1JRZA

Crystal structure of arg402tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTYDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C
publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 194
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrzA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrzA01
4RSLA 1NG4A 2X50A 2RGJA 4X9NA 1LQTA 3VQRA 2LFCA 4I58A 1JOAA 4Z2TA 1FEAA 3DH9A 1PHHA 2CDUA 1DOBA 3OWMA 2BC0A 1GTEA 2XFNA 2R0GA 4U2SA 3SFEA 4Q0TA 3TORA 2GAHB 4YKFA 1ZMDA 4BK2A 1SEZA 4H4ZA 4Z25A 2YG3A 4U8MA 1ELIA 1XPQA 2Q7VA 3LB8A 2GAGB 4FK1A 3AE3A 3K7QX 4YWOA 2XLTA 3BNUA 4IVMB 3GDNA 4Y4NA 1FEBA 3UKLA 4J57A 4B68A 3GDPA 4U8LA 4YTMA 1LJ1A 5BULA 2WP6A 2WPEA 3CGBA 4H2QA 3AE5A 1LV0A 1TRBA 3CNSA 4Z24A 1GSNA 3FPZA 4EMJA 5IPYA 1ZP0A 2BS2A 3EPTA 3DGHA 2YLSA 1GRFA 1S3EA 1NDAA 3AYIA 5FS6A 1MXTA 2AQJA 1ZX9A 2E80A 1CJ2A 1PXAA 3BI5A 3D1CA 2QAEA 4U8IA 3S5WA 4Q1OA 3UP5A 2XCGA 4BK3A 4CBQA 2E4GA 3SGLA 4TLZA 5EB4A 1VQWA 4XWZA 3AEBA 2YLRA 1D4DA 1V59A 2C70A 2GQFA 3AE2A 1D7YA 4A6NA 3UBRA 2GR1A 3DK9A 4H4PA 2XVEA 3BI2A 4REKA 2C7GA 3P1WA 2WU2A 3AEFA 1BGJA 3GRTA 2OA1A 4NTEA 2OLNA 3RKHA 3NGCX 2XVJA 3CPIG 1TYPA 1PBCA 3AEGA 4EQWA 5U63A 2WEUA 1JNIA 4U8PA 4OPTA 2YLTA 4K7ZA 1H83A 3NTDA 4J2WA 2JB1A 2YM1A 4MJWA 2XLRA 4EQRA 2WESA 4M52A 4OPUA 4H4SA 2CFYA 3PVCA 4H4XA 4USRA 2E5VA 1H84A 1NAAA 2K3VA 1BZLA 2CVJA 1OJCA 4JDRA 2XVHA 2YAUA 3C4NA 4EMWA 1CJ3A 1YQ4A 3KLJA 5JCLA 3RP7A 4H4RA 3GSIA 3G5RA 3S61A 3NNEA 2QA2A 3BI4A 1Q1WA 1RSGA 3I3LA 3LADA 1KNPA 3NK0X 3ADAB 1VRQB 2YLXA 2YQUA 4OPCA 5JCMA 3OZ2A 3REDA 2YWLA 4EIQA 5KRQA 4EMIA 4NEWA 3CNPA 2WOIA 3NT6A 4GDPA 3NYFA 4IV9A 3AD9B 4C5OA 5CKUA 2C3DA 3IF9A 1FT6A 2PYXA 3L8KA 2YLZA 2R45A 3B3RA 3AE4A 3CN8A 4B67A 4CCQA 1TDNA 3EAOA 2WDRA 2XFUA 2GQWA 1OJTA 5FS9A 4TM3A 3L1TA 3VRDB 5L46A 1KFYA 1DOCA 3NHOX 3KPFA 4X9MA 3UKFA 1NENA 2EQ9A 3BHKA 1NHQA 2Q0KA 4J34A 5CQFA 1OJAA 2GMHA 3FBSA 3FIMB 1S3BA 4HB9A 5HY5A 3CIRA 5U1OA 1E1MA 4ECHA 1N4VA 4GR1A 3UP4A 3UKPA 2X8GA 2YLWA 3NN0X 1IUXA 3L1RA 5KOXA 2B9YA 4Z44A 1EBDA 1ONFA 3AD7B 1OJ9A 4Y4LA 2YG4A 1F8RA 4RG4A 3D8XA 5KOWA 2EQ7A 4AOSA 4K2XA 4IA6A 3AYJA 1UKVG 1BVBA 4GDEA 3S7WA 1W4XA 1NHSA 3CGDA 3UOVA 4NTDA 5EB5A 1N1PA 1F3PA 3ITJA 3VRAA 1FCDA 2GV8A 3SQPA 1N4WA 4NEVA 2YR6A 2BXSA 4CNJA 5J7XA 3AE8A 3ABVA 1E1LA 4Q4UA 1GALA 1H7XA 3DJJA 4P9SA 2WDVA 4TM0A 5EBKA 3SFDA 3UOXA 4B66A 3AE7A 3CNTA 2GF3A 3DJEA 2Z5XA 3C96A 2OALA 3DA1A 3AXBA 3BNHA 1REOA 1P2EA 3G5QA 3NG7X 4I59A 4L3XA 3NKSA 1O5WA 1M64A 4CRTA 5JCKA 5EOWA 2GR2A 5FS7A 3IHGA 3P4QA 3FO3A 2BS4A 2JBVA 2YVGA 1JEHA 4O5QA 4FX9A 4JNAA 2VQ7A 1GETA 3NK1X 3UOZA 1XANA 1QO8A 1B37A 2C76A 1CBOA 2OAMA 3C4AA 3G5SA 1PJ5A 3RHAA 4GUVA 4CY6A 1IUUA 4C3YA 1FL2A 1CL0A 3UKQA 5FMHA 3VRBA 2QCUA 2R9ZA 1O95A 1Y56A 2VVMA 3QFBA 2WP5A 1YKJA 3K7TA 2YVFA 4H7UA 2B7SA 2F5ZA 3QSSA 5HHFA 4BJZA 4H4TA 4OPDA 5U25A 1VDCA 4PABA 3UTFA 1JNRA 5J60A 3BNFA 1CHUA 5KWFA 1KSSA 1DJQA 2X3NA 3UU9A 2DKIA 3RP8A 5DBJA 2YG5A 4YTNA 1O94A 4B64A 2I0ZA 5C3JA 1AOGA 2BS3A 2WP9A 1E7PA 1QJDA 2VQBA 3BNGA 4YKGA 3QVRA 1JRXA 2YG6A 3CNJA 3M13A 2YM2A 2B76A 3P4SA 2XFQA 3UKKA 2C75A 3GYIA 4J33A 1JNZA 1FS9A 2A8XA 3AE1A 4ZCDA 5FS8A 2GVCA 1MOKA 4EQXA 1IJHA 2WOVA 2GH5A 4LU6A 3QJ4A 1FECA 1DOEA 2X8HA 2W0HA 3P4RA 1H81A 2R46A 3SM8A 1TDFA 3M12A 3LG1A 2BK5A 4IVOB 4OPLA 4Q5CA 3PO7A 4A6NB 2BACA 3CPHG 2R0PA 4PAAA 4A5LA 4TM1A 3II4A 1BKWA 3NTAA 5JCIA 3GM6A 1VG0A 4B63A 4C77A 2JB2A 4EM3A 5BVAA 2AAQA 2XVIA 4K8DA 1PBBA 1SP3A 1QLBA 3AWIA 3EANA 1GTHA 5BUKA 2YVJA 1XHCA 1LTXR 2JAEA 4EIPA 3ICTA 4K5SA 1TYTA 1L9CA 5TR3A 1CF3A 3Q9TA 2V3AA 4C74A 1IUVA 1H86A 1E39A 4U8KA 4AOXA 1ZY8A 4WJYA 1S2QA 3CPJG 2YG7A 2GR3A 2OLOA 4KPRA 3ZYXA 4ZN0A 1PBDA 1YY5A 2EQ6A 1F6MA 4U8OA 4CY8A 1CC6A 2H89A 4LA1A 2FBWA 1IUWA 2XFPA 2Z5YA 4XWRA 1E1NA 3RP6A 3ZDNA 4YTPA 1P2HA 4U2TA 1GOSA 3ALMA 3UTGA 2RGOA 4Z43A 2YR5A 1FS7A 3AE9A 1M1PA 1M1RA 1RYIA 2GB0A 4JNQA 1ZK7A 2DKHA 2JK6A 1BGNA 3IWAA 3CGEA 5KVIA 3DK4A 4BV6A 1KDGA 2QA1A 3QVPA 4HA6A 4RG3A 5ER0A 4Q5BA 2ZZBA 3LOVA 4GCMA 3TTBA 1HYUA 4H4QA 4D04A 4JY2A 1LQUA 1JU2A 1IUTA 1BWCA 3NYCA 2VVLA 3GWDA 1CC4A 1VG9A 3SCEA 3SXQA 4GRTA 2IIDA 1H82A 3UTEA 3LGQA 4DGKA 1L9DA 3NH3X 4H4WA 2H88A 2ZBWA 3BNMA 1KSUA 3AYLA 1PN0A 1BF3A 4J31A 2TMDA 5IQ4A 3I6DA 3V3NA 1PDHA 4J56A 1OAHA 4JQ9A 2RABA 3K30A 3ATRA 4WCTA 2BXRA 2O9ZA 3LJPA 2BK4A 2Q6UA 1PXCA 4DSHA 2OT4A 1EL5A 4H4UA 2WQYA 2J3NA 3AECA 2NVKX 1GT8A 3KU9A 2R4JA 2FJBA 3DJGX 4A99A 4AT2A 2ZZ0A 4UDQA 2HQMA 4L3ZA 1DODA 1GXFA 3NK2X 2WU5A 3Q6JA 3COXA 3DGZA 4OVIA 3PS9A 1RP0A 1GREA 3NN6X 1NG3A 2VVLG 4B1BA 2IVDA 4BK1A 2B9WA 2XVFA 2VRLA 4FDCB 2GR0A 2XLPA 1ZDLA 1F8SA 3AEAA 4ZCCA 4B65A 4DNAA 1GV4A 2B7RA 1K0JA 1GRBA 2A89A 1E1KA 3GWFA 4H50A 1TDOA 2XLUA 1LPFA 4X4JA 4U8JA 1YQ3A 1GPEA 3GD4A 2BA9A 1L9EA 2C73A 1D7LA 1TDEA 1KNRA 3D1IA 3UKHA 3F8PA 4A9WA 4A7AA 2WBAA 2BABA 1IUSA 1M6IA 3H4KA 5GSNA 1D4CA 1CJ4A 1GRGA 1XDIA 2PHHA 4CCRA 4DSGA 2VRMA 1Y0PA 3JSKA 4N9XA 4CNKA 4UDPA 1GRAA 3IHMA 1ZKQA 2R4EA 4LIIA 3UOYA 4AP3A 5BRTA 1Q1RA 4EM4A 4H2NA 2WETA 2XDOA 2NPXA 3AD8B 4UP3A 3VR8A 5LV9A 4TLXA 3URHA 4FK1C 4K22A 1PBFA 3GD3A 3V3OA 3QFAA 2GMJA 2WS3A 3RNMA 3F29A 3WE0A 4AT0A 3QSEA 1DXLA 2GRTA 2V6OA 4Y4MA 3NRNA 1H7WA 2B9XA 3ICSA 3T37A 1H6VA 1Y56B 3K7MX 3LXDA 3ICRA 3NIXA 1B5QA 1PJ7A 2C3CA 2JKCA 3VR9A 1B4VA 3MMOA 1NHPA 2Q0LA 3UTHA 3KKJA 3UKAA 4APNA 1K4QA 2WPFA 4YT0A 2X8CA 2BCPA 3ALJA 1COYA 4JN9A 4KX6A 3QSMA 1JRYA 1F8WA 1D5TA 3UCLA 1CJCA 2BYBA 1M1QA 3AB1A 4A79A 5IQ1A 2E1MA 2Y6RA 2WHDA 2XFOA 3CTYA 1EL9A 1FOHA 1FT5A 1GU6A 2JB3A 4YSYA 3KD9A 1ZMCA 1Z6LA 1TDKA 3DK8A 3P4PA 4H4YA 4Q17A 2EQ8A 3ISHA 1E6EA 2APGA 1L0VA 4H4VA 3M0OA 5KXJA 3BNJA 4D03A 2ARDA 4YSXA 2WDQA 4L3YA 1NEKA 3GRSA 4Z26A 4YSHA 4U2LA 2FJDA 2V3BA 4Z2UA 1OJDA 2IVEA 1GRTA 1EL8A 3HZLA 4WX1A 3CGCA 3NLCA 4U8NA 2V61A 2RF7A 3AE6A 3IC9A 1DNCA 3H8LA 3AEEA 1DJNA 1NPXA 2WPCA 2C67A 1X31B 1YQZA 2R0CA 3F8DA 5KVHA 2C66A 5JCNA 3DJDA 1QDBA 2VR0A 3F8RA 3GMBA 1KF6A 4OPIA 2UZZA 4USQA 4E0VA 5C2TA 5M10A 3FG2P 3DMEA 1CC2A 3B6DA 4A65A 4BJYA 1K0IA 1D4EA 2ZZCA 3EF6A 4C3XA 2C72A 4YSZA 2ACZA 3O0HA 3BHFA 2ZO5A 3P9UA 4JY3A 4AP1A 4H2PA 2C64A 3LZXA 2BC1A 3KVEA 5HYMA 2XYOA 4NZHA 3H8IA 1PS9A 1LVLA 4ICYA 4YXDA 3ATQA 3NYEA 5HXIA 3KA7A 2RDZA 4EQSA 3AEDA 1FS8A 2AR8A 3GYJA 2VOUA 3GYXA 4TM4A 4H2RA 1GESA 4L38A 2FJAA 2TPRA 3E1TA 2A87A 4BURA 4J36A 3V76A 1N4UA 2WOWA 2YR4A 5M0ZA 3R9UA 2RGHA 4K5RA 5GRTA 4ADWA 2GEWA 1K0LA 1EL7A 2XLSA 3CNDA 1ZOYA 3GMCA 2J7AA 1PBEA 2BCGG 1MO9A 1ZOVA 3FMWA 4B69A 2CULA 4O5UA 2V60A 4NTCA 1Q9IA 1PJ6A 1PXBA 2C65A 3ALLA 3OC4A 4IA5A 4OPGA 1B8SA 2VZ2A 4GF7A 4Z2RA 3LZWA 2E81A 1GEUA 1GERA 1GNDA 4UDRA 4XXGA 1JRZA 4OCGA 1NHRA 2V5ZA 2BK3A 1S2YA 1GRHA 2FJEA 2X99A 2Y6QA
chains in the Genus database with same CATH superfamily
4RSLA 1NG4A 2X50A 2RGJA 4X9NA 1LQTA 3VQRA 2LFCA 4I58A 1JOAA 4Z2TA 1FEAA 3DH9A 1PHHA 2CDUA 1DOBA 3OWMA 2BC0A 1GTEA 2XFNA 2R0GA 4U2SA 3SFEA 4Q0TA 3TORA 2GAHB 4YKFA 1ZMDA 4BK2A 1SEZA 4H4ZA 4Z25A 2YG3A 4U8MA 1ELIA 1XPQA 2Q7VA 3LB8A 2GAGB 4FK1A 3AE3A 3K7QX 4YWOA 2XLTA 3BNUA 4IVMB 3GDNA 4Y4NA 1FEBA 3UKLA 4J57A 4B68A 3SZ0A 3GDPA 4U8LA 4YTMA 1LJ1A 5BULA 2WP6A 2WPEA 3CGBA 4H2QA 3AE5A 1LV0A 1TRBA 3CNSA 4Z24A 1GSNA 3FPZA 4EMJA 5IPYA 1ZP0A 2BS2A 3EPTA 3DGHA 2YLSA 3KPKA 1GRFA 1S3EA 1NDAA 3AYIA 2BRAA 1MXTA 5FS6A 2AQJA 1ZX9A 2E80A 1CJ2A 1PXAA 3BI5A 3D1CA 2QAEA 4U8IA 3S5WA 4Q1OA 3UP5A 2XCGA 4BK3A 4CBQA 2E4GA 3SGLA 4TLZA 5EB4A 3SYIA 1VQWA 4XWZA 3AEBA 2YLRA 1D4DA 1V59A 2C70A 2GQFA 3AE2A 1D7YA 4A6NA 3UBRA 2GR1A 4GAPA 3DK9A 4H4PA 2XVEA 3BI2A 4REKA 3SXIA 2C7GA 3P1WA 2WU2A 3AEFA 1BGJA 3GRTA 2OA1A 4NTEA 2OLNA 3RKHA 3NGCX 2XVJA 3CPIG 1TYPA 1PBCA 3AEGA 4EQWA 5U63A 2WEUA 1JNIA 4U8PA 4OPTA 2YLTA 4K7ZA 1H83A 3NTDA 4J2WA 2JB1A 2YM1A 4MJWA 2XLRA 4G9KA 4EQRA 2WESA 4M52A 4OPUA 4G6GA 2CFYA 3PVCA 4H4SA 4H4XA 4USRA 2E5VA 1H84A 1NAAA 2K3VA 1BZLA 2CVJA 1OJCA 4JDRA 2XVHA 2YAUA 3C4NA 4EMWA 1CJ3A 1YQ4A 3KLJA 5JCLA 3RP7A 4H4RA 3GSIA 3G5RA 3S61A 3NNEA 2QA2A 3BI4A 1Q1WA 1RSGA 3I3LA 3LADA 3T2ZA 1KNPA 3NK0X 3ADAB 1VRQB 2YLXA 2YQUA 4OPCA 5JCMA 3OZ2A 3REDA 2YWLA 4EIQA 5KRQA 4EMIA 4NEWA 3CNPA 2WOIA 3NT6A 4GDPA 3NYFA 4IV9A 3AD9B 4C5OA 5CKUA 2C3DA 3IF9A 1FT6A 2PYXA 3L8KA 2YLZA 2R45A 3B3RA 3AE4A 3CN8A 4B67A 4CCQA 1TDNA 3EAOA 2WDRA 2XFUA 2GQWA 1OJTA 5FS9A 4TM3A 3L1TA 3VRDB 3SZFA 5L46A 1KFYA 1DOCA 3NHOX 3KPFA 4X9MA 3UKFA 1NENA 2EQ9A 3BHKA 1NHQA 2Q0KA 4J34A 5CQFA 1OJAA 2GMHA 3FBSA 3FIMB 1S3BA 4HB9A 5HY5A 3CIRA 5U1OA 1E1MA 4ECHA 1N4VA 4GR1A 3UP4A 3UKPA 4G73A 2X8GA 2YLWA 3NN0X 1IUXA 3L1RA 5KOXA 2B9YA 4G74A 4Z44A 1EBDA 1ONFA 3AD7B 1OJ9A 4Y4LA 2YG4A 1F8RA 4RG4A 3D8XA 4II2A 2EQ7A 5KOWA 4AOSA 3HYWA 4IA6A 4K2XA 3AYJA 1UKVG 1BVBA 4GDEA 3S7WA 1W4XA 1NHSA 3CGDA 3UOVA 4NTDA 5EB5A 1N1PA 1F3PA 3ITJA 3VRAA 1FCDA 2GV8A 3SQPA 1N4WA 4NEVA 2YR6A 2BXSA 4CNJA 5J7XA 3AE8A 3ABVA 1E1LA 4Q4UA 1GALA 1H7XA 3DJJA 4P9SA 2WDVA 4TM0A 5EBKA 3SFDA 3UOXA 4B66A 3AE7A 3CNTA 2GF3A 3DJEA 2Z5XA 4NWZA 3C96A 2OALA 3DA1A 3AXBA 3BNHA 1REOA 1P2EA 3G5QA 3NG7X 4I59A 4L3XA 3NKSA 1O5WA 1M64A 4CRTA 5JCKA 5EOWA 2GR2A 5FS7A 3IHGA 3P4QA 3FO3A 2BS4A 2JBVA 2YVGA 5KMSA 1JEHA 4O5QA 4FX9A 4JNAA 2VQ7A 1GETA 3NK1X 3UOZA 1XANA 1QO8A 1B37A 2C76A 1CBOA 2OAMA 3C4AA 3T2KA 3G5SA 1PJ5A 2CZSA 3RHAA 4GUVA 4CY6A 1IUUA 4C3YA 1FL2A 1CL0A 3UKQA 5FMHA 3VRBA 2QCUA 2R9ZA 1O95A 1Y56A 2VVMA 3QFBA 2WP5A 1YKJA 3K7TA 2YVFA 4H7UA 2B7SA 2F5ZA 3QSSA 5HHFA 4BJZA 4H4TA 4OPDA 5U25A 1VDCA 4PABA 4II3A 3UTFA 1JNRA 5J60A 3BNFA 1CHUA 5KWFA 1KSSA 1DJQA 2X3NA 3UU9A 2DKIA 3RP8A 5DBJA 2YG5A 4YTNA 1O94A 4B64A 2I0ZA 5C3JA 1AOGA 2BS3A 2WP9A 1E7PA 1QJDA 2VQBA 3BNGA 4YKGA 3QVRA 1JRXA 2YG6A 3CNJA 3M13A 2YM2A 2B76A 3P4SA 2XFQA 3UKKA 2C75A 3GYIA 4J33A 1JNZA 1FS9A 2A8XA 3AE1A 4ZCDA 5FS8A 2GVCA 1MOKA 4EQXA 1IJHA 2WOVA 2GH5A 4LU6A 3QJ4A 1FECA 1DOEA 2X8HA 2W0HA 3P4RA 1H81A 2R46A 3SM8A 1TDFA 3M12A 3LG1A 2BK5A 4IVOB 4OPLA 4Q5CA 3PO7A 4A6NB 2BACA 3CPHG 2R0PA 4PAAA 4A5LA 5KNLA 4TM1A 3II4A 1BKWA 3NTAA 5JCIA 3GM6A 1VG0A 4B63A 4C77A 2JB2A 4EM3A 5BVAA 2AAQA 2XVIA 4K8DA 1PBBA 1SP3A 1QLBA 3AWIA 3EANA 1GTHA 5BUKA 3T31A 2YVJA 1XHCA 1LTXR 2JAEA 4EIPA 3ICTA 4K5SA 1TYTA 1L9CA 5TR3A 1CF3A 2BRYA 3Q9TA 2V3AA 4C74A 1IUVA 1H86A 1E39A 4U8KA 4AOXA 1ZY8A 4WJYA 1S2QA 3CPJG 2YG7A 3T14A 4GAVA 2GR3A 2OLOA 4KPRA 3ZYXA 4ZN0A 1PBDA 1YY5A 2EQ6A 1F6MA 4U8OA 4CY8A 1CC6A 2H89A 4LA1A 2FBWA 1IUWA 2XFPA 2Z5YA 4XWRA 1E1NA 3RP6A 3SZWA 3ZDNA 1P2HA 4U2TA 1GOSA 4YTPA 3ALMA 3UTGA 5KMPA 2RGOA 4Z43A 2YR5A 1FS7A 3AE9A 1M1PA 1M1RA 1RYIA 2GB0A 4JNQA 1ZK7A 2DKHA 3HYVA 2JK6A 1BGNA 3IWAA 3CGEA 5KVIA 3DK4A 4BV6A 1KDGA 2QA1A 3QVPA 4HA6A 4RG3A 5ER0A 4Q5BA 2ZZBA 3LOVA 4GCMA 3TTBA 1HYUA 4H4QA 4D04A 4JY2A 1LQUA 1JU2A 1IUTA 1BWCA 3NYCA 2VVLA 3GWDA 1CC4A 1VG9A 3SCEA 3SXQA 4GRTA 2IIDA 1H82A 3UTEA 3LGQA 4DGKA 1L9DA 3NH3X 4H4WA 2H88A 2ZBWA 3BNMA 1KSUA 3AYLA 1PN0A 1BF3A 4J31A 2TMDA 5IQ4A 3I6DA 3V3NA 1PDHA 4J56A 1OAHA 4JQ9A 2RABA 3K30A 3ATRA 4WCTA 2BXRA 2O9ZA 3LJPA 2BK4A 2Q6UA 1PXCA 4DSHA 2OT4A 1EL5A 4H4UA 2WQYA 2J3NA 3AECA 2NVKX 1GT8A 3KU9A 2R4JA 2FJBA 3DJGX 4A99A 4AT2A 2ZZ0A 4UDQA 2HQMA 4L3ZA 1DODA 1GXFA 3NK2X 2WU5A 3Q6JA 3COXA 3DGZA 4OVIA 3PS9A 1RP0A 1GREA 3HYXA 3NN6X 1NG3A 2VVLG 4B1BA 2IVDA 4BK1A 2B9WA 2XVFA 2VRLA 4FDCB 2GR0A 2XLPA 1ZDLA 1F8SA 3AEAA 4ZCCA 4B65A 4DNAA 1GV4A 2B7RA 1K0JA 1GRBA 2A89A 1E1KA 3GWFA 4H50A 1TDOA 2XLUA 1LPFA 4X4JA 4U8JA 1YQ3A 1GPEA 3GD4A 2BA9A 1L9EA 2C73A 1D7LA 1TDEA 1KNRA 3D1IA 3UKHA 3F8PA 5KMQA 4A9WA 4A7AA 2WBAA 2BABA 1IUSA 1M6IA 3H4KA 5GSNA 1D4CA 1CJ4A 1GRGA 1XDIA 2PHHA 4CCRA 4DSGA 2VRMA 1Y0PA 3JSKA 4N9XA 4CNKA 4UDPA 1GRAA 3IHMA 1ZKQA 2R4EA 4LIIA 3UOYA 4AP3A 5BRTA 1Q1RA 4EM4A 4H2NA 4G6HA 2WETA 2XDOA 2NPXA 3AD8B 4UP3A 3VR8A 5LV9A 4TLXA 3URHA 4FK1C 4K22A 1PBFA 3GD3A 3V3OA 3QFAA 2GMJA 2WS3A 3RNMA 3F29A 3WE0A 4AT0A 3QSEA 1DXLA 2GRTA 2V6OA 4Y4MA 3NRNA 3SY4A 3SZCA 1H7WA 2B9XA 3ICSA 3T37A 1H6VA 1Y56B 3K7MX 3LXDA 3ICRA 3NIXA 1B5QA 1PJ7A 2C3CA 2JKCA 3VR9A 1B4VA 3MMOA 1NHPA 2Q0LA 3UTHA 3KKJA 3UKAA 4APNA 1K4QA 2WPFA 4YT0A 2X8CA 2BCPA 3ALJA 1COYA 4JN9A 4KX6A 3QSMA 1JRYA 1F8WA 1D5TA 4NNJA 3UCLA 1CJCA 2BYBA 1M1QA 3AB1A 4A79A 5IQ1A 2E1MA 2Y6RA 2WHDA 2XFOA 3CTYA 1EL9A 1FOHA 1FT5A 1GU6A 2JB3A 4YSYA 3KD9A 1ZMCA 1Z6LA 1TDKA 3DK8A 3P4PA 4H4YA 4Q17A 2EQ8A 3ISHA 1E6EA 2APGA 1L0VA 4H4VA 3M0OA 5KXJA 3BNJA 4D03A 2ARDA 4YSXA 2WDQA 4L3YA 1NEKA 3GRSA 4Z26A 4YSHA 4U2LA 2FJDA 2V3BA 4Z2UA 1OJDA 2IVEA 1GRTA 1EL8A 3HZLA 4WX1A 3CGCA 3NLCA 4U8NA 2V61A 2RF7A 3AE6A 3IC9A 1DNCA 3H8LA 3AEEA 1DJNA 1NPXA 5KMRA 2WPCA 2C67A 1X31B 1YQZA 2R0CA 3T2YA 3F8DA 5KVHA 2C66A 5JCNA 3DJDA 1QDBA 2VR0A 3F8RA 3GMBA 1KF6A 4OPIA 2UZZA 4USQA 4E0VA 5C2TA 5M10A 3FG2P 3DMEA 3T0KA 1CC2A 3B6DA 4A65A 4BJYA 1K0IA 1D4EA 2ZZCA 3EF6A 4C3XA 2C72A 4YSZA 2ACZA 3O0HA 3BHFA 2ZO5A 3P9UA 4JY3A 4AP1A 4H2PA 2C64A 3LZXA 2BC1A 3KVEA 5HYMA 2XYOA 4NZHA 3H8IA 1PS9A 1LVLA 4ICYA 4YXDA 3ATQA 3NYEA 5HXIA 3CMMA 2RDZA 3KA7A 3AEDA 1FS8A 2AR8A 3GYJA 4EQSA 2VOUA 3GYXA 4TM4A 4H2RA 1GESA 4L38A 2FJAA 2TPRA 3E1TA 2A87A 4BURA 4J36A 3V76A 1N4UA 2WOWA 2YR4A 5M0ZA 3R9UA 2RGHA 4K5RA 5GRTA 4ADWA 2GEWA 1K0LA 1EL7A 2XLSA 3CNDA 1ZOYA 3GMCA 2J7AA 1PBEA 2BCGG 1MO9A 1ZOVA 2C4CA 3FMWA 4B69A 2CULA 4O5UA 2V60A 4NTCA 1Q9IA 1PJ6A 1PXBA 2C65A 3ALLA 3OC4A 4IA5A 4OPGA 1B8SA 2VZ2A 4GF7A 4Z2RA 3LZWA 2E81A 1GEUA 1GERA 1GNDA 4UDRA 4XXGA 1JRZA 4OCGA 1NHRA 2V5ZA 2BK3A 1S2YA 1GRHA 2FJEA 3SX6A 2X99A 2Y6QA
chains in the Genus database with same CATH topology
4RSLA 1NG4A 2X50A 2RGJA 4X9NA 1LQTA 3VQRA 2LFCA 4I58A 1JOAA 4Z2TA 1FEAA 3DH9A 1PHHA 2CDUA 1DOBA 3OWMA 2BC0A 1GTEA 2XFNA 2R0GA 4U2SA 3SFEA 4Q0TA 3TORA 2GAHB 4YKFA 1ZMDA 4BK2A 1SEZA 4H4ZA 4Z25A 2YG3A 4U8MA 1ELIA 1XPQA 2Q7VA 3LB8A 2GAGB 4FK1A 3AE3A 3K7QX 4YWOA 2XLTA 3BNUA 4IVMB 3GDNA 4Y4NA 1FEBA 3UKLA 4J57A 4B68A 3SZ0A 3GDPA 4U8LA 4YTMA 1LJ1A 5BULA 2WP6A 2WPEA 3CGBA 4H2QA 3AE5A 1LV0A 1TRBA 3CNSA 4Z24A 1GSNA 3FPZA 4EMJA 5IPYA 1ZP0A 2BS2A 3EPTA 3DGHA 2YLSA 3KPKA 1GRFA 1S3EA 1NDAA 3AYIA 2BRAA 1MXTA 5FS6A 2AQJA 1ZX9A 2E80A 1CJ2A 1PXAA 3BI5A 3D1CA 2QAEA 4U8IA 3S5WA 4Q1OA 3UP5A 2XCGA 4BK3A 4CBQA 2E4GA 3SGLA 4TLZA 5EB4A 3SYIA 1VQWA 4XWZA 3AEBA 2YLRA 1D4DA 1V59A 2C70A 2GQFA 3AE2A 1D7YA 4A6NA 3UBRA 2GR1A 4GAPA 3DK9A 4H4PA 2XVEA 3BI2A 4REKA 3SXIA 2C7GA 3P1WA 2WU2A 3AEFA 1BGJA 3GRTA 2OA1A 4NTEA 2OLNA 3RKHA 3NGCX 2XVJA 3CPIG 1TYPA 1PBCA 3AEGA 4EQWA 5U63A 2WEUA 1JNIA 4U8PA 4OPTA 2YLTA 4K7ZA 1H83A 3NTDA 4J2WA 2JB1A 2YM1A 4MJWA 2XLRA 4G9KA 4EQRA 2WESA 4M52A 4OPUA 4G6GA 2CFYA 3PVCA 4H4SA 4H4XA 4USRA 2E5VA 1H84A 1NAAA 2K3VA 1BZLA 2CVJA 1OJCA 4JDRA 2XVHA 2YAUA 3C4NA 4EMWA 1CJ3A 1YQ4A 3KLJA 5JCLA 3RP7A 4H4RA 3GSIA 3G5RA 3S61A 3NNEA 2QA2A 3BI4A 1Q1WA 1RSGA 3I3LA 3LADA 3T2ZA 1KNPA 3NK0X 3ADAB 1VRQB 2YLXA 2YQUA 4OPCA 5JCMA 3OZ2A 3REDA 2YWLA 4EIQA 5KRQA 4EMIA 4NEWA 3CNPA 2WOIA 3NT6A 4GDPA 3NYFA 4IV9A 3AD9B 4C5OA 5CKUA 2C3DA 3IF9A 1FT6A 2PYXA 3L8KA 2YLZA 2R45A 3B3RA 3AE4A 3CN8A 4B67A 4CCQA 1TDNA 3EAOA 2WDRA 2XFUA 2GQWA 1OJTA 5FS9A 4TM3A 3L1TA 3VRDB 3SZFA 5L46A 1KFYA 1DOCA 3NHOX 3KPFA 4X9MA 3UKFA 1NENA 2EQ9A 3BHKA 1NHQA 2Q0KA 4J34A 5CQFA 1OJAA 2GMHA 3FBSA 3FIMB 1S3BA 4HB9A 5HY5A 3CIRA 5U1OA 1E1MA 4ECHA 1N4VA 4GR1A 3UP4A 3UKPA 4G73A 2X8GA 2YLWA 3NN0X 1IUXA 3L1RA 5KOXA 2B9YA 4G74A 4Z44A 1EBDA 1ONFA 3AD7B 1OJ9A 4Y4LA 2YG4A 1F8RA 4RG4A 3D8XA 4II2A 2EQ7A 5KOWA 4AOSA 3HYWA 4IA6A 4K2XA 3AYJA 1UKVG 1BVBA 4GDEA 3S7WA 1W4XA 1NHSA 3CGDA 3UOVA 4NTDA 5EB5A 1N1PA 1F3PA 3ITJA 3VRAA 1FCDA 2GV8A 3SQPA 1N4WA 4NEVA 2YR6A 2BXSA 4CNJA 5J7XA 3AE8A 3ABVA 1E1LA 4Q4UA 1GALA 1H7XA 3DJJA 4P9SA 2WDVA 4TM0A 5EBKA 3SFDA 3UOXA 4B66A 3AE7A 3CNTA 2GF3A 3DJEA 2Z5XA 4NWZA 3C96A 2OALA 3DA1A 3AXBA 3BNHA 1REOA 1P2EA 3G5QA 3NG7X 4I59A 4L3XA 3NKSA 1O5WA 1M64A 4CRTA 5JCKA 5EOWA 2GR2A 5FS7A 3IHGA 3P4QA 3FO3A 2BS4A 2JBVA 2YVGA 5KMSA 1JEHA 4O5QA 4FX9A 4JNAA 2VQ7A 1GETA 3NK1X 3UOZA 1XANA 1QO8A 1B37A 2C76A 1CBOA 2OAMA 3C4AA 3T2KA 3G5SA 1PJ5A 3RHAA 4GUVA 4CY6A 1IUUA 4C3YA 1FL2A 1CL0A 3UKQA 5FMHA 3VRBA 2QCUA 2R9ZA 1O95A 1Y56A 2VVMA 3QFBA 2WP5A 1YKJA 3K7TA 2YVFA 4H7UA 2B7SA 2F5ZA 3QSSA 5HHFA 4BJZA 4H4TA 4OPDA 5U25A 1VDCA 4PABA 4II3A 3UTFA 1JNRA 5J60A 3BNFA 1CHUA 5KWFA 1KSSA 1DJQA 2X3NA 3UU9A 2DKIA 3RP8A 5DBJA 2YG5A 4YTNA 1O94A 4B64A 2I0ZA 5C3JA 1AOGA 2BS3A 2WP9A 1E7PA 1QJDA 2VQBA 3BNGA 4YKGA 3QVRA 1JRXA 2YG6A 3CNJA 3M13A 2YM2A 2B76A 3P4SA 2XFQA 3UKKA 2C75A 3GYIA 4J33A 1JNZA 1FS9A 2A8XA 3AE1A 4ZCDA 5FS8A 2GVCA 1MOKA 4EQXA 1IJHA 2WOVA 2GH5A 4LU6A 3QJ4A 1FECA 1DOEA 2X8HA 2W0HA 3P4RA 1H81A 2R46A 3SM8A 1TDFA 3M12A 3LG1A 2BK5A 4IVOB 4OPLA 4Q5CA 3PO7A 4A6NB 2BACA 3CPHG 2R0PA 4PAAA 4A5LA 5KNLA 4TM1A 3II4A 1BKWA 3NTAA 5JCIA 3GM6A 1VG0A 4B63A 4C77A 2JB2A 4EM3A 5BVAA 2AAQA 2XVIA 4K8DA 1PBBA 1SP3A 1QLBA 3AWIA 3EANA 1GTHA 5BUKA 3T31A 2YVJA 1XHCA 1LTXR 2JAEA 4EIPA 3ICTA 4K5SA 1TYTA 1L9CA 5TR3A 1CF3A 2BRYA 3Q9TA 2V3AA 4C74A 1IUVA 1H86A 1E39A 4U8KA 4AOXA 1ZY8A 4WJYA 1S2QA 3CPJG 2YG7A 3T14A 4GAVA 2GR3A 2OLOA 4KPRA 3ZYXA 4ZN0A 1PBDA 1YY5A 2EQ6A 1F6MA 4U8OA 4CY8A 1CC6A 2H89A 4LA1A 2FBWA 1IUWA 2XFPA 2Z5YA 4XWRA 1E1NA 3RP6A 3SZWA 3ZDNA 1P2HA 4U2TA 1GOSA 4YTPA 3ALMA 3UTGA 5KMPA 2RGOA 4Z43A 2YR5A 1FS7A 3AE9A 1M1PA 1M1RA 1RYIA 2GB0A 4JNQA 1ZK7A 2DKHA 3HYVA 2JK6A 1BGNA 3IWAA 3CGEA 5KVIA 3DK4A 4BV6A 1KDGA 2QA1A 3QVPA 4HA6A 4RG3A 5ER0A 4Q5BA 2ZZBA 3LOVA 4GCMA 3TTBA 1HYUA 4H4QA 4D04A 4JY2A 1LQUA 1JU2A 1IUTA 1BWCA 3NYCA 2VVLA 3GWDA 1CC4A 1VG9A 3SCEA 3SXQA 4GRTA 2IIDA 1H82A 3UTEA 3LGQA 4DGKA 1L9DA 3NH3X 4H4WA 2H88A 2ZBWA 3BNMA 1KSUA 3AYLA 1PN0A 1BF3A 4J31A 2TMDA 5IQ4A 3I6DA 3V3NA 1PDHA 4J56A 1OAHA 4JQ9A 2RABA 3K30A 3ATRA 4WCTA 2BXRA 2O9ZA 3LJPA 2BK4A 2Q6UA 1PXCA 4DSHA 2OT4A 1EL5A 4H4UA 2WQYA 2J3NA 3AECA 2NVKX 1GT8A 3KU9A 2R4JA 2FJBA 3DJGX 4A99A 4AT2A 2ZZ0A 4UDQA 2HQMA 4L3ZA 1DODA 1GXFA 3NK2X 2WU5A 3Q6JA 3COXA 3DGZA 4OVIA 3PS9A 1RP0A 1GREA 3HYXA 3NN6X 1NG3A 2VVLG 4B1BA 2IVDA 4BK1A 2B9WA 2XVFA 2VRLA 4FDCB 2GR0A 2XLPA 1ZDLA 1F8SA 3AEAA 4ZCCA 4B65A 4DNAA 1GV4A 2B7RA 1K0JA 1GRBA 2A89A 1E1KA 3GWFA 4H50A 1TDOA 2XLUA 1LPFA 4X4JA 4U8JA 1YQ3A 1GPEA 3GD4A 2BA9A 1L9EA 2C73A 1D7LA 1TDEA 1KNRA 3D1IA 3UKHA 3F8PA 5KMQA 4A9WA 4A7AA 2WBAA 2BABA 1IUSA 1M6IA 3H4KA 5GSNA 1D4CA 1CJ4A 1GRGA 1XDIA 2PHHA 4CCRA 4DSGA 2VRMA 1Y0PA 3JSKA 4N9XA 4CNKA 4UDPA 1GRAA 3IHMA 1ZKQA 2R4EA 4LIIA 3UOYA 4AP3A 5BRTA 1Q1RA 4EM4A 4H2NA 4G6HA 2WETA 2XDOA 2NPXA 3AD8B 4UP3A 3VR8A 5LV9A 4TLXA 3URHA 4FK1C 4K22A 1PBFA 3GD3A 3V3OA 3QFAA 2GMJA 2WS3A 3RNMA 3F29A 3WE0A 4AT0A 3QSEA 1DXLA 2GRTA 2V6OA 4Y4MA 3NRNA 3SY4A 3SZCA 1H7WA 2B9XA 3ICSA 3T37A 1H6VA 1Y56B 3K7MX 3LXDA 3ICRA 3NIXA 1B5QA 1PJ7A 2C3CA 2JKCA 3VR9A 1B4VA 3MMOA 1NHPA 2Q0LA 3UTHA 3KKJA 3UKAA 4APNA 1K4QA 2WPFA 4YT0A 2X8CA 2BCPA 3ALJA 1COYA 4JN9A 4KX6A 3QSMA 1JRYA 1F8WA 1D5TA 4NNJA 3UCLA 1CJCA 2BYBA 1M1QA 3AB1A 4A79A 5IQ1A 2E1MA 2Y6RA 2WHDA 2XFOA 3CTYA 1EL9A 1FOHA 1FT5A 1GU6A 2JB3A 4YSYA 3KD9A 1ZMCA 1Z6LA 1TDKA 3DK8A 3P4PA 4H4YA 4Q17A 2EQ8A 3ISHA 1E6EA 2APGA 1L0VA 4H4VA 3M0OA 5KXJA 3BNJA 4D03A 2ARDA 4YSXA 2WDQA 4L3YA 1NEKA 3GRSA 4Z26A 4YSHA 4U2LA 2FJDA 2V3BA 4Z2UA 1OJDA 2IVEA 1GRTA 1EL8A 3HZLA 4WX1A 3CGCA 3NLCA 4U8NA 2V61A 2RF7A 3AE6A 3IC9A 1DNCA 3H8LA 3AEEA 1DJNA 1NPXA 5KMRA 2WPCA 2C67A 1X31B 1YQZA 2R0CA 3T2YA 3F8DA 5KVHA 2C66A 5JCNA 3DJDA 1QDBA 2VR0A 3F8RA 3GMBA 1KF6A 4OPIA 2UZZA 4USQA 4E0VA 5C2TA 5M10A 3FG2P 3DMEA 3T0KA 1CC2A 3B6DA 4A65A 4BJYA 1K0IA 1D4EA 2ZZCA 3EF6A 4C3XA 2C72A 4YSZA 2ACZA 3O0HA 3BHFA 2ZO5A 3P9UA 4JY3A 4AP1A 4H2PA 2C64A 3LZXA 2BC1A 3KVEA 5HYMA 2XYOA 4NZHA 3H8IA 1PS9A 1LVLA 4ICYA 4YXDA 3ATQA 3NYEA 5HXIA 3CMMA 2RDZA 3KA7A 3AEDA 1FS8A 2AR8A 3GYJA 4EQSA 2VOUA 3GYXA 4TM4A 4H2RA 1GESA 4L38A 2FJAA 2TPRA 3E1TA 2A87A 4BURA 4J36A 3V76A 1N4UA 2WOWA 2YR4A 5M0ZA 3R9UA 2RGHA 4K5RA 5GRTA 4ADWA 2GEWA 1K0LA 1EL7A 2XLSA 3CNDA 1ZOYA 3GMCA 2J7AA 1PBEA 2BCGG 1MO9A 1ZOVA 2C4CA 3FMWA 4B69A 2CULA 4O5UA 2V60A 4NTCA 1Q9IA 1PJ6A 1PXBA 2C65A 3ALLA 3OC4A 4IA5A 4OPGA 1B8SA 2VZ2A 4GF7A 4Z2RA 3LZWA 2E81A 1GEUA 1GERA 1GNDA 4UDRA 4XXGA 1JRZA 4OCGA 1NHRA 2V5ZA 2BK3A 1S2YA 1GRHA 2FJEA 3SX6A 2X99A 2Y6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RSL A;  1NG4 A;  2X50 A;  2RGJ A;  4X9N A;  1LQT A;  3VQR A;  2LFC A;  4I58 A;  1JOA A;  4Z2T A;  1FEA A;  3DH9 A;  1PHH A;  2CDU A;  1DOB A;  3OWM A;  2BC0 A;  1GTE A;  2XFN A;  2R0G A;  4U2S A;  3SFE A;  4Q0T A;  3TOR A;  2GAH B;  4YKF A;  1ZMD A;  4BK2 A;  1SEZ A;  4H4Z A;  4Z25 A;  2YG3 A;  4U8M A;  1ELI A;  1XPQ A;  2Q7V A;  3LB8 A;  2GAG B;  4FK1 A;  3AE3 A;  3K7Q X;  4YWO A;  2XLT A;  3BNU A;  4IVM B;  3GDN A;  4Y4N A;  1FEB A;  3UKL A;  4J57 A;  4B68 A;  3GDP A;  4U8L A;  4YTM A;  1LJ1 A;  5BUL A;  2WP6 A;  2WPE A;  3CGB A;  4H2Q A;  3AE5 A;  1LV0 A;  1TRB A;  3CNS A;  4Z24 A;  1GSN A;  3FPZ A;  4EMJ A;  5IPY A;  1ZP0 A;  2BS2 A;  3EPT A;  3DGH A;  2YLS A;  1GRF A;  1S3E A;  1NDA A;  3AYI A;  5FS6 A;  1MXT A;  2AQJ A;  1ZX9 A;  2E80 A;  1CJ2 A;  1PXA A;  3BI5 A;  3D1C A;  2QAE A;  4U8I A;  3S5W A;  4Q1O A;  3UP5 A;  2XCG A;  4BK3 A;  4CBQ A;  2E4G A;  3SGL A;  4TLZ A;  5EB4 A;  1VQW A;  4XWZ A;  3AEB A;  2YLR A;  1D4D A;  1V59 A;  2C70 A;  2GQF A;  3AE2 A;  1D7Y A;  4A6N A;  3UBR A;  2GR1 A;  3DK9 A;  4H4P A;  2XVE A;  3BI2 A;  4REK A;  2C7G A;  3P1W A;  2WU2 A;  3AEF A;  1BGJ A;  3GRT A;  2OA1 A;  4NTE A;  2OLN A;  3RKH A;  3NGC X;  2XVJ A;  3CPI G;  1TYP A;  1PBC A;  3AEG A;  4EQW A;  5U63 A;  2WEU A;  1JNI A;  4U8P A;  4OPT A;  2YLT A;  4K7Z A;  1H83 A;  3NTD A;  4J2W A;  2JB1 A;  2YM1 A;  4MJW A;  2XLR A;  4EQR A;  2WES A;  4M52 A;  4OPU A;  4H4S A;  2CFY A;  3PVC A;  4H4X A;  4USR A;  2E5V A;  1H84 A;  1NAA A;  2K3V A;  1BZL A;  2CVJ A;  1OJC A;  4JDR A;  2XVH A;  2YAU A;  3C4N A;  4EMW A;  1CJ3 A;  1YQ4 A;  3KLJ A;  5JCL A;  3RP7 A;  4H4R A;  3GSI A;  3G5R A;  3S61 A;  3NNE A;  2QA2 A;  3BI4 A;  1Q1W A;  1RSG A;  3I3L A;  3LAD A;  1KNP A;  3NK0 X;  3ADA B;  1VRQ B;  2YLX A;  2YQU A;  4OPC A;  5JCM A;  3OZ2 A;  3RED A;  2YWL A;  4EIQ A;  5KRQ A;  4EMI A;  4NEW A;  3CNP A;  2WOI A;  3NT6 A;  4GDP A;  3NYF A;  4IV9 A;  3AD9 B;  4C5O A;  5CKU A;  2C3D A;  3IF9 A;  1FT6 A;  2PYX A;  3L8K A;  2YLZ A;  2R45 A;  3B3R A;  3AE4 A;  3CN8 A;  4B67 A;  4CCQ A;  1TDN A;  3EAO A;  2WDR A;  2XFU A;  2GQW A;  1OJT A;  5FS9 A;  4TM3 A;  3L1T A;  3VRD B;  5L46 A;  1KFY A;  1DOC A;  3NHO X;  3KPF A;  4X9M A;  3UKF A;  1NEN A;  2EQ9 A;  3BHK A;  1NHQ A;  2Q0K A;  4J34 A;  5CQF A;  1OJA A;  2GMH A;  3FBS A;  3FIM B;  1S3B A;  4HB9 A;  5HY5 A;  3CIR A;  5U1O A;  1E1M A;  4ECH A;  1N4V A;  4GR1 A;  3UP4 A;  3UKP A;  2X8G A;  2YLW A;  3NN0 X;  1IUX A;  3L1R A;  5KOX A;  2B9Y A;  4Z44 A;  1EBD A;  1ONF A;  3AD7 B;  1OJ9 A;  4Y4L A;  2YG4 A;  1F8R A;  4RG4 A;  3D8X A;  5KOW A;  2EQ7 A;  4AOS A;  4K2X A;  4IA6 A;  3AYJ A;  1UKV G;  1BVB A;  4GDE A;  3S7W A;  1W4X A;  1NHS A;  3CGD A;  3UOV A;  4NTD A;  5EB5 A;  1N1P A;  1F3P A;  3ITJ A;  3VRA A;  1FCD A;  2GV8 A;  3SQP A;  1N4W A;  4NEV A;  2YR6 A;  2BXS A;  4CNJ A;  5J7X A;  3AE8 A;  3ABV A;  1E1L A;  4Q4U A;  1GAL A;  1H7X A;  3DJJ A;  4P9S A;  2WDV A;  4TM0 A;  5EBK A;  3SFD A;  3UOX A;  4B66 A;  3AE7 A;  3CNT A;  2GF3 A;  3DJE A;  2Z5X A;  3C96 A;  2OAL A;  3DA1 A;  3AXB A;  3BNH A;  1REO A;  1P2E A;  3G5Q A;  3NG7 X;  4I59 A;  4L3X A;  3NKS A;  1O5W A;  1M64 A;  4CRT A;  5JCK A;  5EOW A;  2GR2 A;  5FS7 A;  3IHG A;  3P4Q A;  3FO3 A;  2BS4 A;  2JBV A;  2YVG A;  1JEH A;  4O5Q A;  4FX9 A;  4JNA A;  2VQ7 A;  1GET A;  3NK1 X;  3UOZ A;  1XAN A;  1QO8 A;  1B37 A;  2C76 A;  1CBO A;  2OAM A;  3C4A A;  3G5S A;  1PJ5 A;  3RHA A;  4GUV A;  4CY6 A;  1IUU A;  4C3Y A;  1FL2 A;  1CL0 A;  3UKQ A;  5FMH A;  3VRB A;  2QCU A;  2R9Z A;  1O95 A;  1Y56 A;  2VVM A;  3QFB A;  2WP5 A;  1YKJ A;  3K7T A;  2YVF A;  4H7U A;  2B7S A;  2F5Z A;  3QSS A;  5HHF A;  4BJZ A;  4H4T A;  4OPD A;  5U25 A;  1VDC A;  4PAB A;  3UTF A;  1JNR A;  5J60 A;  3BNF A;  1CHU A;  5KWF A;  1KSS A;  1DJQ A;  2X3N A;  3UU9 A;  2DKI A;  3RP8 A;  5DBJ A;  2YG5 A;  4YTN A;  1O94 A;  4B64 A;  2I0Z A;  5C3J A;  1AOG A;  2BS3 A;  2WP9 A;  1E7P A;  1QJD A;  2VQB A;  3BNG A;  4YKG A;  3QVR A;  1JRX A;  2YG6 A;  3CNJ A;  3M13 A;  2YM2 A;  2B76 A;  3P4S A;  2XFQ A;  3UKK A;  2C75 A;  3GYI A;  4J33 A;  1JNZ A;  1FS9 A;  2A8X A;  3AE1 A;  4ZCD A;  5FS8 A;  2GVC A;  1MOK A;  4EQX A;  1IJH A;  2WOV A;  2GH5 A;  4LU6 A;  3QJ4 A;  1FEC A;  1DOE A;  2X8H A;  2W0H A;  3P4R A;  1H81 A;  2R46 A;  3SM8 A;  1TDF A;  3M12 A;  3LG1 A;  2BK5 A;  4IVO B;  4OPL A;  4Q5C A;  3PO7 A;  4A6N B;  2BAC A;  3CPH G;  2R0P A;  4PAA A;  4A5L A;  4TM1 A;  3II4 A;  1BKW A;  3NTA A;  5JCI A;  3GM6 A;  1VG0 A;  4B63 A;  4C77 A;  2JB2 A;  4EM3 A;  5BVA A;  2AAQ A;  2XVI A;  4K8D A;  1PBB A;  1SP3 A;  1QLB A;  3AWI A;  3EAN A;  1GTH A;  5BUK A;  2YVJ A;  1XHC A;  1LTX R;  2JAE A;  4EIP A;  3ICT A;  4K5S A;  1TYT A;  1L9C A;  5TR3 A;  1CF3 A;  3Q9T A;  2V3A A;  4C74 A;  1IUV A;  1H86 A;  1E39 A;  4U8K A;  4AOX A;  1ZY8 A;  4WJY A;  1S2Q A;  3CPJ G;  2YG7 A;  2GR3 A;  2OLO A;  4KPR A;  3ZYX A;  4ZN0 A;  1PBD A;  1YY5 A;  2EQ6 A;  1F6M A;  4U8O A;  4CY8 A;  1CC6 A;  2H89 A;  4LA1 A;  2FBW A;  1IUW A;  2XFP A;  2Z5Y A;  4XWR A;  1E1N A;  3RP6 A;  3ZDN A;  4YTP A;  1P2H A;  4U2T A;  1GOS A;  3ALM A;  3UTG A;  2RGO A;  4Z43 A;  2YR5 A;  1FS7 A;  3AE9 A;  1M1P A;  1M1R A;  1RYI A;  2GB0 A;  4JNQ A;  1ZK7 A;  2DKH A;  2JK6 A;  1BGN A;  3IWA A;  3CGE A;  5KVI A;  3DK4 A;  4BV6 A;  1KDG A;  2QA1 A;  3QVP A;  4HA6 A;  4RG3 A;  5ER0 A;  4Q5B A;  2ZZB A;  3LOV A;  4GCM A;  3TTB A;  1HYU A;  4H4Q A;  4D04 A;  4JY2 A;  1LQU A;  1JU2 A;  1IUT A;  1BWC A;  3NYC A;  2VVL A;  3GWD A;  1CC4 A;  1VG9 A;  3SCE A;  3SXQ A;  4GRT A;  2IID A;  1H82 A;  3UTE A;  3LGQ A;  4DGK A;  1L9D A;  3NH3 X;  4H4W A;  2H88 A;  2ZBW A;  3BNM A;  1KSU A;  3AYL A;  1PN0 A;  1BF3 A;  4J31 A;  2TMD A;  5IQ4 A;  3I6D A;  3V3N A;  1PDH A;  4J56 A;  1OAH A;  4JQ9 A;  2RAB A;  3K30 A;  3ATR A;  4WCT A;  2BXR A;  2O9Z A;  3LJP A;  2BK4 A;  2Q6U A;  1PXC A;  4DSH A;  2OT4 A;  1EL5 A;  4H4U A;  2WQY A;  2J3N A;  3AEC A;  2NVK X;  1GT8 A;  3KU9 A;  2R4J A;  2FJB A;  3DJG X;  4A99 A;  4AT2 A;  2ZZ0 A;  4UDQ A;  2HQM A;  4L3Z A;  1DOD A;  1GXF A;  3NK2 X;  2WU5 A;  3Q6J A;  3COX A;  3DGZ A;  4OVI A;  3PS9 A;  1RP0 A;  1GRE A;  3NN6 X;  1NG3 A;  2VVL G;  4B1B A;  2IVD A;  4BK1 A;  2B9W A;  2XVF A;  2VRL A;  4FDC B;  2GR0 A;  2XLP A;  1ZDL A;  1F8S A;  3AEA A;  4ZCC A;  4B65 A;  4DNA A;  1GV4 A;  2B7R A;  1K0J A;  1GRB A;  2A89 A;  1E1K A;  3GWF A;  4H50 A;  1TDO A;  2XLU A;  1LPF A;  4X4J A;  4U8J A;  1YQ3 A;  1GPE A;  3GD4 A;  2BA9 A;  1L9E A;  2C73 A;  1D7L A;  1TDE A;  1KNR A;  3D1I A;  3UKH A;  3F8P A;  4A9W A;  4A7A A;  2WBA A;  2BAB A;  1IUS A;  1M6I A;  3H4K A;  5GSN A;  1D4C A;  1CJ4 A;  1GRG A;  1XDI A;  2PHH A;  4CCR A;  4DSG A;  2VRM A;  1Y0P A;  3JSK A;  4N9X A;  4CNK A;  4UDP A;  1GRA A;  3IHM A;  1ZKQ A;  2R4E A;  4LII A;  3UOY A;  4AP3 A;  5BRT A;  1Q1R A;  4EM4 A;  4H2N A;  2WET A;  2XDO A;  2NPX A;  3AD8 B;  4UP3 A;  3VR8 A;  5LV9 A;  4TLX A;  3URH A;  4FK1 C;  4K22 A;  1PBF A;  3GD3 A;  3V3O A;  3QFA A;  2GMJ A;  2WS3 A;  3RNM A;  3F29 A;  3WE0 A;  4AT0 A;  3QSE A;  1DXL A;  2GRT A;  2V6O A;  4Y4M A;  3NRN A;  1H7W A;  2B9X A;  3ICS A;  3T37 A;  1H6V A;  1Y56 B;  3K7M X;  3LXD A;  3ICR A;  3NIX A;  1B5Q A;  1PJ7 A;  2C3C A;  2JKC A;  3VR9 A;  1B4V A;  3MMO A;  1NHP A;  2Q0L A;  3UTH A;  3KKJ A;  3UKA A;  4APN A;  1K4Q A;  2WPF A;  4YT0 A;  2X8C A;  2BCP A;  3ALJ A;  1COY A;  4JN9 A;  4KX6 A;  3QSM A;  1JRY A;  1F8W A;  1D5T A;  3UCL A;  1CJC A;  2BYB A;  1M1Q A;  3AB1 A;  4A79 A;  5IQ1 A;  2E1M A;  2Y6R A;  2WHD A;  2XFO A;  3CTY A;  1EL9 A;  1FOH A;  1FT5 A;  1GU6 A;  2JB3 A;  4YSY A;  3KD9 A;  1ZMC A;  1Z6L A;  1TDK A;  3DK8 A;  3P4P A;  4H4Y A;  4Q17 A;  2EQ8 A;  3ISH A;  1E6E A;  2APG A;  1L0V A;  4H4V A;  3M0O A;  5KXJ A;  3BNJ A;  4D03 A;  2ARD A;  4YSX A;  2WDQ A;  4L3Y A;  1NEK A;  3GRS A;  4Z26 A;  4YSH A;  4U2L A;  2FJD A;  2V3B A;  4Z2U A;  1OJD A;  2IVE A;  1GRT A;  1EL8 A;  3HZL A;  4WX1 A;  3CGC A;  3NLC A;  4U8N A;  2V61 A;  2RF7 A;  3AE6 A;  3IC9 A;  1DNC A;  3H8L A;  3AEE A;  1DJN A;  1NPX A;  2WPC A;  2C67 A;  1X31 B;  1YQZ A;  2R0C A;  3F8D A;  5KVH A;  2C66 A;  5JCN A;  3DJD A;  1QDB A;  2VR0 A;  3F8R A;  3GMB A;  1KF6 A;  4OPI A;  2UZZ A;  4USQ A;  4E0V A;  5C2T A;  5M10 A;  3FG2 P;  3DME A;  1CC2 A;  3B6D A;  4A65 A;  4BJY A;  1K0I A;  1D4E A;  2ZZC A;  3EF6 A;  4C3X A;  2C72 A;  4YSZ A;  2ACZ A;  3O0H A;  3BHF A;  2ZO5 A;  3P9U A;  4JY3 A;  4AP1 A;  4H2P A;  2C64 A;  3LZX A;  2BC1 A;  3KVE A;  5HYM A;  2XYO A;  4NZH A;  3H8I A;  1PS9 A;  1LVL A;  4ICY A;  4YXD A;  3ATQ A;  3NYE A;  5HXI A;  3KA7 A;  2RDZ A;  4EQS A;  3AED A;  1FS8 A;  2AR8 A;  3GYJ A;  2VOU A;  3GYX A;  4TM4 A;  4H2R A;  1GES A;  4L38 A;  2FJA A;  2TPR A;  3E1T A;  2A87 A;  4BUR A;  4J36 A;  3V76 A;  1N4U A;  2WOW A;  2YR4 A;  5M0Z A;  3R9U A;  2RGH A;  4K5R A;  5GRT A;  4ADW A;  2GEW A;  1K0L A;  1EL7 A;  2XLS A;  3CND A;  1ZOY A;  3GMC A;  2J7A A;  1PBE A;  2BCG G;  1MO9 A;  1ZOV A;  3FMW A;  4B69 A;  2CUL A;  4O5U A;  2V60 A;  4NTC A;  1Q9I A;  1PJ6 A;  1PXB A;  2C65 A;  3ALL A;  3OC4 A;  4IA5 A;  4OPG A;  1B8S A;  2VZ2 A;  4GF7 A;  4Z2R A;  3LZW A;  2E81 A;  1GEU A;  1GER A;  1GND A;  4UDR A;  4XXG A;  1JRZ A;  4OCG A;  1NHR A;  2V5Z A;  2BK3 A;  1S2Y A;  1GRH A;  2FJE A;  2X99 A;  2Y6Q A; 
#chains in the Genus database with same CATH topology
 4RSL A;  1NG4 A;  2X50 A;  2RGJ A;  4X9N A;  1LQT A;  3VQR A;  2LFC A;  4I58 A;  1JOA A;  4Z2T A;  1FEA A;  3DH9 A;  1PHH A;  2CDU A;  1DOB A;  3OWM A;  2BC0 A;  1GTE A;  2XFN A;  2R0G A;  4U2S A;  3SFE A;  4Q0T A;  3TOR A;  2GAH B;  4YKF A;  1ZMD A;  4BK2 A;  1SEZ A;  4H4Z A;  4Z25 A;  2YG3 A;  4U8M A;  1ELI A;  1XPQ A;  2Q7V A;  3LB8 A;  2GAG B;  4FK1 A;  3AE3 A;  3K7Q X;  4YWO A;  2XLT A;  3BNU A;  4IVM B;  3GDN A;  4Y4N A;  1FEB A;  3UKL A;  4J57 A;  4B68 A;  3SZ0 A;  3GDP A;  4U8L A;  4YTM A;  1LJ1 A;  5BUL A;  2WP6 A;  2WPE A;  3CGB A;  4H2Q A;  3AE5 A;  1LV0 A;  1TRB A;  3CNS A;  4Z24 A;  1GSN A;  3FPZ A;  4EMJ A;  5IPY A;  1ZP0 A;  2BS2 A;  3EPT A;  3DGH A;  2YLS A;  3KPK A;  1GRF A;  1S3E A;  1NDA A;  3AYI A;  2BRA A;  1MXT A;  5FS6 A;  2AQJ A;  1ZX9 A;  2E80 A;  1CJ2 A;  1PXA A;  3BI5 A;  3D1C A;  2QAE A;  4U8I A;  3S5W A;  4Q1O A;  3UP5 A;  2XCG A;  4BK3 A;  4CBQ A;  2E4G A;  3SGL A;  4TLZ A;  5EB4 A;  3SYI A;  1VQW A;  4XWZ A;  3AEB A;  2YLR A;  1D4D A;  1V59 A;  2C70 A;  2GQF A;  3AE2 A;  1D7Y A;  4A6N A;  3UBR A;  2GR1 A;  4GAP A;  3DK9 A;  4H4P A;  2XVE A;  3BI2 A;  4REK A;  3SXI A;  2C7G A;  3P1W A;  2WU2 A;  3AEF A;  1BGJ A;  3GRT A;  2OA1 A;  4NTE A;  2OLN A;  3RKH A;  3NGC X;  2XVJ A;  3CPI G;  1TYP A;  1PBC A;  3AEG A;  4EQW A;  5U63 A;  2WEU A;  1JNI A;  4U8P A;  4OPT A;  2YLT A;  4K7Z A;  1H83 A;  3NTD A;  4J2W A;  2JB1 A;  2YM1 A;  4MJW A;  2XLR A;  4G9K A;  4EQR A;  2WES A;  4M52 A;  4OPU A;  4G6G A;  2CFY A;  3PVC A;  4H4S A;  4H4X A;  4USR A;  2E5V A;  1H84 A;  1NAA A;  2K3V A;  1BZL A;  2CVJ A;  1OJC A;  4JDR A;  2XVH A;  2YAU A;  3C4N A;  4EMW A;  1CJ3 A;  1YQ4 A;  3KLJ A;  5JCL A;  3RP7 A;  4H4R A;  3GSI A;  3G5R A;  3S61 A;  3NNE A;  2QA2 A;  3BI4 A;  1Q1W A;  1RSG A;  3I3L A;  3LAD A;  3T2Z A;  1KNP A;  3NK0 X;  3ADA B;  1VRQ B;  2YLX A;  2YQU A;  4OPC A;  5JCM A;  3OZ2 A;  3RED A;  2YWL A;  4EIQ A;  5KRQ A;  4EMI A;  4NEW A;  3CNP A;  2WOI A;  3NT6 A;  4GDP A;  3NYF A;  4IV9 A;  3AD9 B;  4C5O A;  5CKU A;  2C3D A;  3IF9 A;  1FT6 A;  2PYX A;  3L8K A;  2YLZ A;  2R45 A;  3B3R A;  3AE4 A;  3CN8 A;  4B67 A;  4CCQ A;  1TDN A;  3EAO A;  2WDR A;  2XFU A;  2GQW A;  1OJT A;  5FS9 A;  4TM3 A;  3L1T A;  3VRD B;  3SZF A;  5L46 A;  1KFY A;  1DOC A;  3NHO X;  3KPF A;  4X9M A;  3UKF A;  1NEN A;  2EQ9 A;  3BHK A;  1NHQ A;  2Q0K A;  4J34 A;  5CQF A;  1OJA A;  2GMH A;  3FBS A;  3FIM B;  1S3B A;  4HB9 A;  5HY5 A;  3CIR A;  5U1O A;  1E1M A;  4ECH A;  1N4V A;  4GR1 A;  3UP4 A;  3UKP A;  4G73 A;  2X8G A;  2YLW A;  3NN0 X;  1IUX A;  3L1R A;  5KOX A;  2B9Y A;  4G74 A;  4Z44 A;  1EBD A;  1ONF A;  3AD7 B;  1OJ9 A;  4Y4L A;  2YG4 A;  1F8R A;  4RG4 A;  3D8X A;  4II2 A;  2EQ7 A;  5KOW A;  4AOS A;  3HYW A;  4IA6 A;  4K2X A;  3AYJ A;  1UKV G;  1BVB A;  4GDE A;  3S7W A;  1W4X A;  1NHS A;  3CGD A;  3UOV A;  4NTD A;  5EB5 A;  1N1P A;  1F3P A;  3ITJ A;  3VRA A;  1FCD A;  2GV8 A;  3SQP A;  1N4W A;  4NEV A;  2YR6 A;  2BXS A;  4CNJ A;  5J7X A;  3AE8 A;  3ABV A;  1E1L A;  4Q4U A;  1GAL A;  1H7X A;  3DJJ A;  4P9S A;  2WDV A;  4TM0 A;  5EBK A;  3SFD A;  3UOX A;  4B66 A;  3AE7 A;  3CNT A;  2GF3 A;  3DJE A;  2Z5X A;  4NWZ A;  3C96 A;  2OAL A;  3DA1 A;  3AXB A;  3BNH A;  1REO A;  1P2E A;  3G5Q A;  3NG7 X;  4I59 A;  4L3X A;  3NKS A;  1O5W A;  1M64 A;  4CRT A;  5JCK A;  5EOW A;  2GR2 A;  5FS7 A;  3IHG A;  3P4Q A;  3FO3 A;  2BS4 A;  2JBV A;  2YVG A;  5KMS A;  1JEH A;  4O5Q A;  4FX9 A;  4JNA A;  2VQ7 A;  1GET A;  3NK1 X;  3UOZ A;  1XAN A;  1QO8 A;  1B37 A;  2C76 A;  1CBO A;  2OAM A;  3C4A A;  3T2K A;  3G5S A;  1PJ5 A;  2CZS A;  3RHA A;  4GUV A;  4CY6 A;  1IUU A;  4C3Y A;  1FL2 A;  1CL0 A;  3UKQ A;  5FMH A;  3VRB A;  2QCU A;  2R9Z A;  1O95 A;  1Y56 A;  2VVM A;  3QFB A;  2WP5 A;  1YKJ A;  3K7T A;  2YVF A;  4H7U A;  2B7S A;  2F5Z A;  3QSS A;  5HHF A;  4BJZ A;  4H4T A;  4OPD A;  5U25 A;  1VDC A;  4PAB A;  4II3 A;  3UTF A;  1JNR A;  5J60 A;  3BNF A;  1CHU A;  5KWF A;  1KSS A;  1DJQ A;  2X3N A;  3UU9 A;  2DKI A;  3RP8 A;  5DBJ A;  2YG5 A;  4YTN A;  1O94 A;  4B64 A;  2I0Z A;  5C3J A;  1AOG A;  2BS3 A;  2WP9 A;  1E7P A;  1QJD A;  2VQB A;  3BNG A;  4YKG A;  3QVR A;  1JRX A;  2YG6 A;  3CNJ A;  3M13 A;  2YM2 A;  2B76 A;  3P4S A;  2XFQ A;  3UKK A;  2C75 A;  3GYI A;  4J33 A;  1JNZ A;  1FS9 A;  2A8X A;  3AE1 A;  4ZCD A;  5FS8 A;  2GVC A;  1MOK A;  4EQX A;  1IJH A;  2WOV A;  2GH5 A;  4LU6 A;  3QJ4 A;  1FEC A;  1DOE A;  2X8H A;  2W0H A;  3P4R A;  1H81 A;  2R46 A;  3SM8 A;  1TDF A;  3M12 A;  3LG1 A;  2BK5 A;  4IVO B;  4OPL A;  4Q5C A;  3PO7 A;  4A6N B;  2BAC A;  3CPH G;  2R0P A;  4PAA A;  4A5L A;  5KNL A;  4TM1 A;  3II4 A;  1BKW A;  3NTA A;  5JCI A;  3GM6 A;  1VG0 A;  4B63 A;  4C77 A;  2JB2 A;  4EM3 A;  5BVA A;  2AAQ A;  2XVI A;  4K8D A;  1PBB A;  1SP3 A;  1QLB A;  3AWI A;  3EAN A;  1GTH A;  5BUK A;  3T31 A;  2YVJ A;  1XHC A;  1LTX R;  2JAE A;  4EIP A;  3ICT A;  4K5S A;  1TYT A;  1L9C A;  5TR3 A;  1CF3 A;  2BRY A;  3Q9T A;  2V3A A;  4C74 A;  1IUV A;  1H86 A;  1E39 A;  4U8K A;  4AOX A;  1ZY8 A;  4WJY A;  1S2Q A;  3CPJ G;  2YG7 A;  3T14 A;  4GAV A;  2GR3 A;  2OLO A;  4KPR A;  3ZYX A;  4ZN0 A;  1PBD A;  1YY5 A;  2EQ6 A;  1F6M A;  4U8O A;  4CY8 A;  1CC6 A;  2H89 A;  4LA1 A;  2FBW A;  1IUW A;  2XFP A;  2Z5Y A;  4XWR A;  1E1N A;  3RP6 A;  3SZW A;  3ZDN A;  1P2H A;  4U2T A;  1GOS A;  4YTP A;  3ALM A;  3UTG A;  5KMP A;  2RGO A;  4Z43 A;  2YR5 A;  1FS7 A;  3AE9 A;  1M1P A;  1M1R A;  1RYI A;  2GB0 A;  4JNQ A;  1ZK7 A;  2DKH A;  3HYV A;  2JK6 A;  1BGN A;  3IWA A;  3CGE A;  5KVI A;  3DK4 A;  4BV6 A;  1KDG A;  2QA1 A;  3QVP A;  4HA6 A;  4RG3 A;  5ER0 A;  4Q5B A;  2ZZB A;  3LOV A;  4GCM A;  3TTB A;  1HYU A;  4H4Q A;  4D04 A;  4JY2 A;  1LQU A;  1JU2 A;  1IUT A;  1BWC A;  3NYC A;  2VVL A;  3GWD A;  1CC4 A;  1VG9 A;  3SCE A;  3SXQ A;  4GRT A;  2IID A;  1H82 A;  3UTE A;  3LGQ A;  4DGK A;  1L9D A;  3NH3 X;  4H4W A;  2H88 A;  2ZBW A;  3BNM A;  1KSU A;  3AYL A;  1PN0 A;  1BF3 A;  4J31 A;  2TMD A;  5IQ4 A;  3I6D A;  3V3N A;  1PDH A;  4J56 A;  1OAH A;  4JQ9 A;  2RAB A;  3K30 A;  3ATR A;  4WCT A;  2BXR A;  2O9Z A;  3LJP A;  2BK4 A;  2Q6U A;  1PXC A;  4DSH A;  2OT4 A;  1EL5 A;  4H4U A;  2WQY A;  2J3N A;  3AEC A;  2NVK X;  1GT8 A;  3KU9 A;  2R4J A;  2FJB A;  3DJG X;  4A99 A;  4AT2 A;  2ZZ0 A;  4UDQ A;  2HQM A;  4L3Z A;  1DOD A;  1GXF A;  3NK2 X;  2WU5 A;  3Q6J A;  3COX A;  3DGZ A;  4OVI A;  3PS9 A;  1RP0 A;  1GRE A;  3HYX A;  3NN6 X;  1NG3 A;  2VVL G;  4B1B A;  2IVD A;  4BK1 A;  2B9W A;  2XVF A;  2VRL A;  4FDC B;  2GR0 A;  2XLP A;  1ZDL A;  1F8S A;  3AEA A;  4ZCC A;  4B65 A;  4DNA A;  1GV4 A;  2B7R A;  1K0J A;  1GRB A;  2A89 A;  1E1K A;  3GWF A;  4H50 A;  1TDO A;  2XLU A;  1LPF A;  4X4J A;  4U8J A;  1YQ3 A;  1GPE A;  3GD4 A;  2BA9 A;  1L9E A;  2C73 A;  1D7L A;  1TDE A;  1KNR A;  3D1I A;  3UKH A;  3F8P A;  5KMQ A;  4A9W A;  4A7A A;  2WBA A;  2BAB A;  1IUS A;  1M6I A;  3H4K A;  5GSN A;  1D4C A;  1CJ4 A;  1GRG A;  1XDI A;  2PHH A;  4CCR A;  4DSG A;  2VRM A;  1Y0P A;  3JSK A;  4N9X A;  4CNK A;  4UDP A;  1GRA A;  3IHM A;  1ZKQ A;  2R4E A;  4LII A;  3UOY A;  4AP3 A;  5BRT A;  1Q1R A;  4EM4 A;  4H2N A;  4G6H A;  2WET A;  2XDO A;  2NPX A;  3AD8 B;  4UP3 A;  3VR8 A;  5LV9 A;  4TLX A;  3URH A;  4FK1 C;  4K22 A;  1PBF A;  3GD3 A;  3V3O A;  3QFA A;  2GMJ A;  2WS3 A;  3RNM A;  3F29 A;  3WE0 A;  4AT0 A;  3QSE A;  1DXL A;  2GRT A;  2V6O A;  4Y4M A;  3NRN A;  3SY4 A;  3SZC A;  1H7W A;  2B9X A;  3ICS A;  3T37 A;  1H6V A;  1Y56 B;  3K7M X;  3LXD A;  3ICR A;  3NIX A;  1B5Q A;  1PJ7 A;  2C3C A;  2JKC A;  3VR9 A;  1B4V A;  3MMO A;  1NHP A;  2Q0L A;  3UTH A;  3KKJ A;  3UKA A;  4APN A;  1K4Q A;  2WPF A;  4YT0 A;  2X8C A;  2BCP A;  3ALJ A;  1COY A;  4JN9 A;  4KX6 A;  3QSM A;  1JRY A;  1F8W A;  1D5T A;  4NNJ A;  3UCL A;  1CJC A;  2BYB A;  1M1Q A;  3AB1 A;  4A79 A;  5IQ1 A;  2E1M A;  2Y6R A;  2WHD A;  2XFO A;  3CTY A;  1EL9 A;  1FOH A;  1FT5 A;  1GU6 A;  2JB3 A;  4YSY A;  3KD9 A;  1ZMC A;  1Z6L A;  1TDK A;  3DK8 A;  3P4P A;  4H4Y A;  4Q17 A;  2EQ8 A;  3ISH A;  1E6E A;  2APG A;  1L0V A;  4H4V A;  3M0O A;  5KXJ A;  3BNJ A;  4D03 A;  2ARD A;  4YSX A;  2WDQ A;  4L3Y A;  1NEK A;  3GRS A;  4Z26 A;  4YSH A;  4U2L A;  2FJD A;  2V3B A;  4Z2U A;  1OJD A;  2IVE A;  1GRT A;  1EL8 A;  3HZL A;  4WX1 A;  3CGC A;  3NLC A;  4U8N A;  2V61 A;  2RF7 A;  3AE6 A;  3IC9 A;  1DNC A;  3H8L A;  3AEE A;  1DJN A;  1NPX A;  5KMR A;  2WPC A;  2C67 A;  1X31 B;  1YQZ A;  2R0C A;  3T2Y A;  3F8D A;  5KVH A;  2C66 A;  5JCN A;  3DJD A;  1QDB A;  2VR0 A;  3F8R A;  3GMB A;  1KF6 A;  4OPI A;  2UZZ A;  4USQ A;  4E0V A;  5C2T A;  5M10 A;  3FG2 P;  3DME A;  3T0K A;  1CC2 A;  3B6D A;  4A65 A;  4BJY A;  1K0I A;  1D4E A;  2ZZC A;  3EF6 A;  4C3X A;  2C72 A;  4YSZ A;  2ACZ A;  3O0H A;  3BHF A;  2ZO5 A;  3P9U A;  4JY3 A;  4AP1 A;  4H2P A;  2C64 A;  3LZX A;  2BC1 A;  3KVE A;  5HYM A;  2XYO A;  4NZH A;  3H8I A;  1PS9 A;  1LVL A;  4ICY A;  4YXD A;  3ATQ A;  3NYE A;  5HXI A;  3CMM A;  2RDZ A;  3KA7 A;  3AED A;  1FS8 A;  2AR8 A;  3GYJ A;  4EQS A;  2VOU A;  3GYX A;  4TM4 A;  4H2R A;  1GES A;  4L38 A;  2FJA A;  2TPR A;  3E1T A;  2A87 A;  4BUR A;  4J36 A;  3V76 A;  1N4U A;  2WOW A;  2YR4 A;  5M0Z A;  3R9U A;  2RGH A;  4K5R A;  5GRT A;  4ADW A;  2GEW A;  1K0L A;  1EL7 A;  2XLS A;  3CND A;  1ZOY A;  3GMC A;  2J7A A;  1PBE A;  2BCG G;  1MO9 A;  1ZOV A;  2C4C A;  3FMW A;  4B69 A;  2CUL A;  4O5U A;  2V60 A;  4NTC A;  1Q9I A;  1PJ6 A;  1PXB A;  2C65 A;  3ALL A;  3OC4 A;  4IA5 A;  4OPG A;  1B8S A;  2VZ2 A;  4GF7 A;  4Z2R A;  3LZW A;  2E81 A;  1GEU A;  1GER A;  1GND A;  4UDR A;  4XXG A;  1JRZ A;  4OCG A;  1NHR A;  2V5Z A;  2BK3 A;  1S2Y A;  1GRH A;  2FJE A;  3SX6 A;  2X99 A;  2Y6Q A; 
#chains in the Genus database with same CATH homology
 4RSL A;  1NG4 A;  2X50 A;  2RGJ A;  4X9N A;  1LQT A;  3VQR A;  2LFC A;  4I58 A;  1JOA A;  4Z2T A;  1FEA A;  3DH9 A;  1PHH A;  2CDU A;  1DOB A;  3OWM A;  2BC0 A;  1GTE A;  2XFN A;  2R0G A;  4U2S A;  3SFE A;  4Q0T A;  3TOR A;  2GAH B;  4YKF A;  1ZMD A;  4BK2 A;  1SEZ A;  4H4Z A;  4Z25 A;  2YG3 A;  4U8M A;  1ELI A;  1XPQ A;  2Q7V A;  3LB8 A;  2GAG B;  4FK1 A;  3AE3 A;  3K7Q X;  4YWO A;  2XLT A;  3BNU A;  4IVM B;  3GDN A;  4Y4N A;  1FEB A;  3UKL A;  4J57 A;  4B68 A;  3SZ0 A;  3GDP A;  4U8L A;  4YTM A;  1LJ1 A;  5BUL A;  2WP6 A;  2WPE A;  3CGB A;  4H2Q A;  3AE5 A;  1LV0 A;  1TRB A;  3CNS A;  4Z24 A;  1GSN A;  3FPZ A;  4EMJ A;  5IPY A;  1ZP0 A;  2BS2 A;  3EPT A;  3DGH A;  2YLS A;  3KPK A;  1GRF A;  1S3E A;  1NDA A;  3AYI A;  2BRA A;  1MXT A;  5FS6 A;  2AQJ A;  1ZX9 A;  2E80 A;  1CJ2 A;  1PXA A;  3BI5 A;  3D1C A;  2QAE A;  4U8I A;  3S5W A;  4Q1O A;  3UP5 A;  2XCG A;  4BK3 A;  4CBQ A;  2E4G A;  3SGL A;  4TLZ A;  5EB4 A;  3SYI A;  1VQW A;  4XWZ A;  3AEB A;  2YLR A;  1D4D A;  1V59 A;  2C70 A;  2GQF A;  3AE2 A;  1D7Y A;  4A6N A;  3UBR A;  2GR1 A;  4GAP A;  3DK9 A;  4H4P A;  2XVE A;  3BI2 A;  4REK A;  3SXI A;  2C7G A;  3P1W A;  2WU2 A;  3AEF A;  1BGJ A;  3GRT A;  2OA1 A;  4NTE A;  2OLN A;  3RKH A;  3NGC X;  2XVJ A;  3CPI G;  1TYP A;  1PBC A;  3AEG A;  4EQW A;  5U63 A;  2WEU A;  1JNI A;  4U8P A;  4OPT A;  2YLT A;  4K7Z A;  1H83 A;  3NTD A;  4J2W A;  2JB1 A;  2YM1 A;  4MJW A;  2XLR A;  4G9K A;  4EQR A;  2WES A;  4M52 A;  4OPU A;  4G6G A;  2CFY A;  3PVC A;  4H4S A;  4H4X A;  4USR A;  2E5V A;  1H84 A;  1NAA A;  2K3V A;  1BZL A;  2CVJ A;  1OJC A;  4JDR A;  2XVH A;  2YAU A;  3C4N A;  4EMW A;  1CJ3 A;  1YQ4 A;  3KLJ A;  5JCL A;  3RP7 A;  4H4R A;  3GSI A;  3G5R A;  3S61 A;  3NNE A;  2QA2 A;  3BI4 A;  1Q1W A;  1RSG A;  3I3L A;  3LAD A;  3T2Z A;  1KNP A;  3NK0 X;  3ADA B;  1VRQ B;  2YLX A;  2YQU A;  4OPC A;  5JCM A;  3OZ2 A;  3RED A;  2YWL A;  4EIQ A;  5KRQ A;  4EMI A;  4NEW A;  3CNP A;  2WOI A;  3NT6 A;  4GDP A;  3NYF A;  4IV9 A;  3AD9 B;  4C5O A;  5CKU A;  2C3D A;  3IF9 A;  1FT6 A;  2PYX A;  3L8K A;  2YLZ A;  2R45 A;  3B3R A;  3AE4 A;  3CN8 A;  4B67 A;  4CCQ A;  1TDN A;  3EAO A;  2WDR A;  2XFU A;  2GQW A;  1OJT A;  5FS9 A;  4TM3 A;  3L1T A;  3VRD B;  3SZF A;  5L46 A;  1KFY A;  1DOC A;  3NHO X;  3KPF A;  4X9M A;  3UKF A;  1NEN A;  2EQ9 A;  3BHK A;  1NHQ A;  2Q0K A;  4J34 A;  5CQF A;  1OJA A;  2GMH A;  3FBS A;  3FIM B;  1S3B A;  4HB9 A;  5HY5 A;  3CIR A;  5U1O A;  1E1M A;  4ECH A;  1N4V A;  4GR1 A;  3UP4 A;  3UKP A;  4G73 A;  2X8G A;  2YLW A;  3NN0 X;  1IUX A;  3L1R A;  5KOX A;  2B9Y A;  4G74 A;  4Z44 A;  1EBD A;  1ONF A;  3AD7 B;  1OJ9 A;  4Y4L A;  2YG4 A;  1F8R A;  4RG4 A;  3D8X A;  4II2 A;  2EQ7 A;  5KOW A;  4AOS A;  3HYW A;  4IA6 A;  4K2X A;  3AYJ A;  1UKV G;  1BVB A;  4GDE A;  3S7W A;  1W4X A;  1NHS A;  3CGD A;  3UOV A;  4NTD A;  5EB5 A;  1N1P A;  1F3P A;  3ITJ A;  3VRA A;  1FCD A;  2GV8 A;  3SQP A;  1N4W A;  4NEV A;  2YR6 A;  2BXS A;  4CNJ A;  5J7X A;  3AE8 A;  3ABV A;  1E1L A;  4Q4U A;  1GAL A;  1H7X A;  3DJJ A;  4P9S A;  2WDV A;  4TM0 A;  5EBK A;  3SFD A;  3UOX A;  4B66 A;  3AE7 A;  3CNT A;  2GF3 A;  3DJE A;  2Z5X A;  4NWZ A;  3C96 A;  2OAL A;  3DA1 A;  3AXB A;  3BNH A;  1REO A;  1P2E A;  3G5Q A;  3NG7 X;  4I59 A;  4L3X A;  3NKS A;  1O5W A;  1M64 A;  4CRT A;  5JCK A;  5EOW A;  2GR2 A;  5FS7 A;  3IHG A;  3P4Q A;  3FO3 A;  2BS4 A;  2JBV A;  2YVG A;  5KMS A;  1JEH A;  4O5Q A;  4FX9 A;  4JNA A;  2VQ7 A;  1GET A;  3NK1 X;  3UOZ A;  1XAN A;  1QO8 A;  1B37 A;  2C76 A;  1CBO A;  2OAM A;  3C4A A;  3T2K A;  3G5S A;  1PJ5 A;  3RHA A;  4GUV A;  4CY6 A;  1IUU A;  4C3Y A;  1FL2 A;  1CL0 A;  3UKQ A;  5FMH A;  3VRB A;  2QCU A;  2R9Z A;  1O95 A;  1Y56 A;  2VVM A;  3QFB A;  2WP5 A;  1YKJ A;  3K7T A;  2YVF A;  4H7U A;  2B7S A;  2F5Z A;  3QSS A;  5HHF A;  4BJZ A;  4H4T A;  4OPD A;  5U25 A;  1VDC A;  4PAB A;  4II3 A;  3UTF A;  1JNR A;  5J60 A;  3BNF A;  1CHU A;  5KWF A;  1KSS A;  1DJQ A;  2X3N A;  3UU9 A;  2DKI A;  3RP8 A;  5DBJ A;  2YG5 A;  4YTN A;  1O94 A;  4B64 A;  2I0Z A;  5C3J A;  1AOG A;  2BS3 A;  2WP9 A;  1E7P A;  1QJD A;  2VQB A;  3BNG A;  4YKG A;  3QVR A;  1JRX A;  2YG6 A;  3CNJ A;  3M13 A;  2YM2 A;  2B76 A;  3P4S A;  2XFQ A;  3UKK A;  2C75 A;  3GYI A;  4J33 A;  1JNZ A;  1FS9 A;  2A8X A;  3AE1 A;  4ZCD A;  5FS8 A;  2GVC A;  1MOK A;  4EQX A;  1IJH A;  2WOV A;  2GH5 A;  4LU6 A;  3QJ4 A;  1FEC A;  1DOE A;  2X8H A;  2W0H A;  3P4R A;  1H81 A;  2R46 A;  3SM8 A;  1TDF A;  3M12 A;  3LG1 A;  2BK5 A;  4IVO B;  4OPL A;  4Q5C A;  3PO7 A;  4A6N B;  2BAC A;  3CPH G;  2R0P A;  4PAA A;  4A5L A;  5KNL A;  4TM1 A;  3II4 A;  1BKW A;  3NTA A;  5JCI A;  3GM6 A;  1VG0 A;  4B63 A;  4C77 A;  2JB2 A;  4EM3 A;  5BVA A;  2AAQ A;  2XVI A;  4K8D A;  1PBB A;  1SP3 A;  1QLB A;  3AWI A;  3EAN A;  1GTH A;  5BUK A;  3T31 A;  2YVJ A;  1XHC A;  1LTX R;  2JAE A;  4EIP A;  3ICT A;  4K5S A;  1TYT A;  1L9C A;  5TR3 A;  1CF3 A;  2BRY A;  3Q9T A;  2V3A A;  4C74 A;  1IUV A;  1H86 A;  1E39 A;  4U8K A;  4AOX A;  1ZY8 A;  4WJY A;  1S2Q A;  3CPJ G;  2YG7 A;  3T14 A;  4GAV A;  2GR3 A;  2OLO A;  4KPR A;  3ZYX A;  4ZN0 A;  1PBD A;  1YY5 A;  2EQ6 A;  1F6M A;  4U8O A;  4CY8 A;  1CC6 A;  2H89 A;  4LA1 A;  2FBW A;  1IUW A;  2XFP A;  2Z5Y A;  4XWR A;  1E1N A;  3RP6 A;  3SZW A;  3ZDN A;  1P2H A;  4U2T A;  1GOS A;  4YTP A;  3ALM A;  3UTG A;  5KMP A;  2RGO A;  4Z43 A;  2YR5 A;  1FS7 A;  3AE9 A;  1M1P A;  1M1R A;  1RYI A;  2GB0 A;  4JNQ A;  1ZK7 A;  2DKH A;  3HYV A;  2JK6 A;  1BGN A;  3IWA A;  3CGE A;  5KVI A;  3DK4 A;  4BV6 A;  1KDG A;  2QA1 A;  3QVP A;  4HA6 A;  4RG3 A;  5ER0 A;  4Q5B A;  2ZZB A;  3LOV A;  4GCM A;  3TTB A;  1HYU A;  4H4Q A;  4D04 A;  4JY2 A;  1LQU A;  1JU2 A;  1IUT A;  1BWC A;  3NYC A;  2VVL A;  3GWD A;  1CC4 A;  1VG9 A;  3SCE A;  3SXQ A;  4GRT A;  2IID A;  1H82 A;  3UTE A;  3LGQ A;  4DGK A;  1L9D A;  3NH3 X;  4H4W A;  2H88 A;  2ZBW A;  3BNM A;  1KSU A;  3AYL A;  1PN0 A;  1BF3 A;  4J31 A;  2TMD A;  5IQ4 A;  3I6D A;  3V3N A;  1PDH A;  4J56 A;  1OAH A;  4JQ9 A;  2RAB A;  3K30 A;  3ATR A;  4WCT A;  2BXR A;  2O9Z A;  3LJP A;  2BK4 A;  2Q6U A;  1PXC A;  4DSH A;  2OT4 A;  1EL5 A;  4H4U A;  2WQY A;  2J3N A;  3AEC A;  2NVK X;  1GT8 A;  3KU9 A;  2R4J A;  2FJB A;  3DJG X;  4A99 A;  4AT2 A;  2ZZ0 A;  4UDQ A;  2HQM A;  4L3Z A;  1DOD A;  1GXF A;  3NK2 X;  2WU5 A;  3Q6J A;  3COX A;  3DGZ A;  4OVI A;  3PS9 A;  1RP0 A;  1GRE A;  3HYX A;  3NN6 X;  1NG3 A;  2VVL G;  4B1B A;  2IVD A;  4BK1 A;  2B9W A;  2XVF A;  2VRL A;  4FDC B;  2GR0 A;  2XLP A;  1ZDL A;  1F8S A;  3AEA A;  4ZCC A;  4B65 A;  4DNA A;  1GV4 A;  2B7R A;  1K0J A;  1GRB A;  2A89 A;  1E1K A;  3GWF A;  4H50 A;  1TDO A;  2XLU A;  1LPF A;  4X4J A;  4U8J A;  1YQ3 A;  1GPE A;  3GD4 A;  2BA9 A;  1L9E A;  2C73 A;  1D7L A;  1TDE A;  1KNR A;  3D1I A;  3UKH A;  3F8P A;  5KMQ A;  4A9W A;  4A7A A;  2WBA A;  2BAB A;  1IUS A;  1M6I A;  3H4K A;  5GSN A;  1D4C A;  1CJ4 A;  1GRG A;  1XDI A;  2PHH A;  4CCR A;  4DSG A;  2VRM A;  1Y0P A;  3JSK A;  4N9X A;  4CNK A;  4UDP A;  1GRA A;  3IHM A;  1ZKQ A;  2R4E A;  4LII A;  3UOY A;  4AP3 A;  5BRT A;  1Q1R A;  4EM4 A;  4H2N A;  4G6H A;  2WET A;  2XDO A;  2NPX A;  3AD8 B;  4UP3 A;  3VR8 A;  5LV9 A;  4TLX A;  3URH A;  4FK1 C;  4K22 A;  1PBF A;  3GD3 A;  3V3O A;  3QFA A;  2GMJ A;  2WS3 A;  3RNM A;  3F29 A;  3WE0 A;  4AT0 A;  3QSE A;  1DXL A;  2GRT A;  2V6O A;  4Y4M A;  3NRN A;  3SY4 A;  3SZC A;  1H7W A;  2B9X A;  3ICS A;  3T37 A;  1H6V A;  1Y56 B;  3K7M X;  3LXD A;  3ICR A;  3NIX A;  1B5Q A;  1PJ7 A;  2C3C A;  2JKC A;  3VR9 A;  1B4V A;  3MMO A;  1NHP A;  2Q0L A;  3UTH A;  3KKJ A;  3UKA A;  4APN A;  1K4Q A;  2WPF A;  4YT0 A;  2X8C A;  2BCP A;  3ALJ A;  1COY A;  4JN9 A;  4KX6 A;  3QSM A;  1JRY A;  1F8W A;  1D5T A;  4NNJ A;  3UCL A;  1CJC A;  2BYB A;  1M1Q A;  3AB1 A;  4A79 A;  5IQ1 A;  2E1M A;  2Y6R A;  2WHD A;  2XFO A;  3CTY A;  1EL9 A;  1FOH A;  1FT5 A;  1GU6 A;  2JB3 A;  4YSY A;  3KD9 A;  1ZMC A;  1Z6L A;  1TDK A;  3DK8 A;  3P4P A;  4H4Y A;  4Q17 A;  2EQ8 A;  3ISH A;  1E6E A;  2APG A;  1L0V A;  4H4V A;  3M0O A;  5KXJ A;  3BNJ A;  4D03 A;  2ARD A;  4YSX A;  2WDQ A;  4L3Y A;  1NEK A;  3GRS A;  4Z26 A;  4YSH A;  4U2L A;  2FJD A;  2V3B A;  4Z2U A;  1OJD A;  2IVE A;  1GRT A;  1EL8 A;  3HZL A;  4WX1 A;  3CGC A;  3NLC A;  4U8N A;  2V61 A;  2RF7 A;  3AE6 A;  3IC9 A;  1DNC A;  3H8L A;  3AEE A;  1DJN A;  1NPX A;  5KMR A;  2WPC A;  2C67 A;  1X31 B;  1YQZ A;  2R0C A;  3T2Y A;  3F8D A;  5KVH A;  2C66 A;  5JCN A;  3DJD A;  1QDB A;  2VR0 A;  3F8R A;  3GMB A;  1KF6 A;  4OPI A;  2UZZ A;  4USQ A;  4E0V A;  5C2T A;  5M10 A;  3FG2 P;  3DME A;  3T0K A;  1CC2 A;  3B6D A;  4A65 A;  4BJY A;  1K0I A;  1D4E A;  2ZZC A;  3EF6 A;  4C3X A;  2C72 A;  4YSZ A;  2ACZ A;  3O0H A;  3BHF A;  2ZO5 A;  3P9U A;  4JY3 A;  4AP1 A;  4H2P A;  2C64 A;  3LZX A;  2BC1 A;  3KVE A;  5HYM A;  2XYO A;  4NZH A;  3H8I A;  1PS9 A;  1LVL A;  4ICY A;  4YXD A;  3ATQ A;  3NYE A;  5HXI A;  3CMM A;  2RDZ A;  3KA7 A;  3AED A;  1FS8 A;  2AR8 A;  3GYJ A;  4EQS A;  2VOU A;  3GYX A;  4TM4 A;  4H2R A;  1GES A;  4L38 A;  2FJA A;  2TPR A;  3E1T A;  2A87 A;  4BUR A;  4J36 A;  3V76 A;  1N4U A;  2WOW A;  2YR4 A;  5M0Z A;  3R9U A;  2RGH A;  4K5R A;  5GRT A;  4ADW A;  2GEW A;  1K0L A;  1EL7 A;  2XLS A;  3CND A;  1ZOY A;  3GMC A;  2J7A A;  1PBE A;  2BCG G;  1MO9 A;  1ZOV A;  2C4C A;  3FMW A;  4B69 A;  2CUL A;  4O5U A;  2V60 A;  4NTC A;  1Q9I A;  1PJ6 A;  1PXB A;  2C65 A;  3ALL A;  3OC4 A;  4IA5 A;  4OPG A;  1B8S A;  2VZ2 A;  4GF7 A;  4Z2R A;  3LZW A;  2E81 A;  1GEU A;  1GER A;  1GND A;  4UDR A;  4XXG A;  1JRZ A;  4OCG A;  1NHR A;  2V5Z A;  2BK3 A;  1S2Y A;  1GRH A;  2FJE A;  3SX6 A;  2X99 A;  2Y6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...