1JRZA

Crystal structure of arg402tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTYDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C
publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 194
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrzA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrzA01
5LV9A 4Z2RA 2X8CA 5DBJA 2XLUA 1VDCA 2QAEA 3LZXA 2GAGB 1D7LA 2XFPA 1XDIA 4H4VA 4CY6A 1PJ6A 4H50A 1F6MA 2WS3A 3NG7X 3B6DA 1M6IA 2B9YA 4H4RA 4XWRA 2R4EA 2C67A 2RABA 2E81A 2X99A 3GMBA 4XXGA 4EIQA 3L1TA 3SCEA 2WP5A 2IVDA 1CJCA 2YM1A 3ITJA 2V61A 3UOYA 4OPCA 2Q0KA 4LA1A 4J33A 1KDGA 3ABVA 2WQYA 3QSEA 4DSHA 1TRBA 4Z43A 4K22A 1F8RA 2UZZA 1BGJA 1DOEA 1KF6A 3DJJA 3I3LA 1PBEA 2FJDA 3VRDB 2A87A 1D4EA 2GB0A 1D5TA 3LB8A 3AXBA 4A7AA 5HYMA 3P4QA 1HYUA 5BUKA 4J34A 2VRMA 3FG2P 1O95A 3G5QA 1FT6A 1PBBA 4U8LA 1V59A 3NK0X 2C70A 1B4VA 1EL5A 2E5VA 2YVGA 3UKAA 1NHQA 1NENA 3KA7A 4YKGA 4J56A 4IA6A 4J31A 3LOVA 1H81A 3ALJA 2YG4A 4YTNA 1JRZA 3KU9A 1D4CA 3DH9A 4EMJA 3NH3X 2GQWA 2YLWA 2Z5XA 1GRHA 3NIXA 4O5UA 2IVEA 2BC0A 3C4NA 2YWLA 3UOZA 1VQWA 2C73A 4H4TA 1CC4A 3O0HA 1COYA 1BVBA 4EM3A 4CNKA 3Q9TA 3AEDA 3OZ2A 2CFYA 3KLJA 3S7WA 1JRYA 2V6OA 1DJNA 1JU2A 3NNEA 3KVEA 4Z44A 2YG6A 5FS6A 3UTFA 1LQUA 2ZZBA 4ZCCA 3AE6A 3DK4A 4DGKA 4USRA 1LQTA 3SGLA 3SXQA 1OJAA 2K3VA 2GF3A 1BKWA 1PHHA 3UOXA 4H4QA 2H89A 3BNHA 4OPGA 1GTHA 1L9CA 4EMIA 1N4VA 4A99A 3DK9A 2HQMA 2E4GA 3NYFA 3NK1X 2RDZA 1GU6A 1GRTA 2YVJA 4AOXA 1GV4A 3QFAA 1KSSA 2YLSA 4H2QA 4JDRA 4TLXA 2GQFA 4Y4LA 2VRLA 4GCMA 4UDQA 5IQ4A 1O94A 4ECHA 4I58A 4B64A 3ALMA 4Z2TA 1GRGA 4U2LA 1Y56B 1PS9A 2WPCA 3LADA 1K0LA 4BV6A 2QCUA 2C3DA 2WP9A 2WOWA 3RNMA 2YQUA 4NTCA 4B65A 4OPLA 4JN9A 4H2RA 4GF7A 4DSGA 3NKSA 2Q6UA 1ZDLA 4LU6A 3K30A 2C7GA 3SM8A 3BNGA 3LGQA 3H8LA 4H7UA 2WOIA 4Z2UA 5U63A 3AEAA 1GPEA 2YM2A 3CGEA 3CNTA 2BK4A 1JRXA 3K7QX 3KD9A 2GR1A 2DKIA 1OJTA 1E1LA 3GWFA 3DJGX 4IV9A 4UDPA 2IIDA 4WCTA 5FS9A 2WETA 1AOGA 2RGOA 3UP4A 1TDEA 1DXLA 2YG5A 3F29A 1QJDA 2XLTA 4A65A 4ADWA 1NHPA 2XVHA 4J57A 3AEGA 1OAHA 1NG4A 1CJ4A 3GD3A 4D03A 5IPYA 1GETA 2YLRA 2XFUA 3VRBA 3DMEA 3GDNA 1MOKA 2DKHA 1Q1RA 1FL2A 1Q1WA 1ZOYA 1GXFA 4CBQA 1QDBA 2APGA 4Z26A 1TYTA 3HZLA 4JY3A 4OPTA 3AYLA 3QJ4A 4JY2A 4EIPA 2YR4A 5J7XA 1IUSA 4CNJA 1GRBA 3D1IA 1KSUA 2WDRA 2Y6QA 2ACZA 3BNFA 3NTAA 4U2SA 4U8MA 3REDA 1GSNA 2X50A 3AEBA 2B76A 3ICTA 4B1BA 1IUVA 3URHA 4KX6A 3DJDA 4YSXA 4TM4A 4TM1A 3CNSA 1D4DA 1D7YA 2PHHA 4OPIA 2AR8A 2WDQA 4NTDA 3F8PA 1E1KA 1ZMCA 4B66A 5GRTA 2V3AA 3DA1A 3D8XA 2VZ2A 2R45A 3PO7A 1JOAA 3GRSA 3JSKA 4EQSA 4U8JA 1PXBA 1FS9A 2RGHA 2GR2A 3BI2A 1H84A 3IF9A 2R0PA 5JCIA 1M1QA 1ONFA 3GWDA 3P4PA 4IVOB 4RG4A 3MMOA 2VVLG 4CCQA 2WHDA 4B69A 2BK3A 3TTBA 1SP3A 1TDKA 3F8RA 4RSLA 2FBWA 3C4AA 2XFNA 2ZZCA 3CPIG 3NTDA 4GUVA 1BF3A 3K7MX 4N9XA 3V76A 2AQJA 5GSNA 2R46A 1B37A 3IC9A 5FS7A 1S2QA 3L8KA 4H4YA 2W0HA 2FJAA 4KPRA 1L0VA 4K2XA 3RHAA 1XPQA 4AT2A 4FK1A 3VRAA 4B68A 4U8PA 2Q0LA 4MJWA 1H7XA 3NN6X 4TM3A 1TYPA 2VOUA 4NEWA 3UKPA 2GR0A 5KRQA 1CC6A 2OAMA 2GV8A 1B8SA 1NHRA 1TDFA 3ZDNA 2XCGA 5U1OA 4JNQA 4Q5CA 4BK1A 2Z5YA 1F3PA 4X9MA 1OJDA 1N4UA 1ZKQA 3AECA 1MO9A 4H2PA 3UTHA 1NDAA 1ZP0A 1NG3A 3V3OA 2BYBA 1P2HA 2B7RA 1N1PA 3IWAA 4U8KA 3KPFA 3DGHA 3NT6A 3ADAB 3KKJA 4YSZA 3CNPA 1PDHA 2BC1A 2VVLA 3DGZA 1M1RA 2VQ7A 2JB3A 2XFOA 3H8IA 2R0GA 4H4PA 3FMWA 3GD4A 3RP7A 4UP3A 3AD8B 1H83A 4A6NA 1Y0PA 2BCGG 3DJEA 1CHUA 2YVFA 4NTEA 2GH5A 2WBAA 5BRTA 1RP0A 1BGNA 4AT0A 4OCGA 4B67A 2C66A 3ICRA 5M10A 3T37A 1GRAA 2ZZ0A 3SFEA 4Q4UA 3G5RA 3EANA 4Z25A 1GREA 4H4UA 1QLBA 1S3BA 5EB5A 3AD9B 1YQZA 3CGDA 4K5SA 3BI5A 4APNA 1GT8A 3QSSA 4ZN0A 3QFBA 1GRFA 3B3RA 4B63A 3LJPA 4OPDA 2YLTA 3UBRA 1GOSA 4C74A 1JNRA 3AB1A 4H4XA 4PAAA 5JCNA 1XHCA 1K4QA 5HHFA 1BWCA 3BHKA 1REOA 5HXIA 1YQ3A 1E1NA 2OLOA 2V3BA 2C64A 4GDEA 1NAAA 5IQ1A 3RP8A 1B5QA 2GMJA 2X8HA 3UKHA 2YR6A 1GERA 2XLPA 3SFDA 4REKA 2JB2A 2GR3A 2EQ8A 5FMHA 4Q5BA 3GRTA 5JCMA 3UKLA 1GESA 3GYIA 4RG3A 4C77A 3DK8A 4K8DA 4H4WA 3GYJA 1DOBA 1L9EA 2YAUA 1FS8A 5BULA 4GRTA 2WPEA 4C5OA 4TLZA 1Q9IA 1S2YA 2BACA 2BS4A 1CJ3A 4NZHA 5KOWA 3NGCX 1CL0A 2F5ZA 3S61A 5EBKA 2ZO5A 3AD7B 1FEBA 3PS9A 3M12A 3IHGA 4LIIA 2EQ7A 1IJHA 1L9DA 3BI4A 4K7ZA 4XWZA 4CRTA 4L3XA 2CULA 3AWIA 4JQ9A 5L46A 2WPFA 1DJQA 2BS3A 2XVIA 4L38A 3AE7A 2LFCA 2GRTA 3P4RA 1FECA 5C3JA 3VR9A 4YSHA 4U2TA 3EAOA 4YTPA 1FCDA 3NRNA 3ICSA 2JKCA 4Q1OA 1FS7A 1IUXA 1KNPA 2C65A 4JNAA 4IA5A 5CQFA 3AE8A 4DNAA 3Q6JA 5CKUA 2OALA 1JNIA 2V60A 3GDPA 3L1RA 1LVLA 2VR0A 1SEZA 4PABA 3R9UA 3ISHA 3UKQA 4OPUA 1NPXA 3QSMA 2NPXA 3RKHA 5BVAA 1K0IA 4WJYA 2H88A 4EQRA 1LTXR 3P1WA 4CY8A 5JCLA 1LV0A 1LJ1A 1PBFA 2Y6RA 1LPFA 3LZWA 4A5LA 1ELIA 2QA2A 2ZBWA 3CNJA 1UKVG 2XVEA 1GEUA 2BS2A 1GNDA 1M1PA 2AAQA 4O5QA 4EM4A 3QVPA 4Z24A 3CPJG 4J36A 3ATRA 4AOSA 2J7AA 4A79A 4FDCB 1GTEA 3K7TA 4IVMB 2R4JA 4P9SA 1H6VA 3ATQA 3AE4A 1W4XA 1KFYA 1JNZA 3BNMA 3TORA 3EF6A 3LG1A 3S5WA 1F8SA 2FJBA 2PYXA 3M0OA 1DOCA 3E1TA 3AE1A 3CGCA 4USQA 3UTEA 4BJYA 5M0ZA 1OJCA 1NEKA 4YXDA 1GALA 1P2EA 2A89A 1OJ9A 3IHMA 4H4ZA 1VG9A 2JB1A 2YG3A 2GVCA 1NHSA 3VR8A 3I6DA 2Q7VA 3UKFA 1PBCA 1VRQB 2XDOA 2XLRA 3F8DA 1JEHA 2X3NA 4NEVA 4BURA 4A6NB 4ICYA 1TDNA 3ZYXA 3NLCA 2GMHA 2YR5A 3AE9A 4U8NA 5KWFA 1F8WA 2E80A 2YG7A 3UU9A 5U25A 4GDPA 3CIRA 3FBSA 3CPHG 1DODA 3CTYA 3BNUA 1E7PA 4C3YA 4Q0TA 1VG0A 4EQWA 3P9UA 2WU5A 1YKJA 2O9ZA 1X31B 4J2WA 3CGBA 5KVIA 3G5SA 2BA9A 3V3NA 4HA6A 1CF3A 4CCRA 1IUWA 1H82A 3AYIA 3FPZA 1E39A 5C2TA 4C3XA 3H4KA 3P4SA 1XANA 2YLZA 2C72A 5KOXA 2WEUA 1PN0A 4FX9A 2BXSA 4K5RA 3AE3A 5JCKA 2XLSA 2ARDA 4L3ZA 2E1MA 2JAEA 3AEFA 1YY5A 4X4JA 3SQPA 1CBOA 2V5ZA 4AP3A 2WP6A 4BK2A 4M52A 1QO8A 1PJ7A 2TMDA 1CC2A 4YTMA 3CNDA 1DNCA 4Y4MA 2GEWA 2NVKX 3GMCA 3VQRA 4A9WA 4Q17A 4HB9A 3C96A 4YKFA 3RP6A 2WESA 4X9NA 3M13A 3GYXA 1BZLA 1PXAA 1ZOVA 2WDVA 1FEAA 2OLNA 3UTGA 4D04A 3CN8A 4YT0A 3FIMB 4U8IA 1H86A 4Y4NA 5TR3A 1FOHA 3WE0A 1PXCA 2BK5A 4H4SA 1O5WA 4WX1A 4ZCDA 3NK2X 2JBVA 2XYOA 4UDRA 2YLXA 2OT4A 1K0JA 2C75A 3AYJA 3NHOX 3D1CA 1S3EA 2C3CA 2JK6A 2WU2A 4FK1C 1EL7A 3UP5A 1N4WA 5KVHA 2RF7A 3UKKA 4EQXA 1Z6LA 3BHFA 1H7WA 2B9WA 1EL9A 1IUTA 2XVJA 2VQBA 3GM6A 2BCPA 2XFQA 2EQ9A 1PBDA 4AP1A 1ZK7A 1MXTA 4BK3A 1Y56A 1ZX9A 1YQ4A 2FJEA 2BABA 3ALLA 3GSIA 4I59A 4OVIA 1EBDA 3OWMA 2WOVA 1RSGA 2OA1A 1CJ2A 2RGJA 2C76A 2J3NA 2I0ZA 4BJZA 4TM0A 5FS8A 2X8GA 3OC4A 2XVFA 3FO3A 3LXDA 3AE2A 4L3YA 2QA1A 3NYEA 1PJ5A 3II4A 4E0VA 2R9ZA 1ZMDA 2B9XA 3UCLA 3AE5A 5HY5A 3BNJA 2EQ6A 1ZY8A 3EPTA 4EMWA 3NN0X 3QVRA 4GR1A 3UOVA 4YSYA 1IUUA 1FT5A 1KNRA 1EL8A 5J60A 2B7SA 1RYIA 1E1MA 1TDOA 5KXJA 2CVJA 2R0CA 5EB4A 1E6EA 2BXRA 4U8OA 3NYCA 3COXA 4H2NA 2A8XA 2GAHB 2TPRA 5EOWA 5ER0A 3AEEA 3PVCA 2CDUA 2VVMA 1M64A 4YWOA
chains in the Genus database with same CATH superfamily
5LV9A 4Z2RA 2X8CA 5DBJA 2XLUA 1VDCA 2QAEA 3LZXA 2GAGB 1D7LA 2XFPA 1XDIA 4H4VA 4CY6A 1PJ6A 4H50A 1F6MA 2WS3A 3NG7X 3B6DA 1M6IA 2B9YA 4H4RA 4XWRA 2R4EA 2C67A 2RABA 2E81A 2X99A 3GMBA 4XXGA 4EIQA 3L1TA 3SCEA 2WP5A 2IVDA 1CJCA 2YM1A 3ITJA 2V61A 3UOYA 4OPCA 2Q0KA 4G74A 4J33A 4LA1A 1KDGA 3ABVA 2WQYA 3QSEA 4DSHA 1TRBA 4Z43A 4K22A 1F8RA 2UZZA 1BGJA 1DOEA 1KF6A 3DJJA 3I3LA 1PBEA 2FJDA 3VRDB 2A87A 1D4EA 2GB0A 1D5TA 3LB8A 3AXBA 4A7AA 5HYMA 3P4QA 1HYUA 5BUKA 4J34A 2VRMA 3FG2P 1O95A 3G5QA 1FT6A 1PBBA 4U8LA 5KNLA 1V59A 3NK0X 2C70A 1B4VA 1EL5A 2E5VA 4G9KA 2YVGA 3UKAA 1NHQA 1NENA 3KA7A 3KPKA 4YKGA 4J56A 4IA6A 4J31A 3LOVA 1H81A 3ALJA 2YG4A 4YTNA 3SZCA 1JRZA 3KU9A 1D4CA 3DH9A 4EMJA 3NH3X 2GQWA 2YLWA 2Z5XA 1GRHA 3NIXA 4O5UA 2IVEA 2BC0A 3C4NA 2YWLA 3UOZA 5KMQA 1VQWA 2C73A 4H4TA 1CC4A 3O0HA 1COYA 1BVBA 4EM3A 4CNKA 3Q9TA 3AEDA 3OZ2A 2CFYA 3KLJA 3S7WA 1JRYA 2V6OA 1DJNA 1JU2A 3NNEA 3KVEA 4Z44A 2YG6A 3HYVA 5FS6A 3UTFA 1LQUA 2ZZBA 4ZCCA 3AE6A 3DK4A 4DGKA 4USRA 1LQTA 3SGLA 3SXQA 1OJAA 3T0KA 2K3VA 2GF3A 1BKWA 1PHHA 3UOXA 4H4QA 2H89A 3BNHA 4OPGA 1GTHA 1L9CA 4EMIA 1N4VA 4A99A 3DK9A 2HQMA 2E4GA 3NYFA 3NK1X 2RDZA 1GU6A 1GRTA 2YVJA 4AOXA 1GV4A 3QFAA 1KSSA 2YLSA 4H2QA 4JDRA 2BRYA 2GQFA 4TLXA 2VRLA 4GAVA 4GCMA 4UDQA 4Y4LA 5IQ4A 1O94A 4ECHA 4I58A 4B64A 3ALMA 4Z2TA 1GRGA 4U2LA 1Y56B 1PS9A 2WPCA 3LADA 1K0LA 4BV6A 2QCUA 2C3DA 2WP9A 2WOWA 3RNMA 2YQUA 3SZWA 4NTCA 4B65A 4OPLA 4JN9A 4H2RA 4GF7A 4DSGA 3NKSA 2Q6UA 1ZDLA 4LU6A 3K30A 2C7GA 3SM8A 3BNGA 3LGQA 3H8LA 4H7UA 2WOIA 4Z2UA 5U63A 3AEAA 1GPEA 2YM2A 3CGEA 3CNTA 2BK4A 1JRXA 3T14A 3K7QX 3KD9A 2GR1A 2DKIA 1OJTA 1E1LA 3GWFA 3DJGX 4IV9A 4UDPA 2IIDA 4WCTA 5FS9A 2WETA 1AOGA 2RGOA 3UP4A 1TDEA 1DXLA 2YG5A 3F29A 1QJDA 2XLTA 4A65A 4ADWA 1NHPA 2XVHA 4J57A 3AEGA 1OAHA 1NG4A 1CJ4A 3GD3A 4D03A 5IPYA 1GETA 2YLRA 2XFUA 3VRBA 3DMEA 3GDNA 1MOKA 2DKHA 3SZ0A 1Q1RA 1FL2A 1Q1WA 1ZOYA 1GXFA 4CBQA 1QDBA 2APGA 4Z26A 1TYTA 3HZLA 4JY3A 4OPTA 3AYLA 3QJ4A 4G73A 3HYXA 4JY2A 2YR4A 5J7XA 4EIPA 1IUSA 4II2A 4CNJA 1GRBA 3D1IA 1KSUA 2WDRA 2Y6QA 2ACZA 3BNFA 3NTAA 4II3A 4U2SA 3REDA 1GSNA 2X50A 3AEBA 2B76A 3ICTA 4B1BA 1IUVA 3URHA 4KX6A 3SX6A 3DJDA 4YSXA 4TM4A 4TM1A 3CNSA 1D4DA 1D7YA 2PHHA 4OPIA 2AR8A 2WDQA 4NTDA 3F8PA 1E1KA 1ZMCA 4B66A 3SYIA 5GRTA 2V3AA 3DA1A 3D8XA 2VZ2A 2R45A 3PO7A 1JOAA 3GRSA 3JSKA 4EQSA 4U8JA 2CZSA 1PXBA 1FS9A 2RGHA 2GR2A 3CMMA 3BI2A 1H84A 3IF9A 2R0PA 5JCIA 1M1QA 1ONFA 3GWDA 3P4PA 4IVOB 4RG4A 3MMOA 2VVLG 4CCQA 2WHDA 4B69A 2BK3A 3TTBA 1SP3A 1TDKA 3F8RA 4RSLA 2FBWA 3C4AA 2XFNA 2ZZCA 3CPIG 3NTDA 4GUVA 1BF3A 3K7MX 4N9XA 3V76A 2AQJA 5GSNA 2R46A 1B37A 4GAPA 3IC9A 5FS7A 1S2QA 3L8KA 4H4YA 2W0HA 2FJAA 3T2YA 4KPRA 1L0VA 4K2XA 3RHAA 1XPQA 4AT2A 4FK1A 3VRAA 4B68A 4U8PA 2Q0LA 4MJWA 1H7XA 3NN6X 4TM3A 1TYPA 2VOUA 4NEWA 3UKPA 2GR0A 5KRQA 1CC6A 2OAMA 2GV8A 1B8SA 1NHRA 1TDFA 3ZDNA 2XCGA 5U1OA 4JNQA 4Q5CA 4BK1A 2Z5YA 1F3PA 4X9MA 5KMSA 1OJDA 1N4UA 1ZKQA 3AECA 1MO9A 4H2PA 3T2KA 3UTHA 1NDAA 1ZP0A 1NG3A 3V3OA 2BYBA 1P2HA 2B7RA 1N1PA 3IWAA 4U8KA 3KPFA 3DGHA 3NT6A 3ADAB 3KKJA 4YSZA 3CNPA 1PDHA 2BC1A 2VVLA 3DGZA 1M1RA 2VQ7A 2JB3A 2XFOA 3H8IA 2R0GA 4H4PA 3FMWA 3GD4A 3RP7A 4UP3A 4NWZA 3AD8B 1H83A 4A6NA 1Y0PA 2BCGG 3DJEA 1CHUA 2YVFA 4NTEA 2GH5A 2WBAA 5BRTA 1RP0A 1BGNA 4AT0A 4OCGA 4B67A 2C66A 3ICRA 5M10A 3T37A 1GRAA 2ZZ0A 3SFEA 4Q4UA 3G5RA 3EANA 4Z25A 1GREA 4H4UA 1QLBA 1S3BA 5EB5A 3AD9B 1YQZA 3CGDA 4K5SA 3BI5A 4APNA 1GT8A 3QSSA 4ZN0A 3QFBA 1GRFA 3B3RA 4B63A 3LJPA 4OPDA 2YLTA 3UBRA 1GOSA 4C74A 1JNRA 3AB1A 4H4XA 4PAAA 3SZFA 1XHCA 1K4QA 2C4CA 5HHFA 5JCNA 1BWCA 3BHKA 1REOA 5HXIA 1YQ3A 1E1NA 2OLOA 2V3BA 2C64A 4GDEA 1NAAA 5IQ1A 3RP8A 1B5QA 2GMJA 2X8HA 3UKHA 2YR6A 1GERA 2XLPA 3SFDA 4REKA 2JB2A 2GR3A 2EQ8A 5FMHA 4Q5BA 3GRTA 5JCMA 3UKLA 1GESA 3GYIA 4RG3A 4C77A 3DK8A 4K8DA 4H4WA 3GYJA 1DOBA 1L9EA 2YAUA 1FS8A 5BULA 4GRTA 2WPEA 4C5OA 4TLZA 1Q9IA 1S2YA 2BACA 2BS4A 1CJ3A 4NZHA 5KOWA 3NGCX 1CL0A 2F5ZA 3S61A 5EBKA 2ZO5A 3AD7B 1FEBA 3PS9A 3M12A 3IHGA 4LIIA 2EQ7A 1IJHA 1L9DA 3BI4A 4K7ZA 4XWZA 3T2ZA 4CRTA 4L3XA 2CULA 3AWIA 4JQ9A 5L46A 2WPFA 1DJQA 4G6GA 2BS3A 2XVIA 4L38A 3AE7A 2LFCA 2GRTA 3P4RA 1FECA 5C3JA 3SY4A 3VR9A 4U2TA 4YSHA 3EAOA 4YTPA 1FCDA 3NRNA 3ICSA 2JKCA 4Q1OA 1FS7A 1IUXA 1KNPA 2C65A 4JNAA 4IA5A 5CQFA 3AE8A 4DNAA 3Q6JA 5CKUA 2OALA 1JNIA 2V60A 3GDPA 3L1RA 1LVLA 2VR0A 1SEZA 4PABA 3R9UA 3ISHA 3UKQA 4OPUA 1NPXA 3QSMA 2NPXA 3RKHA 5BVAA 1K0IA 4WJYA 2H88A 4EQRA 1LTXR 3P1WA 4CY8A 5JCLA 1LV0A 1LJ1A 1PBFA 2Y6RA 1LPFA 3LZWA 4A5LA 1ELIA 2QA2A 2ZBWA 3CNJA 1UKVG 2XVEA 1GEUA 2BS2A 1GNDA 1M1PA 2AAQA 3HYWA 4O5QA 4EM4A 3QVPA 4Z24A 3CPJG 4J36A 3ATRA 4AOSA 2J7AA 4A79A 4FDCB 1GTEA 3K7TA 4IVMB 2R4JA 4P9SA 1H6VA 3ATQA 3T31A 3AE4A 1W4XA 1KFYA 1JNZA 3BNMA 3TORA 3EF6A 3SXIA 3LG1A 3S5WA 1F8SA 2FJBA 2PYXA 3M0OA 1DOCA 3E1TA 3AE1A 3CGCA 4USQA 3UTEA 4BJYA 5M0ZA 1OJCA 1NEKA 4YXDA 1GALA 1P2EA 2A89A 1OJ9A 3IHMA 4H4ZA 1VG9A 2JB1A 2YG3A 2GVCA 1NHSA 3VR8A 3I6DA 2Q7VA 5KMPA 3UKFA 1PBCA 1VRQB 2XDOA 2XLRA 3F8DA 1JEHA 2X3NA 4NEVA 4BURA 4A6NB 4ICYA 1TDNA 3ZYXA 3NLCA 2GMHA 2YR5A 3AE9A 4U8NA 5KWFA 1F8WA 2E80A 2YG7A 3UU9A 5U25A 4GDPA 3CIRA 3FBSA 3CPHG 1DODA 3CTYA 3BNUA 1E7PA 4C3YA 4Q0TA 1VG0A 4EQWA 3P9UA 2WU5A 1YKJA 2O9ZA 1X31B 4J2WA 3CGBA 5KVIA 3G5SA 2BA9A 3V3NA 4HA6A 1CF3A 4CCRA 1IUWA 1H82A 3AYIA 3FPZA 1E39A 5C2TA 4C3XA 3H4KA 3P4SA 1XANA 2YLZA 2C72A 5KOXA 2WEUA 1PN0A 4FX9A 2BXSA 4K5RA 3AE3A 5KMRA 5JCKA 2XLSA 2ARDA 4L3ZA 2E1MA 2JAEA 3AEFA 1YY5A 4X4JA 3SQPA 1CBOA 2V5ZA 4AP3A 2WP6A 4BK2A 4M52A 1QO8A 1PJ7A 2TMDA 1CC2A 4G6HA 4YTMA 3CNDA 1DNCA 4Y4MA 2GEWA 2NVKX 3GMCA 3VQRA 4A9WA 4Q17A 4HB9A 3C96A 4YKFA 3RP6A 2WESA 4X9NA 3GYXA 3M13A 1BZLA 1PXAA 1ZOVA 2WDVA 1FEAA 2OLNA 3UTGA 4D04A 3CN8A 4YT0A 3FIMB 4U8IA 1H86A 4Y4NA 5TR3A 1FOHA 3WE0A 1PXCA 2BK5A 4H4SA 1O5WA 4WX1A 4ZCDA 3NK2X 2JBVA 2XYOA 4UDRA 2YLXA 2OT4A 1K0JA 2C75A 3AYJA 3NHOX 3D1CA 1S3EA 2C3CA 2JK6A 2WU2A 4FK1C 1EL7A 3UP5A 1N4WA 5KVHA 2RF7A 3UKKA 4EQXA 1Z6LA 3BHFA 1H7WA 2B9WA 1EL9A 1IUTA 2XVJA 2VQBA 3GM6A 2BCPA 2XFQA 2EQ9A 1PBDA 4AP1A 1ZK7A 1MXTA 4BK3A 1Y56A 1ZX9A 2BRAA 1YQ4A 2FJEA 2BABA 3ALLA 3GSIA 4I59A 4OVIA 1EBDA 3OWMA 2WOVA 1RSGA 2OA1A 1CJ2A 2RGJA 2C76A 4NNJA 2J3NA 2I0ZA 4BJZA 4TM0A 5FS8A 2X8GA 3OC4A 2XVFA 3FO3A 3LXDA 3AE2A 4L3YA 2QA1A 3NYEA 1PJ5A 3II4A 4E0VA 2R9ZA 1ZMDA 2B9XA 3UCLA 3AE5A 5HY5A 3BNJA 2EQ6A 1ZY8A 3EPTA 4U8MA 3NN0X 3QVRA 4GR1A 3UOVA 4EMWA 4YSYA 1IUUA 1FT5A 1KNRA 1EL8A 5J60A 2B7SA 1RYIA 1E1MA 1TDOA 5KXJA 2CVJA 2R0CA 5EB4A 1E6EA 2BXRA 4U8OA 3NYCA 3COXA 4H2NA 2A8XA 2GAHB 2TPRA 5EOWA 5ER0A 3AEEA 3PVCA 2CDUA 2VVMA 1M64A 4YWOA
chains in the Genus database with same CATH topology
5LV9A 4Z2RA 2X8CA 5DBJA 2XLUA 1VDCA 2QAEA 3LZXA 2GAGB 1D7LA 2XFPA 1XDIA 4H4VA 4CY6A 1PJ6A 4H50A 1F6MA 2WS3A 3NG7X 3B6DA 1M6IA 2B9YA 4H4RA 4XWRA 2R4EA 2C67A 2RABA 2E81A 2X99A 3GMBA 4XXGA 4EIQA 3L1TA 3SCEA 2WP5A 2IVDA 1CJCA 2YM1A 3ITJA 2V61A 3UOYA 4OPCA 2Q0KA 4G74A 4J33A 4LA1A 1KDGA 3ABVA 2WQYA 3QSEA 4DSHA 1TRBA 4Z43A 4K22A 1F8RA 2UZZA 1BGJA 1DOEA 1KF6A 3DJJA 3I3LA 1PBEA 2FJDA 3VRDB 2A87A 1D4EA 2GB0A 1D5TA 3LB8A 3AXBA 4A7AA 5HYMA 3P4QA 1HYUA 5BUKA 4J34A 2VRMA 3FG2P 1O95A 3G5QA 1FT6A 1PBBA 4U8LA 5KNLA 1V59A 3NK0X 2C70A 1B4VA 1EL5A 2E5VA 4G9KA 2YVGA 3UKAA 1NHQA 1NENA 3KA7A 3KPKA 4YKGA 4J56A 4IA6A 4J31A 3LOVA 1H81A 3ALJA 2YG4A 4YTNA 3SZCA 1JRZA 3KU9A 1D4CA 3DH9A 4EMJA 3NH3X 2GQWA 2YLWA 2Z5XA 1GRHA 3NIXA 4O5UA 2IVEA 2BC0A 3C4NA 2YWLA 3UOZA 5KMQA 1VQWA 2C73A 4H4TA 1CC4A 3O0HA 1COYA 1BVBA 4EM3A 4CNKA 3Q9TA 3AEDA 3OZ2A 2CFYA 3KLJA 3S7WA 1JRYA 2V6OA 1DJNA 1JU2A 3NNEA 3KVEA 4Z44A 2YG6A 3HYVA 5FS6A 3UTFA 1LQUA 2ZZBA 4ZCCA 3AE6A 3DK4A 4DGKA 4USRA 1LQTA 3SGLA 3SXQA 1OJAA 3T0KA 2K3VA 2GF3A 1BKWA 1PHHA 3UOXA 4H4QA 2H89A 3BNHA 4OPGA 1GTHA 1L9CA 4EMIA 1N4VA 4A99A 3DK9A 2HQMA 2E4GA 3NYFA 3NK1X 2RDZA 1GU6A 1GRTA 2YVJA 4AOXA 1GV4A 3QFAA 1KSSA 2YLSA 4H2QA 4JDRA 2BRYA 2GQFA 4TLXA 2VRLA 4GAVA 4GCMA 4UDQA 4Y4LA 5IQ4A 1O94A 4ECHA 4I58A 4B64A 3ALMA 4Z2TA 1GRGA 4U2LA 1Y56B 1PS9A 2WPCA 3LADA 1K0LA 4BV6A 2QCUA 2C3DA 2WP9A 2WOWA 3RNMA 2YQUA 3SZWA 4NTCA 4B65A 4OPLA 4JN9A 4H2RA 4GF7A 4DSGA 3NKSA 2Q6UA 1ZDLA 4LU6A 3K30A 2C7GA 3SM8A 3BNGA 3LGQA 3H8LA 4H7UA 2WOIA 4Z2UA 5U63A 3AEAA 1GPEA 2YM2A 3CGEA 3CNTA 2BK4A 1JRXA 3T14A 3K7QX 3KD9A 2GR1A 2DKIA 1OJTA 1E1LA 3GWFA 3DJGX 4IV9A 4UDPA 2IIDA 4WCTA 5FS9A 2WETA 1AOGA 2RGOA 3UP4A 1TDEA 1DXLA 2YG5A 3F29A 1QJDA 2XLTA 4A65A 4ADWA 1NHPA 2XVHA 4J57A 3AEGA 1OAHA 1NG4A 1CJ4A 3GD3A 4D03A 5IPYA 1GETA 2YLRA 2XFUA 3VRBA 3DMEA 3GDNA 1MOKA 2DKHA 3SZ0A 1Q1RA 1FL2A 1Q1WA 1ZOYA 1GXFA 4CBQA 1QDBA 2APGA 4Z26A 1TYTA 3HZLA 4JY3A 4OPTA 3AYLA 3QJ4A 4G73A 3HYXA 4JY2A 2YR4A 5J7XA 4EIPA 1IUSA 4II2A 4CNJA 1GRBA 3D1IA 1KSUA 2WDRA 2Y6QA 2ACZA 3BNFA 3NTAA 4II3A 4U2SA 3REDA 1GSNA 2X50A 3AEBA 2B76A 3ICTA 4B1BA 1IUVA 3URHA 4KX6A 3SX6A 3DJDA 4YSXA 4TM4A 4TM1A 3CNSA 1D4DA 1D7YA 2PHHA 4OPIA 2AR8A 2WDQA 4NTDA 3F8PA 1E1KA 1ZMCA 4B66A 3SYIA 5GRTA 2V3AA 3DA1A 3D8XA 2VZ2A 2R45A 3PO7A 1JOAA 3GRSA 3JSKA 4EQSA 4U8JA 1PXBA 1FS9A 2RGHA 2GR2A 3CMMA 3BI2A 1H84A 3IF9A 2R0PA 5JCIA 1M1QA 1ONFA 3GWDA 3P4PA 4IVOB 4RG4A 3MMOA 2VVLG 4CCQA 2WHDA 4B69A 2BK3A 3TTBA 1SP3A 1TDKA 3F8RA 4RSLA 2FBWA 3C4AA 2XFNA 2ZZCA 3CPIG 3NTDA 4GUVA 1BF3A 3K7MX 4N9XA 3V76A 2AQJA 5GSNA 2R46A 1B37A 4GAPA 3IC9A 5FS7A 1S2QA 3L8KA 4H4YA 2W0HA 2FJAA 3T2YA 4KPRA 1L0VA 4K2XA 3RHAA 1XPQA 4AT2A 4FK1A 3VRAA 4B68A 4U8PA 2Q0LA 4MJWA 1H7XA 3NN6X 4TM3A 1TYPA 2VOUA 4NEWA 3UKPA 2GR0A 5KRQA 1CC6A 2OAMA 2GV8A 1B8SA 1NHRA 1TDFA 3ZDNA 2XCGA 5U1OA 4JNQA 4Q5CA 4BK1A 2Z5YA 1F3PA 4X9MA 5KMSA 1OJDA 1N4UA 1ZKQA 3AECA 1MO9A 4H2PA 3T2KA 3UTHA 1NDAA 1ZP0A 1NG3A 3V3OA 2BYBA 1P2HA 2B7RA 1N1PA 3IWAA 4U8KA 3KPFA 3DGHA 3NT6A 3ADAB 3KKJA 4YSZA 3CNPA 1PDHA 2BC1A 2VVLA 3DGZA 1M1RA 2VQ7A 2JB3A 2XFOA 3H8IA 2R0GA 4H4PA 3FMWA 3GD4A 3RP7A 4UP3A 4NWZA 3AD8B 1H83A 4A6NA 1Y0PA 2BCGG 3DJEA 1CHUA 2YVFA 4NTEA 2GH5A 2WBAA 5BRTA 1RP0A 1BGNA 4AT0A 4OCGA 4B67A 2C66A 3ICRA 5M10A 3T37A 1GRAA 2ZZ0A 3SFEA 4Q4UA 3G5RA 3EANA 4Z25A 1GREA 4H4UA 1QLBA 1S3BA 5EB5A 3AD9B 1YQZA 3CGDA 4K5SA 3BI5A 4APNA 1GT8A 3QSSA 4ZN0A 3QFBA 1GRFA 3B3RA 4B63A 3LJPA 4OPDA 2YLTA 3UBRA 1GOSA 4C74A 1JNRA 3AB1A 4H4XA 4PAAA 3SZFA 1XHCA 1K4QA 2C4CA 5HHFA 5JCNA 1BWCA 3BHKA 1REOA 5HXIA 1YQ3A 1E1NA 2OLOA 2V3BA 2C64A 4GDEA 1NAAA 5IQ1A 3RP8A 1B5QA 2GMJA 2X8HA 3UKHA 2YR6A 1GERA 2XLPA 3SFDA 4REKA 2JB2A 2GR3A 2EQ8A 5FMHA 4Q5BA 3GRTA 5JCMA 3UKLA 1GESA 3GYIA 4RG3A 4C77A 3DK8A 4K8DA 4H4WA 3GYJA 1DOBA 1L9EA 2YAUA 1FS8A 5BULA 4GRTA 2WPEA 4C5OA 4TLZA 1Q9IA 1S2YA 2BACA 2BS4A 1CJ3A 4NZHA 5KOWA 3NGCX 1CL0A 2F5ZA 3S61A 5EBKA 2ZO5A 3AD7B 1FEBA 3PS9A 3M12A 3IHGA 4LIIA 2EQ7A 1IJHA 1L9DA 3BI4A 4K7ZA 4XWZA 3T2ZA 4CRTA 4L3XA 2CULA 3AWIA 4JQ9A 5L46A 2WPFA 1DJQA 4G6GA 2BS3A 2XVIA 4L38A 3AE7A 2LFCA 2GRTA 3P4RA 1FECA 5C3JA 3SY4A 3VR9A 4U2TA 4YSHA 3EAOA 4YTPA 1FCDA 3NRNA 3ICSA 2JKCA 4Q1OA 1FS7A 1IUXA 1KNPA 2C65A 4JNAA 4IA5A 5CQFA 3AE8A 4DNAA 3Q6JA 5CKUA 2OALA 1JNIA 2V60A 3GDPA 3L1RA 1LVLA 2VR0A 1SEZA 4PABA 3R9UA 3ISHA 3UKQA 4OPUA 1NPXA 3QSMA 2NPXA 3RKHA 5BVAA 1K0IA 4WJYA 2H88A 4EQRA 1LTXR 3P1WA 4CY8A 5JCLA 1LV0A 1LJ1A 1PBFA 2Y6RA 1LPFA 3LZWA 4A5LA 1ELIA 2QA2A 2ZBWA 3CNJA 1UKVG 2XVEA 1GEUA 2BS2A 1GNDA 1M1PA 2AAQA 3HYWA 4O5QA 4EM4A 3QVPA 4Z24A 3CPJG 4J36A 3ATRA 4AOSA 2J7AA 4A79A 4FDCB 1GTEA 3K7TA 4IVMB 2R4JA 4P9SA 1H6VA 3ATQA 3T31A 3AE4A 1W4XA 1KFYA 1JNZA 3BNMA 3TORA 3EF6A 3SXIA 3LG1A 3S5WA 1F8SA 2FJBA 2PYXA 3M0OA 1DOCA 3E1TA 3AE1A 3CGCA 4USQA 3UTEA 4BJYA 5M0ZA 1OJCA 1NEKA 4YXDA 1GALA 1P2EA 2A89A 1OJ9A 3IHMA 4H4ZA 1VG9A 2JB1A 2YG3A 2GVCA 1NHSA 3VR8A 3I6DA 2Q7VA 5KMPA 3UKFA 1PBCA 1VRQB 2XDOA 2XLRA 3F8DA 1JEHA 2X3NA 4NEVA 4BURA 4A6NB 4ICYA 1TDNA 3ZYXA 3NLCA 2GMHA 2YR5A 3AE9A 4U8NA 5KWFA 1F8WA 2E80A 2YG7A 3UU9A 5U25A 4GDPA 3CIRA 3FBSA 3CPHG 1DODA 3CTYA 3BNUA 1E7PA 4C3YA 4Q0TA 1VG0A 4EQWA 3P9UA 2WU5A 1YKJA 2O9ZA 1X31B 4J2WA 3CGBA 5KVIA 3G5SA 2BA9A 3V3NA 4HA6A 1CF3A 4CCRA 1IUWA 1H82A 3AYIA 3FPZA 1E39A 5C2TA 4C3XA 3H4KA 3P4SA 1XANA 2YLZA 2C72A 5KOXA 2WEUA 1PN0A 4FX9A 2BXSA 4K5RA 3AE3A 5KMRA 5JCKA 2XLSA 2ARDA 4L3ZA 2E1MA 2JAEA 3AEFA 1YY5A 4X4JA 3SQPA 1CBOA 2V5ZA 4AP3A 2WP6A 4BK2A 4M52A 1QO8A 1PJ7A 2TMDA 1CC2A 4G6HA 4YTMA 3CNDA 1DNCA 4Y4MA 2GEWA 2NVKX 3GMCA 3VQRA 4A9WA 4Q17A 4HB9A 3C96A 4YKFA 3RP6A 2WESA 4X9NA 3GYXA 3M13A 1BZLA 1PXAA 1ZOVA 2WDVA 1FEAA 2OLNA 3UTGA 4D04A 3CN8A 4YT0A 3FIMB 4U8IA 1H86A 4Y4NA 5TR3A 1FOHA 3WE0A 1PXCA 2BK5A 4H4SA 1O5WA 4WX1A 4ZCDA 3NK2X 2JBVA 2XYOA 4UDRA 2YLXA 2OT4A 1K0JA 2C75A 3AYJA 3NHOX 3D1CA 1S3EA 2C3CA 2JK6A 2WU2A 4FK1C 1EL7A 3UP5A 1N4WA 5KVHA 2RF7A 3UKKA 4EQXA 1Z6LA 3BHFA 1H7WA 2B9WA 1EL9A 1IUTA 2XVJA 2VQBA 3GM6A 2BCPA 2XFQA 2EQ9A 1PBDA 4AP1A 1ZK7A 1MXTA 4BK3A 1Y56A 1ZX9A 2BRAA 1YQ4A 2FJEA 2BABA 3ALLA 3GSIA 4I59A 4OVIA 1EBDA 3OWMA 2WOVA 1RSGA 2OA1A 1CJ2A 2RGJA 2C76A 4NNJA 2J3NA 2I0ZA 4BJZA 4TM0A 5FS8A 2X8GA 3OC4A 2XVFA 3FO3A 3LXDA 3AE2A 4L3YA 2QA1A 3NYEA 1PJ5A 3II4A 4E0VA 2R9ZA 1ZMDA 2B9XA 3UCLA 3AE5A 5HY5A 3BNJA 2EQ6A 1ZY8A 3EPTA 4U8MA 3NN0X 3QVRA 4GR1A 3UOVA 4EMWA 4YSYA 1IUUA 1FT5A 1KNRA 1EL8A 5J60A 2B7SA 1RYIA 1E1MA 1TDOA 5KXJA 2CVJA 2R0CA 5EB4A 1E6EA 2BXRA 4U8OA 3NYCA 3COXA 4H2NA 2A8XA 2GAHB 2TPRA 5EOWA 5ER0A 3AEEA 3PVCA 2CDUA 2VVMA 1M64A 4YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LV9 A;  4Z2R A;  2X8C A;  5DBJ A;  2XLU A;  1VDC A;  2QAE A;  3LZX A;  2GAG B;  1D7L A;  2XFP A;  1XDI A;  4H4V A;  4CY6 A;  1PJ6 A;  4H50 A;  1F6M A;  2WS3 A;  3NG7 X;  3B6D A;  1M6I A;  2B9Y A;  4H4R A;  4XWR A;  2R4E A;  2C67 A;  2RAB A;  2E81 A;  2X99 A;  3GMB A;  4XXG A;  4EIQ A;  3L1T A;  3SCE A;  2WP5 A;  2IVD A;  1CJC A;  2YM1 A;  3ITJ A;  2V61 A;  3UOY A;  4OPC A;  2Q0K A;  4LA1 A;  4J33 A;  1KDG A;  3ABV A;  2WQY A;  3QSE A;  4DSH A;  1TRB A;  4Z43 A;  4K22 A;  1F8R A;  2UZZ A;  1BGJ A;  1DOE A;  1KF6 A;  3DJJ A;  3I3L A;  1PBE A;  2FJD A;  3VRD B;  2A87 A;  1D4E A;  2GB0 A;  1D5T A;  3LB8 A;  3AXB A;  4A7A A;  5HYM A;  3P4Q A;  1HYU A;  5BUK A;  4J34 A;  2VRM A;  3FG2 P;  1O95 A;  3G5Q A;  1FT6 A;  1PBB A;  4U8L A;  1V59 A;  3NK0 X;  2C70 A;  1B4V A;  1EL5 A;  2E5V A;  2YVG A;  3UKA A;  1NHQ A;  1NEN A;  3KA7 A;  4YKG A;  4J56 A;  4IA6 A;  4J31 A;  3LOV A;  1H81 A;  3ALJ A;  2YG4 A;  4YTN A;  1JRZ A;  3KU9 A;  1D4C A;  3DH9 A;  4EMJ A;  3NH3 X;  2GQW A;  2YLW A;  2Z5X A;  1GRH A;  3NIX A;  4O5U A;  2IVE A;  2BC0 A;  3C4N A;  2YWL A;  3UOZ A;  1VQW A;  2C73 A;  4H4T A;  1CC4 A;  3O0H A;  1COY A;  1BVB A;  4EM3 A;  4CNK A;  3Q9T A;  3AED A;  3OZ2 A;  2CFY A;  3KLJ A;  3S7W A;  1JRY A;  2V6O A;  1DJN A;  1JU2 A;  3NNE A;  3KVE A;  4Z44 A;  2YG6 A;  5FS6 A;  3UTF A;  1LQU A;  2ZZB A;  4ZCC A;  3AE6 A;  3DK4 A;  4DGK A;  4USR A;  1LQT A;  3SGL A;  3SXQ A;  1OJA A;  2K3V A;  2GF3 A;  1BKW A;  1PHH A;  3UOX A;  4H4Q A;  2H89 A;  3BNH A;  4OPG A;  1GTH A;  1L9C A;  4EMI A;  1N4V A;  4A99 A;  3DK9 A;  2HQM A;  2E4G A;  3NYF A;  3NK1 X;  2RDZ A;  1GU6 A;  1GRT A;  2YVJ A;  4AOX A;  1GV4 A;  3QFA A;  1KSS A;  2YLS A;  4H2Q A;  4JDR A;  4TLX A;  2GQF A;  4Y4L A;  2VRL A;  4GCM A;  4UDQ A;  5IQ4 A;  1O94 A;  4ECH A;  4I58 A;  4B64 A;  3ALM A;  4Z2T A;  1GRG A;  4U2L A;  1Y56 B;  1PS9 A;  2WPC A;  3LAD A;  1K0L A;  4BV6 A;  2QCU A;  2C3D A;  2WP9 A;  2WOW A;  3RNM A;  2YQU A;  4NTC A;  4B65 A;  4OPL A;  4JN9 A;  4H2R A;  4GF7 A;  4DSG A;  3NKS A;  2Q6U A;  1ZDL A;  4LU6 A;  3K30 A;  2C7G A;  3SM8 A;  3BNG A;  3LGQ A;  3H8L A;  4H7U A;  2WOI A;  4Z2U A;  5U63 A;  3AEA A;  1GPE A;  2YM2 A;  3CGE A;  3CNT A;  2BK4 A;  1JRX A;  3K7Q X;  3KD9 A;  2GR1 A;  2DKI A;  1OJT A;  1E1L A;  3GWF A;  3DJG X;  4IV9 A;  4UDP A;  2IID A;  4WCT A;  5FS9 A;  2WET A;  1AOG A;  2RGO A;  3UP4 A;  1TDE A;  1DXL A;  2YG5 A;  3F29 A;  1QJD A;  2XLT A;  4A65 A;  4ADW A;  1NHP A;  2XVH A;  4J57 A;  3AEG A;  1OAH A;  1NG4 A;  1CJ4 A;  3GD3 A;  4D03 A;  5IPY A;  1GET A;  2YLR A;  2XFU A;  3VRB A;  3DME A;  3GDN A;  1MOK A;  2DKH A;  1Q1R A;  1FL2 A;  1Q1W A;  1ZOY A;  1GXF A;  4CBQ A;  1QDB A;  2APG A;  4Z26 A;  1TYT A;  3HZL A;  4JY3 A;  4OPT A;  3AYL A;  3QJ4 A;  4JY2 A;  4EIP A;  2YR4 A;  5J7X A;  1IUS A;  4CNJ A;  1GRB A;  3D1I A;  1KSU A;  2WDR A;  2Y6Q A;  2ACZ A;  3BNF A;  3NTA A;  4U2S A;  4U8M A;  3RED A;  1GSN A;  2X50 A;  3AEB A;  2B76 A;  3ICT A;  4B1B A;  1IUV A;  3URH A;  4KX6 A;  3DJD A;  4YSX A;  4TM4 A;  4TM1 A;  3CNS A;  1D4D A;  1D7Y A;  2PHH A;  4OPI A;  2AR8 A;  2WDQ A;  4NTD A;  3F8P A;  1E1K A;  1ZMC A;  4B66 A;  5GRT A;  2V3A A;  3DA1 A;  3D8X A;  2VZ2 A;  2R45 A;  3PO7 A;  1JOA A;  3GRS A;  3JSK A;  4EQS A;  4U8J A;  1PXB A;  1FS9 A;  2RGH A;  2GR2 A;  3BI2 A;  1H84 A;  3IF9 A;  2R0P A;  5JCI A;  1M1Q A;  1ONF A;  3GWD A;  3P4P A;  4IVO B;  4RG4 A;  3MMO A;  2VVL G;  4CCQ A;  2WHD A;  4B69 A;  2BK3 A;  3TTB A;  1SP3 A;  1TDK A;  3F8R A;  4RSL A;  2FBW A;  3C4A A;  2XFN A;  2ZZC A;  3CPI G;  3NTD A;  4GUV A;  1BF3 A;  3K7M X;  4N9X A;  3V76 A;  2AQJ A;  5GSN A;  2R46 A;  1B37 A;  3IC9 A;  5FS7 A;  1S2Q A;  3L8K A;  4H4Y A;  2W0H A;  2FJA A;  4KPR A;  1L0V A;  4K2X A;  3RHA A;  1XPQ A;  4AT2 A;  4FK1 A;  3VRA A;  4B68 A;  4U8P A;  2Q0L A;  4MJW A;  1H7X A;  3NN6 X;  4TM3 A;  1TYP A;  2VOU A;  4NEW A;  3UKP A;  2GR0 A;  5KRQ A;  1CC6 A;  2OAM A;  2GV8 A;  1B8S A;  1NHR A;  1TDF A;  3ZDN A;  2XCG A;  5U1O A;  4JNQ A;  4Q5C A;  4BK1 A;  2Z5Y A;  1F3P A;  4X9M A;  1OJD A;  1N4U A;  1ZKQ A;  3AEC A;  1MO9 A;  4H2P A;  3UTH A;  1NDA A;  1ZP0 A;  1NG3 A;  3V3O A;  2BYB A;  1P2H A;  2B7R A;  1N1P A;  3IWA A;  4U8K A;  3KPF A;  3DGH A;  3NT6 A;  3ADA B;  3KKJ A;  4YSZ A;  3CNP A;  1PDH A;  2BC1 A;  2VVL A;  3DGZ A;  1M1R A;  2VQ7 A;  2JB3 A;  2XFO A;  3H8I A;  2R0G A;  4H4P A;  3FMW A;  3GD4 A;  3RP7 A;  4UP3 A;  3AD8 B;  1H83 A;  4A6N A;  1Y0P A;  2BCG G;  3DJE A;  1CHU A;  2YVF A;  4NTE A;  2GH5 A;  2WBA A;  5BRT A;  1RP0 A;  1BGN A;  4AT0 A;  4OCG A;  4B67 A;  2C66 A;  3ICR A;  5M10 A;  3T37 A;  1GRA A;  2ZZ0 A;  3SFE A;  4Q4U A;  3G5R A;  3EAN A;  4Z25 A;  1GRE A;  4H4U A;  1QLB A;  1S3B A;  5EB5 A;  3AD9 B;  1YQZ A;  3CGD A;  4K5S A;  3BI5 A;  4APN A;  1GT8 A;  3QSS A;  4ZN0 A;  3QFB A;  1GRF A;  3B3R A;  4B63 A;  3LJP A;  4OPD A;  2YLT A;  3UBR A;  1GOS A;  4C74 A;  1JNR A;  3AB1 A;  4H4X A;  4PAA A;  5JCN A;  1XHC A;  1K4Q A;  5HHF A;  1BWC A;  3BHK A;  1REO A;  5HXI A;  1YQ3 A;  1E1N A;  2OLO A;  2V3B A;  2C64 A;  4GDE A;  1NAA A;  5IQ1 A;  3RP8 A;  1B5Q A;  2GMJ A;  2X8H A;  3UKH A;  2YR6 A;  1GER A;  2XLP A;  3SFD A;  4REK A;  2JB2 A;  2GR3 A;  2EQ8 A;  5FMH A;  4Q5B A;  3GRT A;  5JCM A;  3UKL A;  1GES A;  3GYI A;  4RG3 A;  4C77 A;  3DK8 A;  4K8D A;  4H4W A;  3GYJ A;  1DOB A;  1L9E A;  2YAU A;  1FS8 A;  5BUL A;  4GRT A;  2WPE A;  4C5O A;  4TLZ A;  1Q9I A;  1S2Y A;  2BAC A;  2BS4 A;  1CJ3 A;  4NZH A;  5KOW A;  3NGC X;  1CL0 A;  2F5Z A;  3S61 A;  5EBK A;  2ZO5 A;  3AD7 B;  1FEB A;  3PS9 A;  3M12 A;  3IHG A;  4LII A;  2EQ7 A;  1IJH A;  1L9D A;  3BI4 A;  4K7Z A;  4XWZ A;  4CRT A;  4L3X A;  2CUL A;  3AWI A;  4JQ9 A;  5L46 A;  2WPF A;  1DJQ A;  2BS3 A;  2XVI A;  4L38 A;  3AE7 A;  2LFC A;  2GRT A;  3P4R A;  1FEC A;  5C3J A;  3VR9 A;  4YSH A;  4U2T A;  3EAO A;  4YTP A;  1FCD A;  3NRN A;  3ICS A;  2JKC A;  4Q1O A;  1FS7 A;  1IUX A;  1KNP A;  2C65 A;  4JNA A;  4IA5 A;  5CQF A;  3AE8 A;  4DNA A;  3Q6J A;  5CKU A;  2OAL A;  1JNI A;  2V60 A;  3GDP A;  3L1R A;  1LVL A;  2VR0 A;  1SEZ A;  4PAB A;  3R9U A;  3ISH A;  3UKQ A;  4OPU A;  1NPX A;  3QSM A;  2NPX A;  3RKH A;  5BVA A;  1K0I A;  4WJY A;  2H88 A;  4EQR A;  1LTX R;  3P1W A;  4CY8 A;  5JCL A;  1LV0 A;  1LJ1 A;  1PBF A;  2Y6R A;  1LPF A;  3LZW A;  4A5L A;  1ELI A;  2QA2 A;  2ZBW A;  3CNJ A;  1UKV G;  2XVE A;  1GEU A;  2BS2 A;  1GND A;  1M1P A;  2AAQ A;  4O5Q A;  4EM4 A;  3QVP A;  4Z24 A;  3CPJ G;  4J36 A;  3ATR A;  4AOS A;  2J7A A;  4A79 A;  4FDC B;  1GTE A;  3K7T A;  4IVM B;  2R4J A;  4P9S A;  1H6V A;  3ATQ A;  3AE4 A;  1W4X A;  1KFY A;  1JNZ A;  3BNM A;  3TOR A;  3EF6 A;  3LG1 A;  3S5W A;  1F8S A;  2FJB A;  2PYX A;  3M0O A;  1DOC A;  3E1T A;  3AE1 A;  3CGC A;  4USQ A;  3UTE A;  4BJY A;  5M0Z A;  1OJC A;  1NEK A;  4YXD A;  1GAL A;  1P2E A;  2A89 A;  1OJ9 A;  3IHM A;  4H4Z A;  1VG9 A;  2JB1 A;  2YG3 A;  2GVC A;  1NHS A;  3VR8 A;  3I6D A;  2Q7V A;  3UKF A;  1PBC A;  1VRQ B;  2XDO A;  2XLR A;  3F8D A;  1JEH A;  2X3N A;  4NEV A;  4BUR A;  4A6N B;  4ICY A;  1TDN A;  3ZYX A;  3NLC A;  2GMH A;  2YR5 A;  3AE9 A;  4U8N A;  5KWF A;  1F8W A;  2E80 A;  2YG7 A;  3UU9 A;  5U25 A;  4GDP A;  3CIR A;  3FBS A;  3CPH G;  1DOD A;  3CTY A;  3BNU A;  1E7P A;  4C3Y A;  4Q0T A;  1VG0 A;  4EQW A;  3P9U A;  2WU5 A;  1YKJ A;  2O9Z A;  1X31 B;  4J2W A;  3CGB A;  5KVI A;  3G5S A;  2BA9 A;  3V3N A;  4HA6 A;  1CF3 A;  4CCR A;  1IUW A;  1H82 A;  3AYI A;  3FPZ A;  1E39 A;  5C2T A;  4C3X A;  3H4K A;  3P4S A;  1XAN A;  2YLZ A;  2C72 A;  5KOX A;  2WEU A;  1PN0 A;  4FX9 A;  2BXS A;  4K5R A;  3AE3 A;  5JCK A;  2XLS A;  2ARD A;  4L3Z A;  2E1M A;  2JAE A;  3AEF A;  1YY5 A;  4X4J A;  3SQP A;  1CBO A;  2V5Z A;  4AP3 A;  2WP6 A;  4BK2 A;  4M52 A;  1QO8 A;  1PJ7 A;  2TMD A;  1CC2 A;  4YTM A;  3CND A;  1DNC A;  4Y4M A;  2GEW A;  2NVK X;  3GMC A;  3VQR A;  4A9W A;  4Q17 A;  4HB9 A;  3C96 A;  4YKF A;  3RP6 A;  2WES A;  4X9N A;  3M13 A;  3GYX A;  1BZL A;  1PXA A;  1ZOV A;  2WDV A;  1FEA A;  2OLN A;  3UTG A;  4D04 A;  3CN8 A;  4YT0 A;  3FIM B;  4U8I A;  1H86 A;  4Y4N A;  5TR3 A;  1FOH A;  3WE0 A;  1PXC A;  2BK5 A;  4H4S A;  1O5W A;  4WX1 A;  4ZCD A;  3NK2 X;  2JBV A;  2XYO A;  4UDR A;  2YLX A;  2OT4 A;  1K0J A;  2C75 A;  3AYJ A;  3NHO X;  3D1C A;  1S3E A;  2C3C A;  2JK6 A;  2WU2 A;  4FK1 C;  1EL7 A;  3UP5 A;  1N4W A;  5KVH A;  2RF7 A;  3UKK A;  4EQX A;  1Z6L A;  3BHF A;  1H7W A;  2B9W A;  1EL9 A;  1IUT A;  2XVJ A;  2VQB A;  3GM6 A;  2BCP A;  2XFQ A;  2EQ9 A;  1PBD A;  4AP1 A;  1ZK7 A;  1MXT A;  4BK3 A;  1Y56 A;  1ZX9 A;  1YQ4 A;  2FJE A;  2BAB A;  3ALL A;  3GSI A;  4I59 A;  4OVI A;  1EBD A;  3OWM A;  2WOV A;  1RSG A;  2OA1 A;  1CJ2 A;  2RGJ A;  2C76 A;  2J3N A;  2I0Z A;  4BJZ A;  4TM0 A;  5FS8 A;  2X8G A;  3OC4 A;  2XVF A;  3FO3 A;  3LXD A;  3AE2 A;  4L3Y A;  2QA1 A;  3NYE A;  1PJ5 A;  3II4 A;  4E0V A;  2R9Z A;  1ZMD A;  2B9X A;  3UCL A;  3AE5 A;  5HY5 A;  3BNJ A;  2EQ6 A;  1ZY8 A;  3EPT A;  4EMW A;  3NN0 X;  3QVR A;  4GR1 A;  3UOV A;  4YSY A;  1IUU A;  1FT5 A;  1KNR A;  1EL8 A;  5J60 A;  2B7S A;  1RYI A;  1E1M A;  1TDO A;  5KXJ A;  2CVJ A;  2R0C A;  5EB4 A;  1E6E A;  2BXR A;  4U8O A;  3NYC A;  3COX A;  4H2N A;  2A8X A;  2GAH B;  2TPR A;  5EOW A;  5ER0 A;  3AEE A;  3PVC A;  2CDU A;  2VVM A;  1M64 A;  4YWO A; 
#chains in the Genus database with same CATH topology
 5LV9 A;  4Z2R A;  2X8C A;  5DBJ A;  2XLU A;  1VDC A;  2QAE A;  3LZX A;  2GAG B;  1D7L A;  2XFP A;  1XDI A;  4H4V A;  4CY6 A;  1PJ6 A;  4H50 A;  1F6M A;  2WS3 A;  3NG7 X;  3B6D A;  1M6I A;  2B9Y A;  4H4R A;  4XWR A;  2R4E A;  2C67 A;  2RAB A;  2E81 A;  2X99 A;  3GMB A;  4XXG A;  4EIQ A;  3L1T A;  3SCE A;  2WP5 A;  2IVD A;  1CJC A;  2YM1 A;  3ITJ A;  2V61 A;  3UOY A;  4OPC A;  2Q0K A;  4G74 A;  4J33 A;  4LA1 A;  1KDG A;  3ABV A;  2WQY A;  3QSE A;  4DSH A;  1TRB A;  4Z43 A;  4K22 A;  1F8R A;  2UZZ A;  1BGJ A;  1DOE A;  1KF6 A;  3DJJ A;  3I3L A;  1PBE A;  2FJD A;  3VRD B;  2A87 A;  1D4E A;  2GB0 A;  1D5T A;  3LB8 A;  3AXB A;  4A7A A;  5HYM A;  3P4Q A;  1HYU A;  5BUK A;  4J34 A;  2VRM A;  3FG2 P;  1O95 A;  3G5Q A;  1FT6 A;  1PBB A;  4U8L A;  5KNL A;  1V59 A;  3NK0 X;  2C70 A;  1B4V A;  1EL5 A;  2E5V A;  4G9K A;  2YVG A;  3UKA A;  1NHQ A;  1NEN A;  3KA7 A;  3KPK A;  4YKG A;  4J56 A;  4IA6 A;  4J31 A;  3LOV A;  1H81 A;  3ALJ A;  2YG4 A;  4YTN A;  3SZC A;  1JRZ A;  3KU9 A;  1D4C A;  3DH9 A;  4EMJ A;  3NH3 X;  2GQW A;  2YLW A;  2Z5X A;  1GRH A;  3NIX A;  4O5U A;  2IVE A;  2BC0 A;  3C4N A;  2YWL A;  3UOZ A;  5KMQ A;  1VQW A;  2C73 A;  4H4T A;  1CC4 A;  3O0H A;  1COY A;  1BVB A;  4EM3 A;  4CNK A;  3Q9T A;  3AED A;  3OZ2 A;  2CFY A;  3KLJ A;  3S7W A;  1JRY A;  2V6O A;  1DJN A;  1JU2 A;  3NNE A;  3KVE A;  4Z44 A;  2YG6 A;  3HYV A;  5FS6 A;  3UTF A;  1LQU A;  2ZZB A;  4ZCC A;  3AE6 A;  3DK4 A;  4DGK A;  4USR A;  1LQT A;  3SGL A;  3SXQ A;  1OJA A;  3T0K A;  2K3V A;  2GF3 A;  1BKW A;  1PHH A;  3UOX A;  4H4Q A;  2H89 A;  3BNH A;  4OPG A;  1GTH A;  1L9C A;  4EMI A;  1N4V A;  4A99 A;  3DK9 A;  2HQM A;  2E4G A;  3NYF A;  3NK1 X;  2RDZ A;  1GU6 A;  1GRT A;  2YVJ A;  4AOX A;  1GV4 A;  3QFA A;  1KSS A;  2YLS A;  4H2Q A;  4JDR A;  2BRY A;  2GQF A;  4TLX A;  2VRL A;  4GAV A;  4GCM A;  4UDQ A;  4Y4L A;  5IQ4 A;  1O94 A;  4ECH A;  4I58 A;  4B64 A;  3ALM A;  4Z2T A;  1GRG A;  4U2L A;  1Y56 B;  1PS9 A;  2WPC A;  3LAD A;  1K0L A;  4BV6 A;  2QCU A;  2C3D A;  2WP9 A;  2WOW A;  3RNM A;  2YQU A;  3SZW A;  4NTC A;  4B65 A;  4OPL A;  4JN9 A;  4H2R A;  4GF7 A;  4DSG A;  3NKS A;  2Q6U A;  1ZDL A;  4LU6 A;  3K30 A;  2C7G A;  3SM8 A;  3BNG A;  3LGQ A;  3H8L A;  4H7U A;  2WOI A;  4Z2U A;  5U63 A;  3AEA A;  1GPE A;  2YM2 A;  3CGE A;  3CNT A;  2BK4 A;  1JRX A;  3T14 A;  3K7Q X;  3KD9 A;  2GR1 A;  2DKI A;  1OJT A;  1E1L A;  3GWF A;  3DJG X;  4IV9 A;  4UDP A;  2IID A;  4WCT A;  5FS9 A;  2WET A;  1AOG A;  2RGO A;  3UP4 A;  1TDE A;  1DXL A;  2YG5 A;  3F29 A;  1QJD A;  2XLT A;  4A65 A;  4ADW A;  1NHP A;  2XVH A;  4J57 A;  3AEG A;  1OAH A;  1NG4 A;  1CJ4 A;  3GD3 A;  4D03 A;  5IPY A;  1GET A;  2YLR A;  2XFU A;  3VRB A;  3DME A;  3GDN A;  1MOK A;  2DKH A;  3SZ0 A;  1Q1R A;  1FL2 A;  1Q1W A;  1ZOY A;  1GXF A;  4CBQ A;  1QDB A;  2APG A;  4Z26 A;  1TYT A;  3HZL A;  4JY3 A;  4OPT A;  3AYL A;  3QJ4 A;  4G73 A;  3HYX A;  4JY2 A;  2YR4 A;  5J7X A;  4EIP A;  1IUS A;  4II2 A;  4CNJ A;  1GRB A;  3D1I A;  1KSU A;  2WDR A;  2Y6Q A;  2ACZ A;  3BNF A;  3NTA A;  4II3 A;  4U2S A;  3RED A;  1GSN A;  2X50 A;  3AEB A;  2B76 A;  3ICT A;  4B1B A;  1IUV A;  3URH A;  4KX6 A;  3SX6 A;  3DJD A;  4YSX A;  4TM4 A;  4TM1 A;  3CNS A;  1D4D A;  1D7Y A;  2PHH A;  4OPI A;  2AR8 A;  2WDQ A;  4NTD A;  3F8P A;  1E1K A;  1ZMC A;  4B66 A;  3SYI A;  5GRT A;  2V3A A;  3DA1 A;  3D8X A;  2VZ2 A;  2R45 A;  3PO7 A;  1JOA A;  3GRS A;  3JSK A;  4EQS A;  4U8J A;  2CZS A;  1PXB A;  1FS9 A;  2RGH A;  2GR2 A;  3CMM A;  3BI2 A;  1H84 A;  3IF9 A;  2R0P A;  5JCI A;  1M1Q A;  1ONF A;  3GWD A;  3P4P A;  4IVO B;  4RG4 A;  3MMO A;  2VVL G;  4CCQ A;  2WHD A;  4B69 A;  2BK3 A;  3TTB A;  1SP3 A;  1TDK A;  3F8R A;  4RSL A;  2FBW A;  3C4A A;  2XFN A;  2ZZC A;  3CPI G;  3NTD A;  4GUV A;  1BF3 A;  3K7M X;  4N9X A;  3V76 A;  2AQJ A;  5GSN A;  2R46 A;  1B37 A;  4GAP A;  3IC9 A;  5FS7 A;  1S2Q A;  3L8K A;  4H4Y A;  2W0H A;  2FJA A;  3T2Y A;  4KPR A;  1L0V A;  4K2X A;  3RHA A;  1XPQ A;  4AT2 A;  4FK1 A;  3VRA A;  4B68 A;  4U8P A;  2Q0L A;  4MJW A;  1H7X A;  3NN6 X;  4TM3 A;  1TYP A;  2VOU A;  4NEW A;  3UKP A;  2GR0 A;  5KRQ A;  1CC6 A;  2OAM A;  2GV8 A;  1B8S A;  1NHR A;  1TDF A;  3ZDN A;  2XCG A;  5U1O A;  4JNQ A;  4Q5C A;  4BK1 A;  2Z5Y A;  1F3P A;  4X9M A;  5KMS A;  1OJD A;  1N4U A;  1ZKQ A;  3AEC A;  1MO9 A;  4H2P A;  3T2K A;  3UTH A;  1NDA A;  1ZP0 A;  1NG3 A;  3V3O A;  2BYB A;  1P2H A;  2B7R A;  1N1P A;  3IWA A;  4U8K A;  3KPF A;  3DGH A;  3NT6 A;  3ADA B;  3KKJ A;  4YSZ A;  3CNP A;  1PDH A;  2BC1 A;  2VVL A;  3DGZ A;  1M1R A;  2VQ7 A;  2JB3 A;  2XFO A;  3H8I A;  2R0G A;  4H4P A;  3FMW A;  3GD4 A;  3RP7 A;  4UP3 A;  4NWZ A;  3AD8 B;  1H83 A;  4A6N A;  1Y0P A;  2BCG G;  3DJE A;  1CHU A;  2YVF A;  4NTE A;  2GH5 A;  2WBA A;  5BRT A;  1RP0 A;  1BGN A;  4AT0 A;  4OCG A;  4B67 A;  2C66 A;  3ICR A;  5M10 A;  3T37 A;  1GRA A;  2ZZ0 A;  3SFE A;  4Q4U A;  3G5R A;  3EAN A;  4Z25 A;  1GRE A;  4H4U A;  1QLB A;  1S3B A;  5EB5 A;  3AD9 B;  1YQZ A;  3CGD A;  4K5S A;  3BI5 A;  4APN A;  1GT8 A;  3QSS A;  4ZN0 A;  3QFB A;  1GRF A;  3B3R A;  4B63 A;  3LJP A;  4OPD A;  2YLT A;  3UBR A;  1GOS A;  4C74 A;  1JNR A;  3AB1 A;  4H4X A;  4PAA A;  3SZF A;  1XHC A;  1K4Q A;  2C4C A;  5HHF A;  5JCN A;  1BWC A;  3BHK A;  1REO A;  5HXI A;  1YQ3 A;  1E1N A;  2OLO A;  2V3B A;  2C64 A;  4GDE A;  1NAA A;  5IQ1 A;  3RP8 A;  1B5Q A;  2GMJ A;  2X8H A;  3UKH A;  2YR6 A;  1GER A;  2XLP A;  3SFD A;  4REK A;  2JB2 A;  2GR3 A;  2EQ8 A;  5FMH A;  4Q5B A;  3GRT A;  5JCM A;  3UKL A;  1GES A;  3GYI A;  4RG3 A;  4C77 A;  3DK8 A;  4K8D A;  4H4W A;  3GYJ A;  1DOB A;  1L9E A;  2YAU A;  1FS8 A;  5BUL A;  4GRT A;  2WPE A;  4C5O A;  4TLZ A;  1Q9I A;  1S2Y A;  2BAC A;  2BS4 A;  1CJ3 A;  4NZH A;  5KOW A;  3NGC X;  1CL0 A;  2F5Z A;  3S61 A;  5EBK A;  2ZO5 A;  3AD7 B;  1FEB A;  3PS9 A;  3M12 A;  3IHG A;  4LII A;  2EQ7 A;  1IJH A;  1L9D A;  3BI4 A;  4K7Z A;  4XWZ A;  3T2Z A;  4CRT A;  4L3X A;  2CUL A;  3AWI A;  4JQ9 A;  5L46 A;  2WPF A;  1DJQ A;  4G6G A;  2BS3 A;  2XVI A;  4L38 A;  3AE7 A;  2LFC A;  2GRT A;  3P4R A;  1FEC A;  5C3J A;  3SY4 A;  3VR9 A;  4U2T A;  4YSH A;  3EAO A;  4YTP A;  1FCD A;  3NRN A;  3ICS A;  2JKC A;  4Q1O A;  1FS7 A;  1IUX A;  1KNP A;  2C65 A;  4JNA A;  4IA5 A;  5CQF A;  3AE8 A;  4DNA A;  3Q6J A;  5CKU A;  2OAL A;  1JNI A;  2V60 A;  3GDP A;  3L1R A;  1LVL A;  2VR0 A;  1SEZ A;  4PAB A;  3R9U A;  3ISH A;  3UKQ A;  4OPU A;  1NPX A;  3QSM A;  2NPX A;  3RKH A;  5BVA A;  1K0I A;  4WJY A;  2H88 A;  4EQR A;  1LTX R;  3P1W A;  4CY8 A;  5JCL A;  1LV0 A;  1LJ1 A;  1PBF A;  2Y6R A;  1LPF A;  3LZW A;  4A5L A;  1ELI A;  2QA2 A;  2ZBW A;  3CNJ A;  1UKV G;  2XVE A;  1GEU A;  2BS2 A;  1GND A;  1M1P A;  2AAQ A;  3HYW A;  4O5Q A;  4EM4 A;  3QVP A;  4Z24 A;  3CPJ G;  4J36 A;  3ATR A;  4AOS A;  2J7A A;  4A79 A;  4FDC B;  1GTE A;  3K7T A;  4IVM B;  2R4J A;  4P9S A;  1H6V A;  3ATQ A;  3T31 A;  3AE4 A;  1W4X A;  1KFY A;  1JNZ A;  3BNM A;  3TOR A;  3EF6 A;  3SXI A;  3LG1 A;  3S5W A;  1F8S A;  2FJB A;  2PYX A;  3M0O A;  1DOC A;  3E1T A;  3AE1 A;  3CGC A;  4USQ A;  3UTE A;  4BJY A;  5M0Z A;  1OJC A;  1NEK A;  4YXD A;  1GAL A;  1P2E A;  2A89 A;  1OJ9 A;  3IHM A;  4H4Z A;  1VG9 A;  2JB1 A;  2YG3 A;  2GVC A;  1NHS A;  3VR8 A;  3I6D A;  2Q7V A;  5KMP A;  3UKF A;  1PBC A;  1VRQ B;  2XDO A;  2XLR A;  3F8D A;  1JEH A;  2X3N A;  4NEV A;  4BUR A;  4A6N B;  4ICY A;  1TDN A;  3ZYX A;  3NLC A;  2GMH A;  2YR5 A;  3AE9 A;  4U8N A;  5KWF A;  1F8W A;  2E80 A;  2YG7 A;  3UU9 A;  5U25 A;  4GDP A;  3CIR A;  3FBS A;  3CPH G;  1DOD A;  3CTY A;  3BNU A;  1E7P A;  4C3Y A;  4Q0T A;  1VG0 A;  4EQW A;  3P9U A;  2WU5 A;  1YKJ A;  2O9Z A;  1X31 B;  4J2W A;  3CGB A;  5KVI A;  3G5S A;  2BA9 A;  3V3N A;  4HA6 A;  1CF3 A;  4CCR A;  1IUW A;  1H82 A;  3AYI A;  3FPZ A;  1E39 A;  5C2T A;  4C3X A;  3H4K A;  3P4S A;  1XAN A;  2YLZ A;  2C72 A;  5KOX A;  2WEU A;  1PN0 A;  4FX9 A;  2BXS A;  4K5R A;  3AE3 A;  5KMR A;  5JCK A;  2XLS A;  2ARD A;  4L3Z A;  2E1M A;  2JAE A;  3AEF A;  1YY5 A;  4X4J A;  3SQP A;  1CBO A;  2V5Z A;  4AP3 A;  2WP6 A;  4BK2 A;  4M52 A;  1QO8 A;  1PJ7 A;  2TMD A;  1CC2 A;  4G6H A;  4YTM A;  3CND A;  1DNC A;  4Y4M A;  2GEW A;  2NVK X;  3GMC A;  3VQR A;  4A9W A;  4Q17 A;  4HB9 A;  3C96 A;  4YKF A;  3RP6 A;  2WES A;  4X9N A;  3GYX A;  3M13 A;  1BZL A;  1PXA A;  1ZOV A;  2WDV A;  1FEA A;  2OLN A;  3UTG A;  4D04 A;  3CN8 A;  4YT0 A;  3FIM B;  4U8I A;  1H86 A;  4Y4N A;  5TR3 A;  1FOH A;  3WE0 A;  1PXC A;  2BK5 A;  4H4S A;  1O5W A;  4WX1 A;  4ZCD A;  3NK2 X;  2JBV A;  2XYO A;  4UDR A;  2YLX A;  2OT4 A;  1K0J A;  2C75 A;  3AYJ A;  3NHO X;  3D1C A;  1S3E A;  2C3C A;  2JK6 A;  2WU2 A;  4FK1 C;  1EL7 A;  3UP5 A;  1N4W A;  5KVH A;  2RF7 A;  3UKK A;  4EQX A;  1Z6L A;  3BHF A;  1H7W A;  2B9W A;  1EL9 A;  1IUT A;  2XVJ A;  2VQB A;  3GM6 A;  2BCP A;  2XFQ A;  2EQ9 A;  1PBD A;  4AP1 A;  1ZK7 A;  1MXT A;  4BK3 A;  1Y56 A;  1ZX9 A;  2BRA A;  1YQ4 A;  2FJE A;  2BAB A;  3ALL A;  3GSI A;  4I59 A;  4OVI A;  1EBD A;  3OWM A;  2WOV A;  1RSG A;  2OA1 A;  1CJ2 A;  2RGJ A;  2C76 A;  4NNJ A;  2J3N A;  2I0Z A;  4BJZ A;  4TM0 A;  5FS8 A;  2X8G A;  3OC4 A;  2XVF A;  3FO3 A;  3LXD A;  3AE2 A;  4L3Y A;  2QA1 A;  3NYE A;  1PJ5 A;  3II4 A;  4E0V A;  2R9Z A;  1ZMD A;  2B9X A;  3UCL A;  3AE5 A;  5HY5 A;  3BNJ A;  2EQ6 A;  1ZY8 A;  3EPT A;  4U8M A;  3NN0 X;  3QVR A;  4GR1 A;  3UOV A;  4EMW A;  4YSY A;  1IUU A;  1FT5 A;  1KNR A;  1EL8 A;  5J60 A;  2B7S A;  1RYI A;  1E1M A;  1TDO A;  5KXJ A;  2CVJ A;  2R0C A;  5EB4 A;  1E6E A;  2BXR A;  4U8O A;  3NYC A;  3COX A;  4H2N A;  2A8X A;  2GAH B;  2TPR A;  5EOW A;  5ER0 A;  3AEE A;  3PVC A;  2CDU A;  2VVM A;  1M64 A;  4YWO A; 
#chains in the Genus database with same CATH homology
 5LV9 A;  4Z2R A;  2X8C A;  5DBJ A;  2XLU A;  1VDC A;  2QAE A;  3LZX A;  2GAG B;  1D7L A;  2XFP A;  1XDI A;  4H4V A;  4CY6 A;  1PJ6 A;  4H50 A;  1F6M A;  2WS3 A;  3NG7 X;  3B6D A;  1M6I A;  2B9Y A;  4H4R A;  4XWR A;  2R4E A;  2C67 A;  2RAB A;  2E81 A;  2X99 A;  3GMB A;  4XXG A;  4EIQ A;  3L1T A;  3SCE A;  2WP5 A;  2IVD A;  1CJC A;  2YM1 A;  3ITJ A;  2V61 A;  3UOY A;  4OPC A;  2Q0K A;  4G74 A;  4J33 A;  4LA1 A;  1KDG A;  3ABV A;  2WQY A;  3QSE A;  4DSH A;  1TRB A;  4Z43 A;  4K22 A;  1F8R A;  2UZZ A;  1BGJ A;  1DOE A;  1KF6 A;  3DJJ A;  3I3L A;  1PBE A;  2FJD A;  3VRD B;  2A87 A;  1D4E A;  2GB0 A;  1D5T A;  3LB8 A;  3AXB A;  4A7A A;  5HYM A;  3P4Q A;  1HYU A;  5BUK A;  4J34 A;  2VRM A;  3FG2 P;  1O95 A;  3G5Q A;  1FT6 A;  1PBB A;  4U8L A;  5KNL A;  1V59 A;  3NK0 X;  2C70 A;  1B4V A;  1EL5 A;  2E5V A;  4G9K A;  2YVG A;  3UKA A;  1NHQ A;  1NEN A;  3KA7 A;  3KPK A;  4YKG A;  4J56 A;  4IA6 A;  4J31 A;  3LOV A;  1H81 A;  3ALJ A;  2YG4 A;  4YTN A;  3SZC A;  1JRZ A;  3KU9 A;  1D4C A;  3DH9 A;  4EMJ A;  3NH3 X;  2GQW A;  2YLW A;  2Z5X A;  1GRH A;  3NIX A;  4O5U A;  2IVE A;  2BC0 A;  3C4N A;  2YWL A;  3UOZ A;  5KMQ A;  1VQW A;  2C73 A;  4H4T A;  1CC4 A;  3O0H A;  1COY A;  1BVB A;  4EM3 A;  4CNK A;  3Q9T A;  3AED A;  3OZ2 A;  2CFY A;  3KLJ A;  3S7W A;  1JRY A;  2V6O A;  1DJN A;  1JU2 A;  3NNE A;  3KVE A;  4Z44 A;  2YG6 A;  3HYV A;  5FS6 A;  3UTF A;  1LQU A;  2ZZB A;  4ZCC A;  3AE6 A;  3DK4 A;  4DGK A;  4USR A;  1LQT A;  3SGL A;  3SXQ A;  1OJA A;  3T0K A;  2K3V A;  2GF3 A;  1BKW A;  1PHH A;  3UOX A;  4H4Q A;  2H89 A;  3BNH A;  4OPG A;  1GTH A;  1L9C A;  4EMI A;  1N4V A;  4A99 A;  3DK9 A;  2HQM A;  2E4G A;  3NYF A;  3NK1 X;  2RDZ A;  1GU6 A;  1GRT A;  2YVJ A;  4AOX A;  1GV4 A;  3QFA A;  1KSS A;  2YLS A;  4H2Q A;  4JDR A;  2BRY A;  2GQF A;  4TLX A;  2VRL A;  4GAV A;  4GCM A;  4UDQ A;  4Y4L A;  5IQ4 A;  1O94 A;  4ECH A;  4I58 A;  4B64 A;  3ALM A;  4Z2T A;  1GRG A;  4U2L A;  1Y56 B;  1PS9 A;  2WPC A;  3LAD A;  1K0L A;  4BV6 A;  2QCU A;  2C3D A;  2WP9 A;  2WOW A;  3RNM A;  2YQU A;  3SZW A;  4NTC A;  4B65 A;  4OPL A;  4JN9 A;  4H2R A;  4GF7 A;  4DSG A;  3NKS A;  2Q6U A;  1ZDL A;  4LU6 A;  3K30 A;  2C7G A;  3SM8 A;  3BNG A;  3LGQ A;  3H8L A;  4H7U A;  2WOI A;  4Z2U A;  5U63 A;  3AEA A;  1GPE A;  2YM2 A;  3CGE A;  3CNT A;  2BK4 A;  1JRX A;  3T14 A;  3K7Q X;  3KD9 A;  2GR1 A;  2DKI A;  1OJT A;  1E1L A;  3GWF A;  3DJG X;  4IV9 A;  4UDP A;  2IID A;  4WCT A;  5FS9 A;  2WET A;  1AOG A;  2RGO A;  3UP4 A;  1TDE A;  1DXL A;  2YG5 A;  3F29 A;  1QJD A;  2XLT A;  4A65 A;  4ADW A;  1NHP A;  2XVH A;  4J57 A;  3AEG A;  1OAH A;  1NG4 A;  1CJ4 A;  3GD3 A;  4D03 A;  5IPY A;  1GET A;  2YLR A;  2XFU A;  3VRB A;  3DME A;  3GDN A;  1MOK A;  2DKH A;  3SZ0 A;  1Q1R A;  1FL2 A;  1Q1W A;  1ZOY A;  1GXF A;  4CBQ A;  1QDB A;  2APG A;  4Z26 A;  1TYT A;  3HZL A;  4JY3 A;  4OPT A;  3AYL A;  3QJ4 A;  4G73 A;  3HYX A;  4JY2 A;  2YR4 A;  5J7X A;  4EIP A;  1IUS A;  4II2 A;  4CNJ A;  1GRB A;  3D1I A;  1KSU A;  2WDR A;  2Y6Q A;  2ACZ A;  3BNF A;  3NTA A;  4II3 A;  4U2S A;  3RED A;  1GSN A;  2X50 A;  3AEB A;  2B76 A;  3ICT A;  4B1B A;  1IUV A;  3URH A;  4KX6 A;  3SX6 A;  3DJD A;  4YSX A;  4TM4 A;  4TM1 A;  3CNS A;  1D4D A;  1D7Y A;  2PHH A;  4OPI A;  2AR8 A;  2WDQ A;  4NTD A;  3F8P A;  1E1K A;  1ZMC A;  4B66 A;  3SYI A;  5GRT A;  2V3A A;  3DA1 A;  3D8X A;  2VZ2 A;  2R45 A;  3PO7 A;  1JOA A;  3GRS A;  3JSK A;  4EQS A;  4U8J A;  1PXB A;  1FS9 A;  2RGH A;  2GR2 A;  3CMM A;  3BI2 A;  1H84 A;  3IF9 A;  2R0P A;  5JCI A;  1M1Q A;  1ONF A;  3GWD A;  3P4P A;  4IVO B;  4RG4 A;  3MMO A;  2VVL G;  4CCQ A;  2WHD A;  4B69 A;  2BK3 A;  3TTB A;  1SP3 A;  1TDK A;  3F8R A;  4RSL A;  2FBW A;  3C4A A;  2XFN A;  2ZZC A;  3CPI G;  3NTD A;  4GUV A;  1BF3 A;  3K7M X;  4N9X A;  3V76 A;  2AQJ A;  5GSN A;  2R46 A;  1B37 A;  4GAP A;  3IC9 A;  5FS7 A;  1S2Q A;  3L8K A;  4H4Y A;  2W0H A;  2FJA A;  3T2Y A;  4KPR A;  1L0V A;  4K2X A;  3RHA A;  1XPQ A;  4AT2 A;  4FK1 A;  3VRA A;  4B68 A;  4U8P A;  2Q0L A;  4MJW A;  1H7X A;  3NN6 X;  4TM3 A;  1TYP A;  2VOU A;  4NEW A;  3UKP A;  2GR0 A;  5KRQ A;  1CC6 A;  2OAM A;  2GV8 A;  1B8S A;  1NHR A;  1TDF A;  3ZDN A;  2XCG A;  5U1O A;  4JNQ A;  4Q5C A;  4BK1 A;  2Z5Y A;  1F3P A;  4X9M A;  5KMS A;  1OJD A;  1N4U A;  1ZKQ A;  3AEC A;  1MO9 A;  4H2P A;  3T2K A;  3UTH A;  1NDA A;  1ZP0 A;  1NG3 A;  3V3O A;  2BYB A;  1P2H A;  2B7R A;  1N1P A;  3IWA A;  4U8K A;  3KPF A;  3DGH A;  3NT6 A;  3ADA B;  3KKJ A;  4YSZ A;  3CNP A;  1PDH A;  2BC1 A;  2VVL A;  3DGZ A;  1M1R A;  2VQ7 A;  2JB3 A;  2XFO A;  3H8I A;  2R0G A;  4H4P A;  3FMW A;  3GD4 A;  3RP7 A;  4UP3 A;  4NWZ A;  3AD8 B;  1H83 A;  4A6N A;  1Y0P A;  2BCG G;  3DJE A;  1CHU A;  2YVF A;  4NTE A;  2GH5 A;  2WBA A;  5BRT A;  1RP0 A;  1BGN A;  4AT0 A;  4OCG A;  4B67 A;  2C66 A;  3ICR A;  5M10 A;  3T37 A;  1GRA A;  2ZZ0 A;  3SFE A;  4Q4U A;  3G5R A;  3EAN A;  4Z25 A;  1GRE A;  4H4U A;  1QLB A;  1S3B A;  5EB5 A;  3AD9 B;  1YQZ A;  3CGD A;  4K5S A;  3BI5 A;  4APN A;  1GT8 A;  3QSS A;  4ZN0 A;  3QFB A;  1GRF A;  3B3R A;  4B63 A;  3LJP A;  4OPD A;  2YLT A;  3UBR A;  1GOS A;  4C74 A;  1JNR A;  3AB1 A;  4H4X A;  4PAA A;  3SZF A;  1XHC A;  1K4Q A;  2C4C A;  5HHF A;  5JCN A;  1BWC A;  3BHK A;  1REO A;  5HXI A;  1YQ3 A;  1E1N A;  2OLO A;  2V3B A;  2C64 A;  4GDE A;  1NAA A;  5IQ1 A;  3RP8 A;  1B5Q A;  2GMJ A;  2X8H A;  3UKH A;  2YR6 A;  1GER A;  2XLP A;  3SFD A;  4REK A;  2JB2 A;  2GR3 A;  2EQ8 A;  5FMH A;  4Q5B A;  3GRT A;  5JCM A;  3UKL A;  1GES A;  3GYI A;  4RG3 A;  4C77 A;  3DK8 A;  4K8D A;  4H4W A;  3GYJ A;  1DOB A;  1L9E A;  2YAU A;  1FS8 A;  5BUL A;  4GRT A;  2WPE A;  4C5O A;  4TLZ A;  1Q9I A;  1S2Y A;  2BAC A;  2BS4 A;  1CJ3 A;  4NZH A;  5KOW A;  3NGC X;  1CL0 A;  2F5Z A;  3S61 A;  5EBK A;  2ZO5 A;  3AD7 B;  1FEB A;  3PS9 A;  3M12 A;  3IHG A;  4LII A;  2EQ7 A;  1IJH A;  1L9D A;  3BI4 A;  4K7Z A;  4XWZ A;  3T2Z A;  4CRT A;  4L3X A;  2CUL A;  3AWI A;  4JQ9 A;  5L46 A;  2WPF A;  1DJQ A;  4G6G A;  2BS3 A;  2XVI A;  4L38 A;  3AE7 A;  2LFC A;  2GRT A;  3P4R A;  1FEC A;  5C3J A;  3SY4 A;  3VR9 A;  4U2T A;  4YSH A;  3EAO A;  4YTP A;  1FCD A;  3NRN A;  3ICS A;  2JKC A;  4Q1O A;  1FS7 A;  1IUX A;  1KNP A;  2C65 A;  4JNA A;  4IA5 A;  5CQF A;  3AE8 A;  4DNA A;  3Q6J A;  5CKU A;  2OAL A;  1JNI A;  2V60 A;  3GDP A;  3L1R A;  1LVL A;  2VR0 A;  1SEZ A;  4PAB A;  3R9U A;  3ISH A;  3UKQ A;  4OPU A;  1NPX A;  3QSM A;  2NPX A;  3RKH A;  5BVA A;  1K0I A;  4WJY A;  2H88 A;  4EQR A;  1LTX R;  3P1W A;  4CY8 A;  5JCL A;  1LV0 A;  1LJ1 A;  1PBF A;  2Y6R A;  1LPF A;  3LZW A;  4A5L A;  1ELI A;  2QA2 A;  2ZBW A;  3CNJ A;  1UKV G;  2XVE A;  1GEU A;  2BS2 A;  1GND A;  1M1P A;  2AAQ A;  3HYW A;  4O5Q A;  4EM4 A;  3QVP A;  4Z24 A;  3CPJ G;  4J36 A;  3ATR A;  4AOS A;  2J7A A;  4A79 A;  4FDC B;  1GTE A;  3K7T A;  4IVM B;  2R4J A;  4P9S A;  1H6V A;  3ATQ A;  3T31 A;  3AE4 A;  1W4X A;  1KFY A;  1JNZ A;  3BNM A;  3TOR A;  3EF6 A;  3SXI A;  3LG1 A;  3S5W A;  1F8S A;  2FJB A;  2PYX A;  3M0O A;  1DOC A;  3E1T A;  3AE1 A;  3CGC A;  4USQ A;  3UTE A;  4BJY A;  5M0Z A;  1OJC A;  1NEK A;  4YXD A;  1GAL A;  1P2E A;  2A89 A;  1OJ9 A;  3IHM A;  4H4Z A;  1VG9 A;  2JB1 A;  2YG3 A;  2GVC A;  1NHS A;  3VR8 A;  3I6D A;  2Q7V A;  5KMP A;  3UKF A;  1PBC A;  1VRQ B;  2XDO A;  2XLR A;  3F8D A;  1JEH A;  2X3N A;  4NEV A;  4BUR A;  4A6N B;  4ICY A;  1TDN A;  3ZYX A;  3NLC A;  2GMH A;  2YR5 A;  3AE9 A;  4U8N A;  5KWF A;  1F8W A;  2E80 A;  2YG7 A;  3UU9 A;  5U25 A;  4GDP A;  3CIR A;  3FBS A;  3CPH G;  1DOD A;  3CTY A;  3BNU A;  1E7P A;  4C3Y A;  4Q0T A;  1VG0 A;  4EQW A;  3P9U A;  2WU5 A;  1YKJ A;  2O9Z A;  1X31 B;  4J2W A;  3CGB A;  5KVI A;  3G5S A;  2BA9 A;  3V3N A;  4HA6 A;  1CF3 A;  4CCR A;  1IUW A;  1H82 A;  3AYI A;  3FPZ A;  1E39 A;  5C2T A;  4C3X A;  3H4K A;  3P4S A;  1XAN A;  2YLZ A;  2C72 A;  5KOX A;  2WEU A;  1PN0 A;  4FX9 A;  2BXS A;  4K5R A;  3AE3 A;  5KMR A;  5JCK A;  2XLS A;  2ARD A;  4L3Z A;  2E1M A;  2JAE A;  3AEF A;  1YY5 A;  4X4J A;  3SQP A;  1CBO A;  2V5Z A;  4AP3 A;  2WP6 A;  4BK2 A;  4M52 A;  1QO8 A;  1PJ7 A;  2TMD A;  1CC2 A;  4G6H A;  4YTM A;  3CND A;  1DNC A;  4Y4M A;  2GEW A;  2NVK X;  3GMC A;  3VQR A;  4A9W A;  4Q17 A;  4HB9 A;  3C96 A;  4YKF A;  3RP6 A;  2WES A;  4X9N A;  3GYX A;  3M13 A;  1BZL A;  1PXA A;  1ZOV A;  2WDV A;  1FEA A;  2OLN A;  3UTG A;  4D04 A;  3CN8 A;  4YT0 A;  3FIM B;  4U8I A;  1H86 A;  4Y4N A;  5TR3 A;  1FOH A;  3WE0 A;  1PXC A;  2BK5 A;  4H4S A;  1O5W A;  4WX1 A;  4ZCD A;  3NK2 X;  2JBV A;  2XYO A;  4UDR A;  2YLX A;  2OT4 A;  1K0J A;  2C75 A;  3AYJ A;  3NHO X;  3D1C A;  1S3E A;  2C3C A;  2JK6 A;  2WU2 A;  4FK1 C;  1EL7 A;  3UP5 A;  1N4W A;  5KVH A;  2RF7 A;  3UKK A;  4EQX A;  1Z6L A;  3BHF A;  1H7W A;  2B9W A;  1EL9 A;  1IUT A;  2XVJ A;  2VQB A;  3GM6 A;  2BCP A;  2XFQ A;  2EQ9 A;  1PBD A;  4AP1 A;  1ZK7 A;  1MXT A;  4BK3 A;  1Y56 A;  1ZX9 A;  2BRA A;  1YQ4 A;  2FJE A;  2BAB A;  3ALL A;  3GSI A;  4I59 A;  4OVI A;  1EBD A;  3OWM A;  2WOV A;  1RSG A;  2OA1 A;  1CJ2 A;  2RGJ A;  2C76 A;  4NNJ A;  2J3N A;  2I0Z A;  4BJZ A;  4TM0 A;  5FS8 A;  2X8G A;  3OC4 A;  2XVF A;  3FO3 A;  3LXD A;  3AE2 A;  4L3Y A;  2QA1 A;  3NYE A;  1PJ5 A;  3II4 A;  4E0V A;  2R9Z A;  1ZMD A;  2B9X A;  3UCL A;  3AE5 A;  5HY5 A;  3BNJ A;  2EQ6 A;  1ZY8 A;  3EPT A;  4U8M A;  3NN0 X;  3QVR A;  4GR1 A;  3UOV A;  4EMW A;  4YSY A;  1IUU A;  1FT5 A;  1KNR A;  1EL8 A;  5J60 A;  2B7S A;  1RYI A;  1E1M A;  1TDO A;  5KXJ A;  2CVJ A;  2R0C A;  5EB4 A;  1E6E A;  2BXR A;  4U8O A;  3NYC A;  3COX A;  4H2N A;  2A8X A;  2GAH B;  2TPR A;  5EOW A;  5ER0 A;  3AEE A;  3PVC A;  2CDU A;  2VVM A;  1M64 A;  4YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...