AEEA 1TDFA 3NYCA 1P2HA 4GR1A 3UKQA 3T2ZA 1GRTA 1OJCA 4L38A 3CMMA 3QFBA 4BJYA 2GH5A 1W4XA 3DK9A 3KPKA 1GRAA 5KMRA 1FS9A 2WOWA 2HQMA 2YG4A 5HY5A 1B4VA 5GRTA 2XFOA 1TDOA 1FS7A 3ZDNA 2Y6RA 1V59A 3F8PA 4MJWA 3BI2A 2B9YA 1GERA 4D04A 3ABVA 5EB4A 1M1PA 2WDRA 5U1OA 4BV6A 3F8RA 4ECHA 1PJ6A 1PXCA 3P4PA 2XLUA 3ICSA 3TTBA 3F29A 1NHPA 3IHGA 4K5SA 3SCEA 1S2YA 3GDNA 4YTMA 3UKPA 5KWFA 1B5QA 3SFDA 1OJDA 2YLSA 3FIMB 4K22A 2Y6QA 2R0GA 2CVJA 5BUKA 3IHMA 1GESA 4H50A 3REDA 3CNPA 1BKWA 2XFQA 2YR5A 1B8SA 5C3JA 1YQ4A 3SXQA 2A8XA 1YQ3A 2BS3A 3LZXA 1PJ7A 1BGJA 4BK2A 2C73A 3EANA 1GXFA 4N9XA 3AE6A 3GMCA 4H2RA 3PO7A 4RSLA 2WHDA 3AE5A 4H4YA 3UOZA 2Z5YA 3B3RA 3COXA 4IA5A 1E6EA 2W0HA 4WJYA 1ZDLA 2WOIA 2ZO5A 2A89A 5FS6A 4AP1A 4Q5CA 3B6DA 3NK0X 2XLRA 3T2YA 2JK6A 4H4PA 1E7PA 2BRYA 2B7RA 1Y0PA 2VRMA 4JY2A 1P2EA 2YQUA 1NPXA 3UOVA 3S7WA 3ICRA 4Y4LA 1YY5A 2WEUA 2BRAA 2OALA 2X50A 3AE3A 4FDCB 2EQ9A 1Q1WA 3KA7A 4CBQA 4Q0TA 2WP9A 1REOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMO A;  4B66 A;  5GSN A;  3HZL A;  3C4N A;  1CC2 A;  2VVL A;  5FMH A;  4IV9 A;  2TMD A;  2QA1 A;  1MXT A;  1ZOY A;  3CNS A;  4USQ A;  1H84 A;  3AD8 B;  4BUR A;  3SFE A;  2C65 A;  2F5Z A;  4JQ9 A;  4D03 A;  3AE2 A;  4HB9 A;  4P9S A;  4Z25 A;  5KOX A;  1ONF A;  1PDH A;  1S3B A;  1EL8 A;  3URH A;  1GV4 A;  1JNZ A;  2YLW A;  2GQW A;  3OWM A;  3KD9 A;  3NYF A;  4Y4M A;  5M0Z A;  4OCG A;  4Z2R A;  4YTN A;  1M1Q A;  1OJ9 A;  3C96 A;  1ZOV A;  5HYM A;  2AQJ A;  1NEK A;  2JAE A;  2R4J A;  4EQX A;  4NEV A;  2XLS A;  3AD7 B;  2XVE A;  3AE4 A;  1BWC A;  2GR2 A;  3GM6 A;  1L9E A;  1KFY A;  1TDN A;  4PAB A;  3NTD A;  4U8N A;  3UP5 A;  4DGK A;  2E81 A;  1DOB A;  1CL0 A;  5CKU A;  1E1N A;  3QFA A;  3VR8 A;  2NVK X;  3CIR A;  1LPF A;  3DA1 A;  2YLT A;  3BI5 A;  2OA1 A;  3CPH G;  3NK2 X;  2IVD A;  2C72 A;  4B64 A;  1CJ2 A;  1N4V A;  1ZX9 A;  1NHR A;  2WQY A;  3GD4 A;  3ZYX A;  3DH9 A;  4H4T A;  1O5W A;  2WPC A;  4JY3 A;  2GMH A;  4UP3 A;  3I6D A;  1GRF A;  1KDG A;  1H6V A;  1N4W A;  4ICY A;  4EQS A;  2BXR A;  2WU5 A;  1NHS A;  3BNM A;  4REK A;  2YWL A;  1L0V A;  1FL2 A;  3L8K A;  1TDE A;  1VG0 A;  3NT6 A;  3P4R A;  2B9W A;  3DK8 A;  4H4Z A;  1LQT A;  1Q1R A;  3P1W A;  1D4C A;  1KSU A;  1MO9 A;  4YKG A;  4ZN0 A;  3D8X A;  4C5O A;  3LOV A;  1H81 A;  4J31 A;  5HHF A;  1D7Y A;  2YLX A;  3P9U A;  3AEF A;  4TM0 A;  4USR A;  1NHQ A;  3DGH A;  4AP3 A;  2BK4 A;  1BGN A;  2J7A A;  5JCK A;  3E1T A;  3C4A A;  4Y4N A;  2WP6 A;  2EQ7 A;  1JNR A;  4X4J A;  2BS2 A;  2WES A;  3CNJ A;  2ZBW A;  3LAD A;  3NLC A;  3AB1 A;  4BK3 A;  4GDP A;  4AOS A;  4A6N B;  1XDI A;  1NG4 A;  1D5T A;  3AYJ A;  3RP6 A;  1COY A;  1S3E A;  4H4R A;  3AYI A;  4NTE A;  1JRX A;  2TPR A;  1YQZ A;  2J3N A;  4H7U A;  4UDR A;  5IQ1 A;  3SQP A;  2V6O A;  3EPT A;  3UU9 A;  2FJA A;  2WS3 A;  3UP4 A;  4KX6 A;  4U8K A;  2ZZB A;  4A7A A;  2Q6U A;  3V3O A;  2K3V A;  3RP7 A;  1ZP0 A;  1KF6 A;  2E80 A;  2I0Z A;  5JCN A;  1PXB A;  2C76 A;  3ITJ A;  1M1R A;  4EM4 A;  3GDP A;  4U8M A;  3UKH A;  1TYP A;  4YT0 A;  3CGD A;  4NTD A;  3UKL A;  3UTG A;  2E1M A;  1PJ5 A;  1PBB A;  2WP5 A;  2XVJ A;  2OAM A;  3D1C A;  3Q6J A;  3M12 A;  3BI4 A;  3UKF A;  1GRG A;  1QLB A;  3FMW A;  2XFU A;  3GRT A;  3OZ2 A;  4B65 A;  4YSH A;  4XWZ A;  3DK4 A;  3AE8 A;  2C70 A;  3PVC A;  5IQ4 A;  3GYX A;  1RP0 A;  4AT2 A;  1H7W A;  2ZZ0 A;  1AOG A;  1H82 A;  2BAC A;  3FBS A;  4U8O A;  1PXA A;  2R0C A;  2APG A;  2GR1 A;  2H89 A;  2VVM A;  2WDV A;  4Z26 A;  1CBO A;  3AEA A;  5BRT A;  2YG5 A;  2PHH A;  2R4E A;  2BK5 A;  4CY6 A;  1JRZ A;  1XHC A;  2A87 A;  4ZCD A;  2E4G A;  3CGB A;  2C3C A;  3NN0 X;  4TLX A;  4JNA A;  4B68 A;  3GYJ A;  2VR0 A;  2FJD A;  1KNR A;  2C3D A;  4U2T A;  3BNH A;  1GAL A;  2GR0 A;  3Q9T A;  2RGO A;  4KPR A;  1EL5 A;  3V76 A;  1IUX A;  2V61 A;  3LJP A;  1DOD A;  1X31 B;  3AD9 B;  1FOH A;  1TYT A;  3KLJ A;  4H2N A;  4K5R A;  4K7Z A;  3UCL A;  4CRT A;  2YM1 A;  5JCI A;  3PS9 A;  3BNG A;  1B37 A;  3ADA B;  1JU2 A;  1OAH A;  3O0H A;  4I59 A;  1BF3 A;  1VQW A;  2WET A;  3ALL A;  4TM4 A;  5C2T A;  3CN8 A;  1LJ1 A;  1H83 A;  2IID A;  4HA6 A;  4I58 A;  5KRQ A;  1NEN A;  3AEG A;  4H4U A;  3IF9 A;  2LFC A;  3BNU A;  2V3B A;  3I3L A;  1O95 A;  3AE9 A;  4TLZ A;  4NEW A;  3ISH A;  1GET A;  2VQ7 A;  3DJG X;  4H4Q A;  3P4Q A;  2X3N A;  4A6N A;  1XPQ A;  3NK1 X;  1IJH A;  4H4V A;  2X8G A;  4C3X A;  1CC4 A;  4EIQ A;  3GRS A;  4FX9 A;  2V60 A;  2WPF A;  4LA1 A;  1D4D A;  2BC0 A;  3G5R A;  3LGQ A;  3KPF A;  4OPG A;  5BVA A;  4H4S A;  2CDU A;  4Q1O A;  4GDE A;  1GSN A;  2FJE A;  2XVF A;  4OPI A;  2QA2 A;  3LB8 A;  2YVJ A;  4OPC A;  1CC6 A;  4AOX A;  4A9W A;  4RG3 A;  3KVE A;  3L1R A;  1GRH A;  3SGL A;  1H86 A;  3QJ4 A;  1YKJ A;  3L1T A;  1F3P A;  2RDZ A;  3CGE A;  1D4E A;  3NGC X;  3RHA A;  1IUV A;  2XFP A;  1GRB A;  1F8S A;  3QVP A;  1CHU A;  3FO3 A;  2WBA A;  4YSY A;  4Q4U A;  1MOK A;  3NTA A;  2BYB A;  2B7S A;  1GPE A;  3IWA A;  4LII A;  3ALM A;  1Q9I A;  3FPZ A;  3QSE A;  1PS9 A;  5KOW A;  3VR9 A;  1LQU A;  3H4K A;  5IPY A;  4EMJ A;  1BZL A;  2R0P A;  3UKA A;  1D7L A;  4Q5B A;  3UKK A;  5JCL A;  2GEW A;  1PHH A;  2WOV A;  1K0I A;  1IUS A;  2XVH A;  3GWF A;  4J33 A;  2JKC A;  2XLP A;  3VRB A;  3LZW A;  2PYX A;  1NDA A;  2GMJ A;  2CUL A;  1IUT A;  3KKJ A;  4GCM A;  2C67 A;  3ATQ A;  1LV0 A;  4IVM B;  1EL7 A;  3JSK A;  4EM3 A;  1TDK A;  3QVR A;  4X9M A;  5U25 A;  4H4W A;  3IC9 A;  4O5Q A;  5DBJ A;  1ZMC A;  1E1M A;  5J7X A;  4BK1 A;  4U2L A;  4EQW A;  2C75 A;  3GYI A;  1O94 A;  3GSI A;  4B67 A;  4XXG A;  1K4Q A;  4CCQ A;  4Q17 A;  1E1K A;  4OVI A;  2RF7 A;  3CNT A;  2Q0L A;  2XDO A;  4TM3 A;  1F8W A;  1ELI A;  4FK1 C;  2XLT A;  4B1B A;  4OPD A;  2VRL A;  2X8C A;  3VQR A;  2R9Z A;  1IUU A;  1XAN A;  1E39 A;  1OJA A;  4J57 A;  1KSS A;  1CJ4 A;  5EBK A;  1K0L A;  4Z43 A;  4TM1 A;  2YM2 A;  1PN0 A;  2CFY A;  4GRT A;  4L3X A;  3UBR A;  2RGH A;  3BHK A;  4NZH A;  2OT4 A;  2Q7V A;  3EAO A;  5KVI A;  1JOA A;  2XYO A;  3P4S A;  5EOW A;  1FS8 A;  3RKH A;  1DJN A;  2VOU A;  2C64 A;  3CGC A;  4J36 A;  2QAE A;  5CQF A;  4C3Y A;  2FJB A;  2RAB A;  2BAB A;  3BNF A;  4ZCC A;  1EBD A;  4JDR A;  2JB1 A;  1GND A;  4UDQ A;  4OPU A;  1GRE A;  4EIP A;  3AEC A;  3BHF A;  1QJD A;  1JEH A;  1K0J A;  1BVB A;  4H4X A;  2ACZ A;  2GR3 A;  2BC1 A;  3TOR A;  3QSM A;  3WE0 A;  2R46 A;  1LVL A;  3VRD B;  2BA9 A;  4YTP A;  3CPJ G;  2QCU A;  1PBF A;  3AE1 A;  1PBE A;  2EQ6 A;  3DJD A;  4U8I A;  4DSH A;  2C7G A;  1QO8 A;  1NAA A;  4K8D A;  3DGZ A;  3R9U A;  4YSZ A;  1L9C A;  3H8I A;  2XVI A;  3NN6 X;  1N1P A;  2BK3 A;  1RSG A;  5KVH A;  2B76 A;  4A79 A;  4EQR A;  1FT6 A;  3F8D A;  1M64 A;  4RG4 A;  3DJE A;  3FG2 P;  4NTC A;  4L3Y A;  3K30 A;  3AE7 A;  3II4 A;  1CF3 A;  1GTH A;  2B9X A;  3K7M X;  1VG9 A;  4B63 A;  2H88 A;  1F6M A;  3AEB A;  2DKI A;  3OC4 A;  2YG6 A;  4YXD A;  2X8H A;  3ATR A;  3UOX A;  4WCT A;  5FS7 A;  4APN A;  2BCG G;  3GWD A;  2YLZ A;  1LTX R;  2GRT A;  1DOC A;  4CNK A;  5FS8 A;  2JB3 A;  2VQB A;  4LU6 A;  4C74 A;  2YG7 A;  3ALJ A;  4L3Z A;  1S2Q A;  1FT5 A;  2GVC A;  1GTE A;  1ZKQ A;  1HYU A;  4OPL A;  2YAU A;  3H8L A;  2OLN A;  2ZZC A;  4U8J A;  1FEA A;  3CTY A;  1IUW A;  4OPT A;  3M0O A;  4B69 A;  4YSX A;  4GF7 A;  5EB5 A;  3S61 A;  5J60 A;  3G5S A;  3KU9 A;  1CJ3 A;  4YWO A;  2R45 A;  1KNP A;  2GAG B;  1DJQ A;  5LV9 A;  2XCG A;  2RGJ A;  3K7Q X;  4GUV A;  4DNA A;  2YLR A;  1ZY8 A;  2AR8 A;  3ICT A;  4O5U A;  1Y56 B;  1TRB A;  2YG3 A;  2OLO A;  4CY8 A;  5ER0 A;  3LG1 A;  1VDC A;  1PBC A;  2GV8 A;  4IA6 A;  3RP8 A;  3NNE A;  3AYL A;  3QSS A;  3NH3 X;  4Z24 A;  2IVE A;  1GOS A;  4DSG A;  1SEZ A;  2VZ2 A;  3UTE A;  1GEU A;  2YVG A;  3CND A;  2WDQ A;  4JN9 A;  2V5Z A;  4YKF A;  3NIX A;  4X9N A;  3DME A;  4IVO B;  5M10 A;  4BJZ A;  1FEC A;  4H2P A;  5TR3 A;  3UTF A;  1JRY A;  1F8R A;  1DXL A;  4J56 A;  3K7T A;  3AWI A;  4UDP A;  4Z2U A;  2YR6 A;  4J2W A;  1Z6L A;  2BCP A;  1E1L A;  3S5W A;  2WPE A;  4H2Q A;  5U63 A;  2BS4 A;  2ARD A;  4EMI A;  3NG7 X;  4Z2T A;  2FBW A;  4ADW A;  5BUL A;  2EQ8 A;  4CNJ A;  3T37 A;  1M6I A;  1OJT A;  2V3A A;  3GMB A;  1NG3 A;  1PBD A;  1GU6 A;  3GD3 A;  2O9Z A;  2GQF A;  2Q0K A;  2VVL G;  2X99 A;  3M13 A;  4U8L A;  1CJC A;  2UZZ A;  3VRA A;  5JCM A;  1FCD A;  4E0V A;  2YR4 A;  3DJJ A;  4JNQ A;  3BNJ A;  3EF6 A;  1VRQ B;  3SM8 A;  3NKS A;  4FK1 A;  4C77 A;  1DOE A;  4WX1 A;  2GF3 A;  5L46 A;  1FEB A;  2JB2 A;  4K2X A;  3G5Q A;  2GAH B;  1EL9 A;  3NYE A;  4PAA A;  3NRN A;  4Z44 A;  4EMW A;  1L9D A;  4U8P A;  3UOY A;  1ZK7 A;  4A99 A;  4AT0 A;  4A5L A;  3D1I A;  2Z5X A;  2WU2 A;  5HXI A;  1JNI A;  3RNM A;  2GB0 A;  3LXD A;  1GT8 A;  1ZMD A;  1H7X A;  2NPX A;  3NHO X;  2YVF A;  1N4U A;  2BXS A;  2C66 A;  2JBV A;  2DKH A;  3CPI G;  4A65 A;  4CCR A;  4J34 A;  5KXJ A;  1QDB A;  3UTH A;  5FS9 A;  3AXB A;  4M52 A;  4XWR A;  1RYI A;  2XFN A;  3V3N A;  3AED A;  2E5V A;  4U2S A;  1DNC A;  1SP3 A;  1UKV G;  1Y56 A;  2AAQ A;  3AEE A;  1TDF A;  3NYC A;  1P2H A;  4GR1 A;  3UKQ A;  1GRT A;  1OJC A;  4L38 A;  3QFB A;  4BJY A;  2GH5 A;  1W4X A;  3DK9 A;  1GRA A;  1FS9 A;  2WOW A;  2HQM A;  2YG4 A;  5HY5 A;  1B4V A;  5GRT A;  2XFO A;  1TDO A;  1FS7 A;  3ZDN A;  2Y6R A;  1V59 A;  3F8P A;  4MJW A;  3BI2 A;  2B9Y A;  1GER A;  4D04 A;  3ABV A;  5EB4 A;  1M1P A;  2WDR A;  5U1O A;  4BV6 A;  3F8R A;  4ECH A;  1PJ6 A;  1PXC A;  3P4P A;  2XLU A;  3ICS A;  3TTB A;  3F29 A;  1NHP A;  3IHG A;  4K5S A;  3SCE A;  1S2Y A;  3GDN A;  4YTM A;  3UKP A;  5KWF A;  1B5Q A;  3SFD A;  1OJD A;  2YLS A;  3FIM B;  4K22 A;  2Y6Q A;  2R0G A;  2CVJ A;  5BUK A;  3IHM A;  1GES A;  4H50 A;  3RED A;  3CNP A;  1BKW A;  2XFQ A;  2YR5 A;  1B8S A;  5C3J A;  1YQ4 A;  3SXQ A;  2A8X A;  1YQ3 A;  2BS3 A;  3LZX A;  1PJ7 A;  1BGJ A;  4BK2 A;  2C73 A;  3EAN A;  1GXF A;  4N9X A;  3AE6 A;  3GMC A;  4H2R A;  3PO7 A;  4RSL A;  2WHD A;  3AE5 A;  4H4Y A;  3UOZ A;  2Z5Y A;  3B3R A;  3COX A;  4IA5 A;  1E6E A;  2W0H A;  4WJY A;  1ZDL A;  2WOI A;  2ZO5 A;  2A89 A;  5FS6 A;  4AP1 A;  4Q5C A;  3B6D A;  3NK0 X;  2XLR A;  2JK6 A;  4H4P A;  1E7P A;  2B7R A;  1Y0P A;  2VRM A;  4JY2 A;  1P2E A;  2YQU A;  1NPX A;  3UOV A;  3S7W A;  3ICR A;  4Y4L A;  1YY5 A;  2WEU A;  2OAL A;  2X50 A;  3AE3 A;  4FDC B;  2EQ9 A;  1Q1W A;  3KA7 A;  4CBQ A;  4Q0T A;  2WP9 A;  1REO A; 
#chains in the Genus database with same CATH topology
 3MMO A;  4B66 A;  5GSN A;  3HZL A;  3C4N A;  1CC2 A;  2VVL A;  5FMH A;  4IV9 A;  2TMD A;  2QA1 A;  1MXT A;  1ZOY A;  3CNS A;  4USQ A;  1H84 A;  3AD8 B;  4BUR A;  3SFE A;  2C65 A;  2F5Z A;  4JQ9 A;  4D03 A;  3AE2 A;  4HB9 A;  4P9S A;  4Z25 A;  5KOX A;  3SY4 A;  1ONF A;  1PDH A;  3SX6 A;  1S3B A;  1EL8 A;  3URH A;  1GV4 A;  1JNZ A;  2YLW A;  2GQW A;  3OWM A;  3KD9 A;  3NYF A;  4Y4M A;  5M0Z A;  4OCG A;  4Z2R A;  4G73 A;  4YTN A;  1M1Q A;  1OJ9 A;  3C96 A;  1ZOV A;  5HYM A;  2AQJ A;  1NEK A;  2JAE A;  2R4J A;  4EQX A;  4NEV A;  2XLS A;  3AD7 B;  2XVE A;  3AE4 A;  1BWC A;  2GR2 A;  3GM6 A;  1L9E A;  1KFY A;  1TDN A;  4PAB A;  3NTD A;  4U8N A;  3UP5 A;  4G9K A;  4DGK A;  2E81 A;  1DOB A;  1CL0 A;  5CKU A;  1E1N A;  3QFA A;  3VR8 A;  2NVK X;  3CIR A;  1LPF A;  3DA1 A;  2YLT A;  3BI5 A;  2OA1 A;  3CPH G;  3NK2 X;  2IVD A;  2C72 A;  3T0K A;  1CJ2 A;  1N4V A;  1ZX9 A;  1NHR A;  2WQY A;  3GD4 A;  4B64 A;  3ZYX A;  3DH9 A;  4H4T A;  1O5W A;  2WPC A;  4JY3 A;  2GMH A;  4UP3 A;  3I6D A;  1GRF A;  1KDG A;  1H6V A;  1N4W A;  4ICY A;  4EQS A;  2BXR A;  2WU5 A;  1NHS A;  3BNM A;  4REK A;  2YWL A;  1L0V A;  1FL2 A;  3L8K A;  1TDE A;  1VG0 A;  3NT6 A;  3P4R A;  2B9W A;  3DK8 A;  4H4Z A;  1LQT A;  1Q1R A;  3P1W A;  1D4C A;  1KSU A;  1MO9 A;  3SZC A;  4YKG A;  4ZN0 A;  3D8X A;  4C5O A;  3LOV A;  1H81 A;  4J31 A;  5HHF A;  1D7Y A;  2YLX A;  3P9U A;  3AEF A;  4TM0 A;  4USR A;  1NHQ A;  3DGH A;  4AP3 A;  2BK4 A;  1BGN A;  2J7A A;  5JCK A;  3E1T A;  3C4A A;  4Y4N A;  2WP6 A;  2EQ7 A;  1JNR A;  4X4J A;  2BS2 A;  2WES A;  3CNJ A;  2ZBW A;  3LAD A;  3NLC A;  3AB1 A;  4NWZ A;  4BK3 A;  4GDP A;  4AOS A;  4A6N B;  1XDI A;  1NG4 A;  1D5T A;  3AYJ A;  3RP6 A;  1COY A;  1S3E A;  4H4R A;  3AYI A;  4NTE A;  1JRX A;  2TPR A;  4GAP A;  1YQZ A;  2J3N A;  4H7U A;  4UDR A;  5IQ1 A;  3SQP A;  2V6O A;  3EPT A;  3UU9 A;  2FJA A;  2WS3 A;  3UP4 A;  4KX6 A;  4U8K A;  2ZZB A;  4A7A A;  2Q6U A;  3V3O A;  2K3V A;  3RP7 A;  1ZP0 A;  1KF6 A;  5KMP A;  2E80 A;  2I0Z A;  5JCN A;  1PXB A;  2C76 A;  3ITJ A;  1M1R A;  4EM4 A;  3GDP A;  4U8M A;  3UKH A;  1TYP A;  4YT0 A;  3CGD A;  4NTD A;  3UKL A;  3UTG A;  2E1M A;  1PJ5 A;  4NNJ A;  1PBB A;  2WP5 A;  2XVJ A;  2OAM A;  3D1C A;  3Q6J A;  3M12 A;  3BI4 A;  3UKF A;  1GRG A;  1QLB A;  3FMW A;  2XFU A;  3GRT A;  3OZ2 A;  4B65 A;  4YSH A;  4XWZ A;  3DK4 A;  3AE8 A;  2C70 A;  3GYX A;  3PVC A;  5IQ4 A;  4G6H A;  1RP0 A;  4AT2 A;  1H7W A;  2ZZ0 A;  1AOG A;  1H82 A;  2BAC A;  3FBS A;  4U8O A;  1PXA A;  2R0C A;  2APG A;  2GR1 A;  2H89 A;  2VVM A;  2WDV A;  4Z26 A;  1CBO A;  3AEA A;  5BRT A;  2YG5 A;  2PHH A;  2R4E A;  2BK5 A;  4CY6 A;  1JRZ A;  1XHC A;  2A87 A;  4ZCD A;  4II2 A;  2E4G A;  3CGB A;  2C3C A;  3NN0 X;  4TLX A;  4JNA A;  4B68 A;  3GYJ A;  2VR0 A;  2FJD A;  1KNR A;  2C3D A;  4U2T A;  3BNH A;  1GAL A;  2GR0 A;  3Q9T A;  2RGO A;  4GAV A;  1EL5 A;  4KPR A;  3V76 A;  1IUX A;  2V61 A;  3LJP A;  1DOD A;  1X31 B;  3AD9 B;  1FOH A;  1TYT A;  3KLJ A;  4H2N A;  4K5R A;  4K7Z A;  3T14 A;  3UCL A;  2YM1 A;  4CRT A;  3PS9 A;  3BNG A;  1B37 A;  3ADA B;  1JU2 A;  1OAH A;  3O0H A;  4I59 A;  1BF3 A;  1VQW A;  2WET A;  3ALL A;  4TM4 A;  5C2T A;  3CN8 A;  3HYV A;  1LJ1 A;  1H83 A;  2IID A;  4G6G A;  4HA6 A;  4I58 A;  3SZ0 A;  5KRQ A;  1NEN A;  3AEG A;  4H4U A;  3IF9 A;  2LFC A;  3BNU A;  2V3B A;  3I3L A;  1O95 A;  3AE9 A;  3HYW A;  4TLZ A;  4NEW A;  3ISH A;  1GET A;  2VQ7 A;  3DJG X;  4H4Q A;  3P4Q A;  2X3N A;  4A6N A;  1XPQ A;  3NK1 X;  1IJH A;  4H4V A;  2X8G A;  4C3X A;  1CC4 A;  4EIQ A;  3GRS A;  4FX9 A;  2V60 A;  2WPF A;  4LA1 A;  1D4D A;  2BC0 A;  3G5R A;  3LGQ A;  3KPF A;  4OPG A;  5BVA A;  4H4S A;  2CDU A;  4Q1O A;  4GDE A;  1GSN A;  2FJE A;  2XVF A;  4OPI A;  2QA2 A;  3LB8 A;  2YVJ A;  4OPC A;  3T31 A;  1CC6 A;  4AOX A;  4A9W A;  4RG3 A;  5KMQ A;  3KVE A;  3L1R A;  1GRH A;  3SGL A;  1H86 A;  3QJ4 A;  1YKJ A;  3L1T A;  1F3P A;  2RDZ A;  3CGE A;  1D4E A;  3NGC X;  3RHA A;  1IUV A;  2XFP A;  1GRB A;  4II3 A;  1F8S A;  3QVP A;  1CHU A;  3FO3 A;  2WBA A;  4YSY A;  4Q4U A;  1MOK A;  3NTA A;  2BYB A;  2B7S A;  1GPE A;  3IWA A;  4LII A;  3ALM A;  1Q9I A;  3FPZ A;  3QSE A;  1PS9 A;  5KOW A;  3VR9 A;  1LQU A;  3H4K A;  5IPY A;  4EMJ A;  1BZL A;  2R0P A;  3UKA A;  1D7L A;  4Q5B A;  3UKK A;  5JCL A;  2GEW A;  1PHH A;  2WOV A;  1K0I A;  1IUS A;  2XVH A;  3GWF A;  4J33 A;  2JKC A;  2XLP A;  3VRB A;  3LZW A;  2PYX A;  1NDA A;  2GMJ A;  2CUL A;  1IUT A;  3KKJ A;  4GCM A;  2C67 A;  3ATQ A;  1LV0 A;  4IVM B;  1EL7 A;  3JSK A;  4EM3 A;  1TDK A;  3QVR A;  2C4C A;  4X9M A;  4H4W A;  3IC9 A;  4O5Q A;  5DBJ A;  1ZMC A;  1E1M A;  5J7X A;  4BK1 A;  4U2L A;  4EQW A;  2C75 A;  3GYI A;  1O94 A;  3GSI A;  3T2K A;  4XXG A;  1K4Q A;  4B67 A;  4Q17 A;  4CCQ A;  1E1K A;  5JCI A;  4OVI A;  2RF7 A;  3CNT A;  2Q0L A;  2XDO A;  4TM3 A;  1F8W A;  1ELI A;  4FK1 C;  2XLT A;  4B1B A;  4OPD A;  2VRL A;  2X8C A;  3VQR A;  2R9Z A;  1IUU A;  1XAN A;  1E39 A;  1OJA A;  4J57 A;  1KSS A;  1CJ4 A;  5EBK A;  1K0L A;  4Z43 A;  4TM1 A;  2YM2 A;  1PN0 A;  2CFY A;  4GRT A;  4L3X A;  3UBR A;  2RGH A;  3BHK A;  4NZH A;  2OT4 A;  2Q7V A;  3EAO A;  5KVI A;  1JOA A;  2XYO A;  3P4S A;  5EOW A;  1FS8 A;  3RKH A;  1DJN A;  2VOU A;  2C64 A;  3CGC A;  4J36 A;  2QAE A;  5CQF A;  4C3Y A;  2FJB A;  2RAB A;  2BAB A;  3BNF A;  4ZCC A;  1EBD A;  4JDR A;  2JB1 A;  1GND A;  4UDQ A;  4OPU A;  1GRE A;  4EIP A;  3AEC A;  3BHF A;  1QJD A;  1JEH A;  1K0J A;  1BVB A;  4H4X A;  2ACZ A;  2GR3 A;  2CZS A;  2BC1 A;  3TOR A;  3QSM A;  3WE0 A;  2R46 A;  1LVL A;  3VRD B;  2BA9 A;  4YTP A;  3CPJ G;  2QCU A;  1PBF A;  3AE1 A;  1PBE A;  2EQ6 A;  3DJD A;  4U8I A;  4DSH A;  2C7G A;  3SXI A;  5U25 A;  1QO8 A;  1NAA A;  4K8D A;  3DGZ A;  3R9U A;  4YSZ A;  1L9C A;  3H8I A;  2XVI A;  3NN6 X;  1N1P A;  2BK3 A;  1RSG A;  5KVH A;  2B76 A;  4A79 A;  4EQR A;  1FT6 A;  3F8D A;  1M64 A;  4RG4 A;  3DJE A;  3FG2 P;  4NTC A;  4L3Y A;  3K30 A;  3AE7 A;  3II4 A;  1CF3 A;  1GTH A;  2B9X A;  3K7M X;  1VG9 A;  4B63 A;  2H88 A;  1F6M A;  3AEB A;  2DKI A;  3OC4 A;  2YG6 A;  4YXD A;  2X8H A;  3ATR A;  3UOX A;  4WCT A;  5FS7 A;  4APN A;  2BCG G;  3GWD A;  2YLZ A;  1LTX R;  2GRT A;  1DOC A;  4CNK A;  5FS8 A;  2JB3 A;  3SYI A;  2VQB A;  4LU6 A;  4C74 A;  2YG7 A;  3ALJ A;  4L3Z A;  1S2Q A;  1FT5 A;  2GVC A;  1GTE A;  1ZKQ A;  1HYU A;  4OPL A;  2YAU A;  3H8L A;  2OLN A;  2ZZC A;  4U8J A;  1FEA A;  3CTY A;  1IUW A;  4OPT A;  3M0O A;  4B69 A;  4YSX A;  4GF7 A;  5EB5 A;  3S61 A;  5J60 A;  3G5S A;  3KU9 A;  1CJ3 A;  4YWO A;  2R45 A;  1KNP A;  2GAG B;  1DJQ A;  5LV9 A;  2XCG A;  2RGJ A;  3K7Q X;  4GUV A;  4DNA A;  2YLR A;  1ZY8 A;  2AR8 A;  3ICT A;  4O5U A;  1Y56 B;  1TRB A;  2YG3 A;  2OLO A;  4CY8 A;  5ER0 A;  3LG1 A;  1VDC A;  1PBC A;  2GV8 A;  4IA6 A;  3RP8 A;  3NNE A;  3AYL A;  3QSS A;  3NH3 X;  4Z24 A;  2IVE A;  3SZF A;  1GOS A;  4DSG A;  1SEZ A;  2VZ2 A;  3UTE A;  1GEU A;  2YVG A;  3CND A;  2WDQ A;  4JN9 A;  2V5Z A;  4YKF A;  5KNL A;  3NIX A;  4X9N A;  3DME A;  4IVO B;  5M10 A;  4BJZ A;  1FEC A;  4H2P A;  5TR3 A;  3UTF A;  1JRY A;  5KMS A;  1F8R A;  1DXL A;  4J56 A;  3K7T A;  3AWI A;  4UDP A;  4Z2U A;  2YR6 A;  4J2W A;  1Z6L A;  2BCP A;  1E1L A;  3S5W A;  2WPE A;  4H2Q A;  5U63 A;  2BS4 A;  2ARD A;  4EMI A;  3NG7 X;  4Z2T A;  2FBW A;  4ADW A;  5BUL A;  2EQ8 A;  4CNJ A;  3T37 A;  1M6I A;  1OJT A;  2V3A A;  3GMB A;  1NG3 A;  1PBD A;  1GU6 A;  3GD3 A;  2O9Z A;  2GQF A;  2Q0K A;  2VVL G;  2X99 A;  3M13 A;  4U8L A;  3SZW A;  1CJC A;  2UZZ A;  3VRA A;  5JCM A;  1FCD A;  4E0V A;  2YR4 A;  3DJJ A;  4G74 A;  4JNQ A;  3BNJ A;  3EF6 A;  1VRQ B;  3SM8 A;  3NKS A;  4FK1 A;  4C77 A;  1DOE A;  4WX1 A;  2GF3 A;  5L46 A;  1FEB A;  2JB2 A;  4K2X A;  3G5Q A;  2GAH B;  1EL9 A;  3NYE A;  4PAA A;  3NRN A;  4Z44 A;  4EMW A;  1L9D A;  4U8P A;  3UOY A;  1ZK7 A;  4A99 A;  4AT0 A;  4A5L A;  3D1I A;  2Z5X A;  2WU2 A;  5HXI A;  1JNI A;  3RNM A;  2GB0 A;  3LXD A;  1GT8 A;  1ZMD A;  1H7X A;  2NPX A;  3NHO X;  2YVF A;  1N4U A;  2BXS A;  2C66 A;  2JBV A;  2DKH A;  3CPI G;  4A65 A;  4CCR A;  4J34 A;  5KXJ A;  1QDB A;  3UTH A;  5FS9 A;  3AXB A;  4M52 A;  4XWR A;  1RYI A;  2XFN A;  3V3N A;  3AED A;  3HYX A;  2E5V A;  4U2S A;  1DNC A;  1SP3 A;  1UKV G;  1Y56 A;  2AAQ A;  3AEE A;  1TDF A;  3NYC A;  1P2H A;  4GR1 A;  3UKQ A;  3T2Z A;  1GRT A;  1OJC A;  4L38 A;  3CMM A;  3QFB A;  4BJY A;  2GH5 A;  1W4X A;  3DK9 A;  3KPK A;  1GRA A;  5KMR A;  1FS9 A;  2WOW A;  2HQM A;  2YG4 A;  5HY5 A;  1B4V A;  5GRT A;  2XFO A;  1TDO A;  1FS7 A;  3ZDN A;  2Y6R A;  1V59 A;  3F8P A;  4MJW A;  3BI2 A;  2B9Y A;  1GER A;  4D04 A;  3ABV A;  5EB4 A;  1M1P A;  2WDR A;  5U1O A;  4BV6 A;  3F8R A;  4ECH A;  1PJ6 A;  1PXC A;  3P4P A;  2XLU A;  3ICS A;  3TTB A;  3F29 A;  1NHP A;  3IHG A;  4K5S A;  3SCE A;  1S2Y A;  3GDN A;  4YTM A;  3UKP A;  5KWF A;  1B5Q A;  3SFD A;  1OJD A;  2YLS A;  3FIM B;  4K22 A;  2Y6Q A;  2R0G A;  2CVJ A;  5BUK A;  3IHM A;  1GES A;  4H50 A;  3RED A;  3CNP A;  1BKW A;  2XFQ A;  2YR5 A;  1B8S A;  5C3J A;  1YQ4 A;  3SXQ A;  2A8X A;  1YQ3 A;  2BS3 A;  3LZX A;  1PJ7 A;  1BGJ A;  4BK2 A;  2C73 A;  3EAN A;  1GXF A;  4N9X A;  3AE6 A;  3GMC A;  4H2R A;  3PO7 A;  4RSL A;  2WHD A;  3AE5 A;  4H4Y A;  3UOZ A;  2Z5Y A;  3B3R A;  3COX A;  4IA5 A;  1E6E A;  2W0H A;  4WJY A;  1ZDL A;  2WOI A;  2ZO5 A;  2A89 A;  5FS6 A;  4AP1 A;  4Q5C A;  3B6D A;  3NK0 X;  2XLR A;  3T2Y A;  2JK6 A;  4H4P A;  1E7P A;  2BRY A;  2B7R A;  1Y0P A;  2VRM A;  4JY2 A;  1P2E A;  2YQU A;  1NPX A;  3UOV A;  3S7W A;  3ICR A;  4Y4L A;  1YY5 A;  2WEU A;  2BRA A;  2OAL A;  2X50 A;  3AE3 A;  4FDC B;  2EQ9 A;  1Q1W A;  3KA7 A;  4CBQ A;  4Q0T A;  2WP9 A;  1REO A; 
#chains in the Genus database with same CATH homology
 3MMO A;  4B66 A;  5GSN A;  3HZL A;  3C4N A;  1CC2 A;  2VVL A;  5FMH A;  4IV9 A;  2TMD A;  2QA1 A;  1MXT A;  1ZOY A;  3CNS A;  4USQ A;  1H84 A;  3AD8 B;  4BUR A;  3SFE A;  2C65 A;  2F5Z A;  4JQ9 A;  4D03 A;  3AE2 A;  4HB9 A;  4P9S A;  4Z25 A;  5KOX A;  3SY4 A;  1ONF A;  1PDH A;  3SX6 A;  1S3B A;  1EL8 A;  3URH A;  1GV4 A;  1JNZ A;  2YLW A;  2GQW A;  3OWM A;  3KD9 A;  3NYF A;  4Y4M A;  5M0Z A;  4OCG A;  4Z2R A;  4G73 A;  4YTN A;  1M1Q A;  1OJ9 A;  3C96 A;  1ZOV A;  5HYM A;  2AQJ A;  1NEK A;  2JAE A;  2R4J A;  4EQX A;  4NEV A;  2XLS A;  3AD7 B;  2XVE A;  3AE4 A;  1BWC A;  2GR2 A;  3GM6 A;  1L9E A;  1KFY A;  1TDN A;  4PAB A;  3NTD A;  4U8N A;  3UP5 A;  4G9K A;  4DGK A;  2E81 A;  1DOB A;  1CL0 A;  5CKU A;  1E1N A;  3QFA A;  3VR8 A;  2NVK X;  3CIR A;  1LPF A;  3DA1 A;  2YLT A;  3BI5 A;  2OA1 A;  3CPH G;  3NK2 X;  2IVD A;  2C72 A;  3T0K A;  1CJ2 A;  1N4V A;  1ZX9 A;  1NHR A;  2WQY A;  3GD4 A;  4B64 A;  3ZYX A;  3DH9 A;  4H4T A;  1O5W A;  2WPC A;  4JY3 A;  2GMH A;  4UP3 A;  3I6D A;  1GRF A;  1KDG A;  1H6V A;  1N4W A;  4ICY A;  4EQS A;  2BXR A;  2WU5 A;  1NHS A;  3BNM A;  4REK A;  2YWL A;  1L0V A;  1FL2 A;  3L8K A;  1TDE A;  1VG0 A;  3NT6 A;  3P4R A;  2B9W A;  3DK8 A;  4H4Z A;  1LQT A;  1Q1R A;  3P1W A;  1D4C A;  1KSU A;  1MO9 A;  3SZC A;  4YKG A;  4ZN0 A;  3D8X A;  4C5O A;  3LOV A;  1H81 A;  4J31 A;  5HHF A;  1D7Y A;  2YLX A;  3P9U A;  3AEF A;  4TM0 A;  4USR A;  1NHQ A;  3DGH A;  4AP3 A;  2BK4 A;  1BGN A;  2J7A A;  5JCK A;  3E1T A;  3C4A A;  4Y4N A;  2WP6 A;  2EQ7 A;  1JNR A;  4X4J A;  2BS2 A;  2WES A;  3CNJ A;  2ZBW A;  3LAD A;  3NLC A;  3AB1 A;  4NWZ A;  4BK3 A;  4GDP A;  4AOS A;  4A6N B;  1XDI A;  1NG4 A;  1D5T A;  3AYJ A;  3RP6 A;  1COY A;  1S3E A;  4H4R A;  3AYI A;  4NTE A;  1JRX A;  2TPR A;  4GAP A;  1YQZ A;  2J3N A;  4H7U A;  4UDR A;  5IQ1 A;  3SQP A;  2V6O A;  3EPT A;  3UU9 A;  2FJA A;  2WS3 A;  3UP4 A;  4KX6 A;  4U8K A;  2ZZB A;  4A7A A;  2Q6U A;  3V3O A;  2K3V A;  3RP7 A;  1ZP0 A;  1KF6 A;  5KMP A;  2E80 A;  2I0Z A;  5JCN A;  1PXB A;  2C76 A;  3ITJ A;  1M1R A;  4EM4 A;  3GDP A;  4U8M A;  3UKH A;  1TYP A;  4YT0 A;  3CGD A;  4NTD A;  3UKL A;  3UTG A;  2E1M A;  1PJ5 A;  4NNJ A;  1PBB A;  2WP5 A;  2XVJ A;  2OAM A;  3D1C A;  3Q6J A;  3M12 A;  3BI4 A;  3UKF A;  1GRG A;  1QLB A;  3FMW A;  2XFU A;  3GRT A;  3OZ2 A;  4B65 A;  4YSH A;  4XWZ A;  3DK4 A;  3AE8 A;  2C70 A;  3GYX A;  3PVC A;  5IQ4 A;  4G6H A;  1RP0 A;  4AT2 A;  1H7W A;  2ZZ0 A;  1AOG A;  1H82 A;  2BAC A;  3FBS A;  4U8O A;  1PXA A;  2R0C A;  2APG A;  2GR1 A;  2H89 A;  2VVM A;  2WDV A;  4Z26 A;  1CBO A;  3AEA A;  5BRT A;  2YG5 A;  2PHH A;  2R4E A;  2BK5 A;  4CY6 A;  1JRZ A;  1XHC A;  2A87 A;  4ZCD A;  4II2 A;  2E4G A;  3CGB A;  2C3C A;  3NN0 X;  4TLX A;  4JNA A;  4B68 A;  3GYJ A;  2VR0 A;  2FJD A;  1KNR A;  2C3D A;  4U2T A;  3BNH A;  1GAL A;  2GR0 A;  3Q9T A;  2RGO A;  4GAV A;  1EL5 A;  4KPR A;  3V76 A;  1IUX A;  2V61 A;  3LJP A;  1DOD A;  1X31 B;  3AD9 B;  1FOH A;  1TYT A;  3KLJ A;  4H2N A;  4K5R A;  4K7Z A;  3T14 A;  3UCL A;  2YM1 A;  4CRT A;  3PS9 A;  3BNG A;  1B37 A;  3ADA B;  1JU2 A;  1OAH A;  3O0H A;  4I59 A;  1BF3 A;  1VQW A;  2WET A;  3ALL A;  4TM4 A;  5C2T A;  3CN8 A;  3HYV A;  1LJ1 A;  1H83 A;  2IID A;  4G6G A;  4HA6 A;  4I58 A;  3SZ0 A;  5KRQ A;  1NEN A;  3AEG A;  4H4U A;  3IF9 A;  2LFC A;  3BNU A;  2V3B A;  3I3L A;  1O95 A;  3AE9 A;  3HYW A;  4TLZ A;  4NEW A;  3ISH A;  1GET A;  2VQ7 A;  3DJG X;  4H4Q A;  3P4Q A;  2X3N A;  4A6N A;  1XPQ A;  3NK1 X;  1IJH A;  4H4V A;  2X8G A;  4C3X A;  1CC4 A;  4EIQ A;  3GRS A;  4FX9 A;  2V60 A;  2WPF A;  4LA1 A;  1D4D A;  2BC0 A;  3G5R A;  3LGQ A;  3KPF A;  4OPG A;  5BVA A;  4H4S A;  2CDU A;  4Q1O A;  4GDE A;  1GSN A;  2FJE A;  2XVF A;  4OPI A;  2QA2 A;  3LB8 A;  2YVJ A;  4OPC A;  3T31 A;  1CC6 A;  4AOX A;  4A9W A;  4RG3 A;  5KMQ A;  3KVE A;  3L1R A;  1GRH A;  3SGL A;  1H86 A;  3QJ4 A;  1YKJ A;  3L1T A;  1F3P A;  2RDZ A;  3CGE A;  1D4E A;  3NGC X;  3RHA A;  1IUV A;  2XFP A;  1GRB A;  4II3 A;  1F8S A;  3QVP A;  1CHU A;  3FO3 A;  2WBA A;  4YSY A;  4Q4U A;  1MOK A;  3NTA A;  2BYB A;  2B7S A;  1GPE A;  3IWA A;  4LII A;  3ALM A;  1Q9I A;  3FPZ A;  3QSE A;  1PS9 A;  5KOW A;  3VR9 A;  1LQU A;  3H4K A;  5IPY A;  4EMJ A;  1BZL A;  2R0P A;  3UKA A;  1D7L A;  4Q5B A;  3UKK A;  5JCL A;  2GEW A;  1PHH A;  2WOV A;  1K0I A;  1IUS A;  2XVH A;  3GWF A;  4J33 A;  2JKC A;  2XLP A;  3VRB A;  3LZW A;  2PYX A;  1NDA A;  2GMJ A;  2CUL A;  1IUT A;  3KKJ A;  4GCM A;  2C67 A;  3ATQ A;  1LV0 A;  4IVM B;  1EL7 A;  3JSK A;  4EM3 A;  1TDK A;  3QVR A;  2C4C A;  4X9M A;  4H4W A;  3IC9 A;  4O5Q A;  5DBJ A;  1ZMC A;  1E1M A;  5J7X A;  4BK1 A;  4U2L A;  4EQW A;  2C75 A;  3GYI A;  1O94 A;  3GSI A;  3T2K A;  4XXG A;  1K4Q A;  4B67 A;  4Q17 A;  4CCQ A;  1E1K A;  5JCI A;  4OVI A;  2RF7 A;  3CNT A;  2Q0L A;  2XDO A;  4TM3 A;  1F8W A;  1ELI A;  4FK1 C;  2XLT A;  4B1B A;  4OPD A;  2VRL A;  2X8C A;  3VQR A;  2R9Z A;  1IUU A;  1XAN A;  1E39 A;  1OJA A;  4J57 A;  1KSS A;  1CJ4 A;  5EBK A;  1K0L A;  4Z43 A;  4TM1 A;  2YM2 A;  1PN0 A;  2CFY A;  4GRT A;  4L3X A;  3UBR A;  2RGH A;  3BHK A;  4NZH A;  2OT4 A;  2Q7V A;  3EAO A;  5KVI A;  1JOA A;  2XYO A;  3P4S A;  5EOW A;  1FS8 A;  3RKH A;  1DJN A;  2VOU A;  2C64 A;  3CGC A;  4J36 A;  2QAE A;  5CQF A;  4C3Y A;  2FJB A;  2RAB A;  2BAB A;  3BNF A;  4ZCC A;  1EBD A;  4JDR A;  2JB1 A;  1GND A;  4UDQ A;  4OPU A;  1GRE A;  4EIP A;  3AEC A;  3BHF A;  1QJD A;  1JEH A;  1K0J A;  1BVB A;  4H4X A;  2ACZ A;  2GR3 A;  2BC1 A;  3TOR A;  3QSM A;  3WE0 A;  2R46 A;  1LVL A;  3VRD B;  2BA9 A;  4YTP A;  3CPJ G;  2QCU A;  1PBF A;  3AE1 A;  1PBE A;  2EQ6 A;  3DJD A;  4U8I A;  4DSH A;  2C7G A;  3SXI A;  5U25 A;  1QO8 A;  1NAA A;  4K8D A;  3DGZ A;  3R9U A;  4YSZ A;  1L9C A;  3H8I A;  2XVI A;  3NN6 X;  1N1P A;  2BK3 A;  1RSG A;  5KVH A;  2B76 A;  4A79 A;  4EQR A;  1FT6 A;  3F8D A;  1M64 A;  4RG4 A;  3DJE A;  3FG2 P;  4NTC A;  4L3Y A;  3K30 A;  3AE7 A;  3II4 A;  1CF3 A;  1GTH A;  2B9X A;  3K7M X;  1VG9 A;  4B63 A;  2H88 A;  1F6M A;  3AEB A;  2DKI A;  3OC4 A;  2YG6 A;  4YXD A;  2X8H A;  3ATR A;  3UOX A;  4WCT A;  5FS7 A;  4APN A;  2BCG G;  3GWD A;  2YLZ A;  1LTX R;  2GRT A;  1DOC A;  4CNK A;  5FS8 A;  2JB3 A;  3SYI A;  2VQB A;  4LU6 A;  4C74 A;  2YG7 A;  3ALJ A;  4L3Z A;  1S2Q A;  1FT5 A;  2GVC A;  1GTE A;  1ZKQ A;  1HYU A;  4OPL A;  2YAU A;  3H8L A;  2OLN A;  2ZZC A;  4U8J A;  1FEA A;  3CTY A;  1IUW A;  4OPT A;  3M0O A;  4B69 A;  4YSX A;  4GF7 A;  5EB5 A;  3S61 A;  5J60 A;  3G5S A;  3KU9 A;  1CJ3 A;  4YWO A;  2R45 A;  1KNP A;  2GAG B;  1DJQ A;  5LV9 A;  2XCG A;  2RGJ A;  3K7Q X;  4GUV A;  4DNA A;  2YLR A;  1ZY8 A;  2AR8 A;  3ICT A;  4O5U A;  1Y56 B;  1TRB A;  2YG3 A;  2OLO A;  4CY8 A;  5ER0 A;  3LG1 A;  1VDC A;  1PBC A;  2GV8 A;  4IA6 A;  3RP8 A;  3NNE A;  3AYL A;  3QSS A;  3NH3 X;  4Z24 A;  2IVE A;  3SZF A;  1GOS A;  4DSG A;  1SEZ A;  2VZ2 A;  3UTE A;  1GEU A;  2YVG A;  3CND A;  2WDQ A;  4JN9 A;  2V5Z A;  4YKF A;  5KNL A;  3NIX A;  4X9N A;  3DME A;  4IVO B;  5M10 A;  4BJZ A;  1FEC A;  4H2P A;  5TR3 A;  3UTF A;  1JRY A;  5KMS A;  1F8R A;  1DXL A;  4J56 A;  3K7T A;  3AWI A;  4UDP A;  4Z2U A;  2YR6 A;  4J2W A;  1Z6L A;  2BCP A;  1E1L A;  3S5W A;  2WPE A;  4H2Q A;  5U63 A;  2BS4 A;  2ARD A;  4EMI A;  3NG7 X;  4Z2T A;  2FBW A;  4ADW A;  5BUL A;  2EQ8 A;  4CNJ A;  3T37 A;  1M6I A;  1OJT A;  2V3A A;  3GMB A;  1NG3 A;  1PBD A;  1GU6 A;  3GD3 A;  2O9Z A;  2GQF A;  2Q0K A;  2VVL G;  2X99 A;  3M13 A;  4U8L A;  3SZW A;  1CJC A;  2UZZ A;  3VRA A;  5JCM A;  1FCD A;  4E0V A;  2YR4 A;  3DJJ A;  4G74 A;  4JNQ A;  3BNJ A;  3EF6 A;  1VRQ B;  3SM8 A;  3NKS A;  4FK1 A;  4C77 A;  1DOE A;  4WX1 A;  2GF3 A;  5L46 A;  1FEB A;  2JB2 A;  4K2X A;  3G5Q A;  2GAH B;  1EL9 A;  3NYE A;  4PAA A;  3NRN A;  4Z44 A;  4EMW A;  1L9D A;  4U8P A;  3UOY A;  1ZK7 A;  4A99 A;  4AT0 A;  4A5L A;  3D1I A;  2Z5X A;  2WU2 A;  5HXI A;  1JNI A;  3RNM A;  2GB0 A;  3LXD A;  1GT8 A;  1ZMD A;  1H7X A;  2NPX A;  3NHO X;  2YVF A;  1N4U A;  2BXS A;  2C66 A;  2JBV A;  2DKH A;  3CPI G;  4A65 A;  4CCR A;  4J34 A;  5KXJ A;  1QDB A;  3UTH A;  5FS9 A;  3AXB A;  4M52 A;  4XWR A;  1RYI A;  2XFN A;  3V3N A;  3AED A;  3HYX A;  2E5V A;  4U2S A;  1DNC A;  1SP3 A;  1UKV G;  1Y56 A;  2AAQ A;  3AEE A;  1TDF A;  3NYC A;  1P2H A;  4GR1 A;  3UKQ A;  3T2Z A;  1GRT A;  1OJC A;  4L38 A;  3CMM A;  3QFB A;  4BJY A;  2GH5 A;  1W4X A;  3DK9 A;  3KPK A;  1GRA A;  5KMR A;  1FS9 A;  2WOW A;  2HQM A;  2YG4 A;  5HY5 A;  1B4V A;  5GRT A;  2XFO A;  1TDO A;  1FS7 A;  3ZDN A;  2Y6R A;  1V59 A;  3F8P A;  4MJW A;  3BI2 A;  2B9Y A;  1GER A;  4D04 A;  3ABV A;  5EB4 A;  1M1P A;  2WDR A;  5U1O A;  4BV6 A;  3F8R A;  4ECH A;  1PJ6 A;  1PXC A;  3P4P A;  2XLU A;  3ICS A;  3TTB A;  3F29 A;  1NHP A;  3IHG A;  4K5S A;  3SCE A;  1S2Y A;  3GDN A;  4YTM A;  3UKP A;  5KWF A;  1B5Q A;  3SFD A;  1OJD A;  2YLS A;  3FIM B;  4K22 A;  2Y6Q A;  2R0G A;  2CVJ A;  5BUK A;  3IHM A;  1GES A;  4H50 A;  3RED A;  3CNP A;  1BKW A;  2XFQ A;  2YR5 A;  1B8S A;  5C3J A;  1YQ4 A;  3SXQ A;  2A8X A;  1YQ3 A;  2BS3 A;  3LZX A;  1PJ7 A;  1BGJ A;  4BK2 A;  2C73 A;  3EAN A;  1GXF A;  4N9X A;  3AE6 A;  3GMC A;  4H2R A;  3PO7 A;  4RSL A;  2WHD A;  3AE5 A;  4H4Y A;  3UOZ A;  2Z5Y A;  3B3R A;  3COX A;  4IA5 A;  1E6E A;  2W0H A;  4WJY A;  1ZDL A;  2WOI A;  2ZO5 A;  2A89 A;  5FS6 A;  4AP1 A;  4Q5C A;  3B6D A;  3NK0 X;  2XLR A;  3T2Y A;  2JK6 A;  4H4P A;  1E7P A;  2BRY A;  2B7R A;  1Y0P A;  2VRM A;  4JY2 A;  1P2E A;  2YQU A;  1NPX A;  3UOV A;  3S7W A;  3ICR A;  4Y4L A;  1YY5 A;  2WEU A;  2BRA A;  2OAL A;  2X50 A;  3AE3 A;  4FDC B;  2EQ9 A;  1Q1W A;  3KA7 A;  4CBQ A;  4Q0T A;  2WP9 A;  1REO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...