1FT6A

Reduced state of cytochrome c554 from nitrosomonas europaea
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
208
structure length
208
Chain Sequence
ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C554
publication title High-resolution structures of the oxidized and reduced states of cytochrome c554 from Nitrosomonas europaea.
pubmed doi rcsb
molecule tags Electron transport
total genus 53
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13435 Cytochrome_C554 Cytochrome c554 and c-prime
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1ft6A00
1M1QA 3TORA 1Q9IA 3SXQA 2OT4A 1JNIA 1SP3A 3GM6A 4Q5CA 3BNJA 4L3YA 3F29A 2B7RA 4Q1OA 1P2HA 3LGQA 2E80A 2E81A 1GU6A 1FT6A 1QO8A 3UU9A 4Q17A 2K3VA 1JRYA 1M1PA 3BNGA 4L3XA 3OWMA 4L3ZA 1BVBA 1JRZA 1FS7A 1QDBA 1QJDA 3UBRA 2ZO5A 3TTBA 1P2EA 2RDZA 3RKHA 3SCEA 2RF7A 1M64A 3MMOA 2VR0A 3L1TA 4Q4UA 1KSUA 1LJ1A 1Y0PA 2B7SA 1OAHA 4Q0TA 1D4DA 4Q5BA 4WJYA 1FT5A 1FS8A 3FO3A 2J7AA 3BNFA 3BNHA 1FS9A 4L38A 1D4CA 1D4EA 1JRXA 3LG1A 3D1IA 3S7WA 1E39A 1KSSA 1M1RA
chains in the Genus database with same CATH superfamily
1M1QA 3TORA 1Q9IA 3SXQA 2OT4A 1JNIA 1SP3A 3GM6A 4Q5CA 3BNJA 4L3YA 3F29A 2B7RA 2CZSA 4Q1OA 1P2HA 3LGQA 2E80A 2E81A 1GU6A 1FT6A 1QO8A 3UU9A 4Q17A 2K3VA 1JRYA 1M1PA 3BNGA 4L3XA 3OWMA 4L3ZA 1BVBA 1JRZA 1FS7A 1QDBA 1QJDA 3UBRA 2ZO5A 3TTBA 1P2EA 2RDZA 3RKHA 3SCEA 2RF7A 1M64A 3MMOA 2VR0A 3L1TA 4Q4UA 1KSUA 1LJ1A 1Y0PA 2B7SA 1OAHA 4Q0TA 1D4DA 4Q5BA 4WJYA 1FT5A 1FS8A 3FO3A 2J7AA 3BNFA 3BNHA 1FS9A 4L38A 1D4CA 1D4EA 1JRXA 3LG1A 3D1IA 3S7WA 1E39A 1KSSA 1M1RA
chains in the Genus database with same CATH topology
1M1QA 3TORA 1Q9IA 3SXQA 2OT4A 1JNIA 1SP3A 3GM6A 4Q5CA 3BNJA 4L3YA 3F29A 2B7RA 4Q1OA 1P2HA 3LGQA 2E80A 2E81A 1GU6A 1FT6A 1QO8A 3UU9A 4Q17A 2K3VA 1JRYA 1M1PA 3BNGA 4L3XA 3OWMA 4L3ZA 1BVBA 1JRZA 1FS7A 1QDBA 1QJDA 3UBRA 2ZO5A 3TTBA 1P2EA 2RDZA 3RKHA 3SCEA 2RF7A 1M64A 3MMOA 2VR0A 3L1TA 4Q4UA 1KSUA 1LJ1A 1Y0PA 2B7SA 1OAHA 4Q0TA 1D4DA 4Q5BA 4WJYA 1FT5A 1FS8A 3FO3A 2J7AA 3BNFA 3BNHA 1FS9A 4L38A 1D4CA 1D4EA 1JRXA 3LG1A 3D1IA 3S7WA 1E39A 1KSSA 1M1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1Q A;  3TOR A;  1Q9I A;  3SXQ A;  2OT4 A;  1JNI A;  1SP3 A;  3GM6 A;  4Q5C A;  3BNJ A;  4L3Y A;  3F29 A;  2B7R A;  4Q1O A;  1P2H A;  3LGQ A;  2E80 A;  2E81 A;  1GU6 A;  1FT6 A;  1QO8 A;  3UU9 A;  4Q17 A;  2K3V A;  1JRY A;  1M1P A;  3BNG A;  4L3X A;  3OWM A;  4L3Z A;  1BVB A;  1JRZ A;  1FS7 A;  1QDB A;  1QJD A;  3UBR A;  2ZO5 A;  3TTB A;  1P2E A;  2RDZ A;  3RKH A;  3SCE A;  2RF7 A;  1M64 A;  3MMO A;  2VR0 A;  3L1T A;  4Q4U A;  1KSU A;  1LJ1 A;  1Y0P A;  2B7S A;  1OAH A;  4Q0T A;  1D4D A;  4Q5B A;  4WJY A;  1FT5 A;  1FS8 A;  3FO3 A;  2J7A A;  3BNF A;  3BNH A;  1FS9 A;  4L38 A;  1D4C A;  1D4E A;  1JRX A;  3LG1 A;  3D1I A;  3S7W A;  1E39 A;  1KSS A;  1M1R A; 
#chains in the Genus database with same CATH topology
 1M1Q A;  3TOR A;  1Q9I A;  3SXQ A;  2OT4 A;  1JNI A;  1SP3 A;  3GM6 A;  4Q5C A;  3BNJ A;  4L3Y A;  3F29 A;  2B7R A;  2CZS A;  4Q1O A;  1P2H A;  3LGQ A;  2E80 A;  2E81 A;  1GU6 A;  1FT6 A;  1QO8 A;  3UU9 A;  4Q17 A;  2K3V A;  1JRY A;  1M1P A;  3BNG A;  4L3X A;  3OWM A;  4L3Z A;  1BVB A;  1JRZ A;  1FS7 A;  1QDB A;  1QJD A;  3UBR A;  2ZO5 A;  3TTB A;  1P2E A;  2RDZ A;  3RKH A;  3SCE A;  2RF7 A;  1M64 A;  3MMO A;  2VR0 A;  3L1T A;  4Q4U A;  1KSU A;  1LJ1 A;  1Y0P A;  2B7S A;  1OAH A;  4Q0T A;  1D4D A;  4Q5B A;  4WJY A;  1FT5 A;  1FS8 A;  3FO3 A;  2J7A A;  3BNF A;  3BNH A;  1FS9 A;  4L38 A;  1D4C A;  1D4E A;  1JRX A;  3LG1 A;  3D1I A;  3S7W A;  1E39 A;  1KSS A;  1M1R A; 
#chains in the Genus database with same CATH homology
 1M1Q A;  3TOR A;  1Q9I A;  3SXQ A;  2OT4 A;  1JNI A;  1SP3 A;  3GM6 A;  4Q5C A;  3BNJ A;  4L3Y A;  3F29 A;  2B7R A;  4Q1O A;  1P2H A;  3LGQ A;  2E80 A;  2E81 A;  1GU6 A;  1FT6 A;  1QO8 A;  3UU9 A;  4Q17 A;  2K3V A;  1JRY A;  1M1P A;  3BNG A;  4L3X A;  3OWM A;  4L3Z A;  1BVB A;  1JRZ A;  1FS7 A;  1QDB A;  1QJD A;  3UBR A;  2ZO5 A;  3TTB A;  1P2E A;  2RDZ A;  3RKH A;  3SCE A;  2RF7 A;  1M64 A;  3MMO A;  2VR0 A;  3L1T A;  4Q4U A;  1KSU A;  1LJ1 A;  1Y0P A;  2B7S A;  1OAH A;  4Q0T A;  1D4D A;  4Q5B A;  4WJY A;  1FT5 A;  1FS8 A;  3FO3 A;  2J7A A;  3BNF A;  3BNH A;  1FS9 A;  4L38 A;  1D4C A;  1D4E A;  1JRX A;  3LG1 A;  3D1I A;  3S7W A;  1E39 A;  1KSS A;  1M1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...