1JRZA

Crystal structure of arg402tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTYDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C
publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 194
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrzA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrzA01
1TYTA 3BNMA 1NHQA 2AQJA 3CNSA 3FIMB 1O5WA 4H4YA 4I58A 4Z2UA 3GMCA 4TLXA 1Q1RA 2EQ7A 4BK2A 3NHOX 2C65A 2B7RA 1NDAA 2XVEA 3QSMA 3UTEA 1D7LA 3UP5A 2A89A 1FL2A 1KNPA 1RSGA 2C73A 2Q0KA 3D1IA 3FBSA 5FS7A 2R0CA 3KA7A 1F8SA 4D04A 3CIRA 1E39A 3K30A 1BWCA 4DGKA 1PBDA 1GERA 3ABVA 4P9SA 3UOZA 3UKPA 4EIPA 2R0PA 2CVJA 2RGJA 3V3OA 1BKWA 1QO8A 3R9UA 1ZOVA 5KVHA 1S3EA 3NRNA 5FMHA 4Y4NA 1L0VA 4J57A 4EQXA 4DNAA 2GQFA 4YSZA 2PYXA 2YLTA 4OPLA 2BS4A 1YQZA 3GWFA 2YG7A 1GU6A 4Z25A 1ZP0A 2EQ6A 3I6DA 4UP3A 3Q6JA 4BK3A 2ZZCA 4K8DA 1UKVG 3QSEA 4CCRA 5FS8A 4AT0A 3AEEA 3VR8A 3ZYXA 3DJEA 4WX1A 4PAAA 2BK3A 3G5SA 3QJ4A 1X31B 3T37A 4U8KA 4U8IA 2XLPA 4BK1A 4H2RA 4BJYA 5HY5A 1H7WA 3DH9A 1QLBA 2X99A 4OCGA 3VQRA 2V5ZA 2YVJA 1GETA 3AE8A 4C3XA 1H7XA 4YSHA 1MOKA 3K7MX 3CGDA 2XCGA 3NIXA 2J7AA 1GRGA 1GT8A 1PDHA 5JCMA 2VQ7A 1GV4A 3JSKA 4NZHA 2WPFA 2OAMA 4BJZA 2R4EA 5L46A 1CC6A 4H4WA 2RGOA 1M6IA 1KSSA 2QCUA 2X50A 2VVLA 4NTDA 3LZXA 2XDOA 3VR9A 1PS9A 2BCGG 4A65A 2FJBA 4YSXA 2B76A 2VR0A 2OLOA 2NPXA 2PHHA 3ICTA 4RG3A 2JB2A 3S5WA 4L3XA 1Y56B 3HZLA 4Z24A 4JNAA 2XYOA 3P9UA 4H4ZA 4ECHA 3GSIA 2C64A 4CNKA 2APGA 2WP9A 2Q6UA 2Y6RA 3CNDA 2GQWA 2E1MA 3F8DA 4J31A 3UU9A 1F3PA 1LTXR 2Q7VA 3CNTA 4OPGA 5FS6A 4Z44A 5HYMA 4XWZA 2BA9A 3RHAA 2YLRA 3PVCA 4M52A 2RGHA 4Q17A 4EQWA 5KOXA 4Q4UA 3C4AA 1B37A 2BXRA 4A79A 3RP7A 4K5SA 2WDRA 3AEBA 3FO3A 2C72A 3IF9A 4H50A 2X8CA 4H7UA 5C3JA 1N4UA 1FS7A 4IA5A 4H4RA 1N1PA 3EANA 4L38A 5IQ1A 2A8XA 3BI2A 1EL7A 2GR0A 3GDNA 1OJAA 2WEUA 3L1TA 4O5UA 2YLSA 1E1LA 1RYIA 2GMHA 1XHCA 1ZDLA 2JBVA 3B6DA 4K5RA 2R9ZA 3QSSA 2WQYA 3NYCA 2X8HA 1IUXA 2FJAA 1GSNA 1MXTA 3GYJA 4ADWA 1KDGA 3FG2P 3AYIA 4U2TA 4C5OA 1ELIA 4EM3A 4FK1A 2W0HA 3H8IA 5IPYA 1QJDA 2GAGB 3RP6A 3AE7A 1VG9A 3AECA 4WJYA 3CTYA 2XFNA 1VG0A 3LOVA 1SP3A 2E4GA 2Z5YA 3PS9A 4B66A 1CJ4A 5EB4A 3O0HA 2I0ZA 2YAUA 2BABA 3D8XA 5DBJA 2FJDA 1EBDA 1GOSA 1K4QA 3DGHA 3GRSA 1CHUA 3ALMA 3AE9A 3UCLA 4CNJA 1B4VA 3F8RA 4YWOA 1FECA 5EBKA 3QVPA 3SGLA 1NHRA 1EL8A 2C70A 2QA1A 3NYEA 1XDIA 3QVRA 4EM4A 1JNZA 1OJCA 2V61A 2XVFA 4H2NA 1F8RA 2VZ2A 3S61A 4CRTA 4EMWA 4XXGA 1DOEA 4EIQA 1TDFA 1YQ4A 4AOXA 4Q5CA 4NEWA 4KX6A 1CJ3A 1JOAA 4NEVA 1M1RA 2BACA 1NAAA 1IJHA 4GF7A 3UBRA 3NTAA 3ZDNA 4H4UA 2GR3A 1ZOYA 3QFAA 4CBQA 3M12A 2J3NA 3KLJA 4AT2A 2FBWA 3LZWA 1K0JA 5LV9A 1V59A 2Q0LA 5JCIA 4K2XA 5KXJA 3AD7B 3KU9A 3II4A 4UDRA 3LG1A 3ATQA 1ONFA 3FPZA 2BS3A 3ATRA 3VRDB 4EMJA 2WP5A 4C3YA 4ZN0A 3AD9B 2BXSA 1DJNA 3UTGA 1O95A 5BRTA 4ZCCA 1JU2A 1H86A 1PHHA 4H2QA 1L9DA 3I3LA 3P1WA 4H4SA 4YSYA 2K3VA 1H83A 2GR2A 1ZMCA 4X4JA 4TM3A 1GESA 2OALA 3NT6A 2BK5A 1GRHA 2V3BA 4GCMA 4YTNA 3UTFA 4H2PA 3B3RA 2B9YA 1H82A 1FT5A 3AE1A 5M0ZA 4FK1C 2ZO5A 1LV0A 2CFYA 3CN8A 3E1TA 4C77A 1NHSA 3NN0X 1D4EA 1TRBA 2DKHA 1FEAA 3AE6A 2GRTA 1LQUA 2C7GA 2JB1A 4DSHA 3UOYA 4U8NA 1LQTA 3LGQA 1CC2A 3S7WA 3NKSA 4JY3A 4USQA 3UKLA 1PXAA 1PN0A 1W4XA 1CJ2A 2YM1A 3KPFA 4J56A 1K0LA 5KOWA 3KVEA 4YKGA 4JNQA 5BULA 1FT6A 2R0GA 3ALJA 3IHGA 1FEBA 3OZ2A 1P2EA 3NLCA 1B8SA 2ZZ0A 4N9XA 3AEAA 1IUTA 1JNIA 1EL9A 4YT0A 1YY5A 3BHFA 2TMDA 3TTBA 1D5TA 3CNPA 1F8WA 4H4QA 2JAEA 1PBEA 4U2LA 3GYXA 2YM2A 3WE0A 1E1KA 3REDA 1TDOA 3EPTA 4D03A 1F6MA 2IIDA 1DOCA 2GH5A 3CPIG 4RG4A 4U8OA 1PBFA 4X9MA 4MJWA 4U8JA 4LIIA 2E80A 4LU6A 3LADA 1DOBA 2VVLG 3CNJA 4A5LA 4B69A 2AR8A 2XFUA 4Z26A 1PXCA 3OWMA 1JRZA 4Z43A 4JN9A 1CC4A 2QA2A 4BURA 4J33A 3F8PA 3BNUA 4J2WA 4B68A 3AEFA 5U1OA 5J7XA 4Q1OA 2C3CA 4LA1A 1BF3A 3EAOA 1L9EA 2H89A 1N4VA 2XLUA 3ADAB 3BI5A 3H8LA 1PJ5A 5FS9A 4OVIA 5CKUA 1ZMDA 2C76A 3ALLA 3NGCX 2ARDA 3Q9TA 4OPIA 4U8LA 4L3ZA 1BGJA 1IUWA 3BNGA 3C4NA 3NG7X 2XLTA 3DK8A 3IC9A 2YG6A 2IVDA 3AE2A 4EQSA 3RNMA 4Q0TA 1VRQB 1COYA 2X8GA 2WDVA 1YKJA 3KKJA 5U25A 4K22A 1GTHA 1DODA 3L1RA 2YR5A 2QAEA 1TDKA 1CJCA 2FJEA 2X3NA 5ER0A 5BVAA 2YR4A 3K7TA 3DK4A 1CL0A 2XFQA 2YVGA 2GB0A 2C3DA 5BUKA 1PJ6A 1NEKA 2C66A 1LJ1A 2B7SA 2DKIA 2YLZA 3DJGX 2WETA 1S2QA 1S2YA 3ICSA 3F29A 2XLSA 4AOSA 2GR1A 3AB1A 4GDEA 2WHDA 3SFEA 2OT4A 5JCNA 5GSNA 3UOVA 3P4PA 4K7ZA 2E5VA 1GRTA 3BNHA 3VRAA 3ICRA 3DJDA 1Q9IA 4OPDA 1H84A 1LVLA 1M64A 2YG5A 2VOUA 3SQPA 1M1PA 2BK4A 1L9CA 2VRLA 5CQFA 4YTMA 4CCQA 5J60A 1GXFA 2WPEA 1GALA 4UDQA 3SXQA 1Z6LA 1PBCA 3GMBA 3CGCA 1E1NA 4O5QA 4ZCDA 2Z5XA 4B65A 2O9ZA 4BV6A 4GDPA 1BGNA 1XPQA 2EQ9A 4GRTA 4U8MA 2GEWA 3SFDA 1NENA 1OJ9A 2JB3A 3GWDA 3H4KA 4KPRA 2YLWA 2YLXA 4B67A 2WOVA 1E1MA 4Q5BA 1KFYA 2XFOA 2IVEA 2V60A 1PJ7A 2ZBWA 2YR6A 4PABA 4RSLA 4AP3A 1OAHA 3AYJA 2WBAA 2CULA 2XVIA 2BCPA 2ACZA 2GVCA 3AE4A 4H4TA 2BC1A 1VQWA 4JQ9A 1QDBA 3LXDA 3CPJG 4HB9A 2A87A 1AOGA 3URHA 3MMOA 5IQ4A 4H4PA 1ZX9A 4A99A 4U8PA 3NTDA 2BC0A 2WS3A 3GDPA 2VRMA 3LB8A 1TDNA 3NK1X 4A7AA 1Y0PA 4YKFA 1O94A 3PO7A 3M0OA 2EQ8A 2WPCA 3NH3X 3UKHA 3UKKA 4EQRA 3BNJA 1FCDA 1OJTA 2RABA 2WOWA 4Y4LA 3L8KA 3KD9A 2ZZBA 3G5RA 2B9WA 1DXLA 3NK2X 1FS8A 2RF7A 2C67A 3AE5A 3NK0X 1NPXA 1BVBA 3D1CA 2Y6QA 4OPUA 1N4WA 3GM6A 3UKQA 2YWLA 2BYBA 2XLRA 3ISHA 2CDUA 3QFBA 4DSGA 2V3AA 3P4RA 2VVMA 3VRBA 4REKA 2YQUA 1E7PA 1FOHA 3FMWA 4IV9A 2R45A 3AE3A 5HHFA 4NTEA 1JNRA 4B64A 4CY6A 1MO9A 3V3NA 1KNRA 3DA1A 1NHPA 1IUUA 2HQMA 3AD8B 1Q1WA 2LFCA 1GTEA 5KVIA 1Y56A 2UZZA 5JCKA 2YG4A 3NYFA 2GAHB 2B9XA 1REOA 4FDCB 2TPRA 4X9NA 3UP4A 5M10A 2OLNA 3UTHA 5EOWA 3UKFA 4J34A 4EMIA 3AWIA 1NG3A 2XVJA 4TM0A 1SEZA 2GF3A 4B1BA 1P2HA 5HXIA 2R4JA 1OJDA 1FS9A 1ZY8A 1D4DA 4B63A 3DGZA 4YTPA 1GRAA 3C96A 4GR1A 5U63A 2RDZA 2V6OA 4A6NA 1GRBA 1NG4A 4JDRA 3DJJA 5KRQA 3BNFA 4C74A 3SM8A 1BZLA 3CGBA 1YQ3A 3AXBA 3IHMA 1D7YA 4CY8A 4Z2TA 4Y4MA 2OA1A 3K7QX 3NNEA 3DMEA 1ZKQA 2WOIA 2BS2A 2H88A 3BHKA 3NN6X 1IUSA 3RKHA 2JK6A 3V76A 1JRXA 2YG3A 3UOXA 1TYPA 2WP6A 1CBOA 1KF6A 4WCTA 3COXA 2R46A 3EF6A 4E0VA 3IWAA 1RP0A 2AAQA 1GRFA 3RP8A 5GRTA 4I59A 4AP1A 2VQBA 1DJQA 1LPFA 4TM4A 1B5QA 1JRYA 1KSUA 3LJPA 4USRA 3AEDA 4TLZA 1PXBA 3G5QA 4U2SA 5JCLA 2NVKX 2JKCA 4A6NB 1JEHA 2WESA 2GMJA 1S3BA 2WU5A 3ITJA 1E6EA 1M1QA 2YVFA 4OPTA 1GNDA 4YXDA 1HYUA 4UDPA 4NTCA 2F5ZA 5C2TA 3SCEA 1H81A 3GRTA 3TORA 3P4QA 4JY2A 3BI4A 4IVOB 4HA6A 5KWFA 2E81A 3UKAA 4Z2RA 4TM1A 1GREA 2WDQA 4XWRA 3DK9A 3CGEA 4GUVA 3GD3A 1TDEA 1VDCA 1PBBA 3P4SA 1GPEA 4H4XA 1ZK7A 5EB5A 4IA6A 1DNCA 1H6VA 4L3YA 2XVHA 4ICYA 4H4VA 3AEGA 4APNA 5TR3A 2WU2A 1GEUA 1D4CA 1K0IA 3CPHG 4FX9A 1CF3A 2GV8A 2C75A 3GYIA 3OC4A 3GD4A 1IUVA 4J36A 4A9WA 2XFPA 3M13A 3AYLA 4IVMB 1XANA 1EL5A 4OPCA
chains in the Genus database with same CATH superfamily
1TYTA 3BNMA 1NHQA 2AQJA 3CNSA 3FIMB 1O5WA 4H4YA 4I58A 4II3A 4Z2UA 3GMCA 4TLXA 1Q1RA 2EQ7A 4BK2A 3NHOX 2C65A 2B7RA 1NDAA 2XVEA 3QSMA 3UTEA 1D7LA 3UP5A 2A89A 1FL2A 1KNPA 1RSGA 2C73A 2Q0KA 3D1IA 3FBSA 5FS7A 2R0CA 3KA7A 1F8SA 4D04A 3CIRA 1E39A 3K30A 1BWCA 4DGKA 1PBDA 1GERA 3ABVA 4P9SA 3UOZA 3UKPA 4EIPA 2R0PA 2CVJA 2RGJA 3V3OA 1BKWA 1QO8A 3R9UA 1ZOVA 5KVHA 1S3EA 3NRNA 5FMHA 4Y4NA 1L0VA 4J57A 4EQXA 4DNAA 2GQFA 4YSZA 2PYXA 2YLTA 4OPLA 2BS4A 1YQZA 3GWFA 2YG7A 1GU6A 4Z25A 4G73A 1ZP0A 2EQ6A 3I6DA 4UP3A 3Q6JA 3T0KA 4BK3A 2ZZCA 4K8DA 1UKVG 3QSEA 4CCRA 5FS8A 4AT0A 3AEEA 3VR8A 3ZYXA 3DJEA 3SYIA 4WX1A 4PAAA 2BK3A 3G5SA 3QJ4A 1X31B 3T37A 4U8KA 4U8IA 2XLPA 4BK1A 4H2RA 4BJYA 5HY5A 1H7WA 3DH9A 1QLBA 2X99A 4OCGA 3VQRA 2V5ZA 2YVJA 1GETA 3AE8A 4C3XA 1H7XA 4YSHA 1MOKA 3K7MX 3CGDA 2XCGA 3NIXA 2J7AA 1GRGA 1GT8A 1PDHA 5JCMA 2VQ7A 1GV4A 3JSKA 4NZHA 2WPFA 2OAMA 4BJZA 2R4EA 5L46A 1CC6A 4H4WA 2RGOA 1M6IA 1KSSA 2QCUA 2X50A 2VVLA 4NTDA 3LZXA 2XDOA 3VR9A 1PS9A 2BCGG 4A65A 2FJBA 4YSXA 2B76A 2VR0A 2OLOA 2NPXA 2PHHA 3T31A 3ICTA 4RG3A 2JB2A 4A7AA 3S5WA 4L3XA 1Y56B 3HZLA 4Z24A 4JNAA 3SZWA 2XYOA 3P9UA 4H4ZA 4ECHA 3GSIA 2C64A 4CNKA 2APGA 2WP9A 2Q6UA 2Y6RA 3CNDA 2GQWA 2E1MA 3F8DA 4J31A 3UU9A 1F3PA 1LTXR 2Q7VA 3CNTA 3CMMA 4OPGA 5FS6A 4Z44A 4XWZA 2BA9A 3RHAA 2YLRA 5HYMA 3PVCA 4M52A 2RGHA 4Q17A 4EQWA 5KOXA 4Q4UA 3C4AA 1B37A 2BXRA 4A79A 3RP7A 4K5SA 2WDRA 3AEBA 3FO3A 2C72A 3IF9A 4H50A 2X8CA 4H7UA 5C3JA 1N4UA 1FS7A 4IA5A 4H4RA 1N1PA 3EANA 4L38A 5IQ1A 2A8XA 3BI2A 1EL7A 2GR0A 3GDNA 1OJAA 2WEUA 3L1TA 4O5UA 2YLSA 1E1LA 3HYXA 1RYIA 2GMHA 1XHCA 1ZDLA 2JBVA 3B6DA 4K5RA 2R9ZA 3QSSA 2WQYA 3NYCA 2X8HA 1IUXA 2FJAA 1GSNA 3SZCA 1MXTA 3GYJA 3SY4A 4ADWA 1KDGA 3FG2P 3AYIA 4U2TA 4C5OA 1ELIA 4EM3A 4FK1A 2W0HA 3H8IA 5IPYA 1QJDA 2GAGB 3RP6A 3AE7A 1VG9A 3AECA 4WJYA 3CTYA 2XFNA 1VG0A 3LOVA 1SP3A 2E4GA 2Z5YA 3PS9A 4B66A 1CJ4A 5EB4A 3O0HA 2I0ZA 2YAUA 2BABA 3D8XA 5DBJA 2FJDA 1EBDA 1GOSA 1K4QA 3DGHA 3GRSA 1CHUA 3ALMA 3AE9A 3UCLA 4CNJA 1B4VA 3F8RA 4YWOA 1FECA 5EBKA 3QVPA 3SGLA 1NHRA 1EL8A 2C70A 2QA1A 3NYEA 1XDIA 3QVRA 4EM4A 1JNZA 1OJCA 2V61A 2XVFA 4H2NA 1F8RA 2VZ2A 3S61A 4CRTA 4EMWA 4XXGA 1DOEA 4EIQA 1TDFA 1YQ4A 4AOXA 4Q5CA 4NEWA 4KX6A 1CJ3A 1JOAA 4NEVA 1M1RA 2BACA 1NAAA 1IJHA 4GF7A 3UBRA 3NTAA 3ZDNA 4H4UA 2GR3A 1ZOYA 3QFAA 3SX6A 4CBQA 3M12A 2J3NA 3KLJA 4AT2A 2FBWA 3LZWA 1K0JA 5LV9A 1V59A 2Q0LA 5JCIA 2CZSA 4K2XA 5KXJA 3AD7B 3KU9A 3HYWA 3II4A 3LG1A 3ATQA 1ONFA 3FPZA 2BS3A 3ATRA 4UDRA 4EMJA 2WP5A 4C3YA 4ZN0A 3AD9B 2BXSA 1DJNA 3UTGA 1O95A 5BRTA 4ZCCA 1JU2A 1H86A 1PHHA 4H2QA 1L9DA 3I3LA 3P1WA 4H4SA 4YSYA 2K3VA 1H83A 2GR2A 1ZMCA 4X4JA 4TM3A 1GESA 2OALA 3NT6A 2BK5A 1GRHA 2V3BA 4GCMA 4YTNA 3UTFA 4H2PA 3B3RA 2B9YA 1H82A 1FT5A 3AE1A 5M0ZA 4FK1C 2ZO5A 1LV0A 2CFYA 3CN8A 3E1TA 4C77A 1NHSA 3NN0X 1D4EA 1TRBA 2DKHA 1FEAA 3AE6A 2GRTA 1LQUA 2C7GA 2JB1A 3VRDB 4DSHA 3UOYA 4NWZA 4U8NA 1LQTA 3LGQA 1CC2A 3S7WA 3NKSA 4JY3A 4USQA 3UKLA 1PXAA 3SZFA 1PN0A 1W4XA 1CJ2A 2YM1A 3KPFA 4J56A 1K0LA 5KOWA 3KVEA 4YKGA 4JNQA 5BULA 1FT6A 2R0GA 3ALJA 3IHGA 1FEBA 3OZ2A 1P2EA 3NLCA 1B8SA 2ZZ0A 4N9XA 3AEAA 5KMQA 1IUTA 1JNIA 1EL9A 4YT0A 1YY5A 3BHFA 2TMDA 3TTBA 1D5TA 3CNPA 1F8WA 4H4QA 2JAEA 1PBEA 4U2LA 3GYXA 2YM2A 3T2ZA 1E1KA 3REDA 1TDOA 3EPTA 3WE0A 4D03A 1F6MA 2IIDA 1DOCA 2GH5A 3CPIG 4RG4A 4U8OA 1PBFA 3T14A 5KMRA 4X9MA 4MJWA 4U8JA 4LIIA 3SXIA 2E80A 4LU6A 3LADA 1DOBA 2VVLG 3CNJA 4A5LA 4B69A 2AR8A 2XFUA 4Z26A 1PXCA 3OWMA 1JRZA 4Z43A 4JN9A 1CC4A 2QA2A 4BURA 4J33A 3F8PA 3BNUA 4J2WA 4B68A 3AEFA 3HYVA 5U1OA 5J7XA 4Q1OA 2C3CA 4LA1A 1BF3A 3EAOA 1L9EA 2H89A 2C4CA 1N4VA 2XLUA 3ADAB 3BI5A 3H8LA 1PJ5A 5FS9A 4OVIA 5CKUA 1ZMDA 2C76A 3ALLA 3NGCX 2ARDA 3Q9TA 4OPIA 4U8LA 4L3ZA 1BGJA 1IUWA 3BNGA 3C4NA 3NG7X 2XLTA 3DK8A 3IC9A 2YG6A 2IVDA 3AE2A 4EQSA 3RNMA 4Q0TA 1VRQB 1COYA 2X8GA 2WDVA 1YKJA 3KKJA 5U25A 4K22A 1GTHA 1DODA 3L1RA 2YR5A 2QAEA 1TDKA 1CJCA 2FJEA 2X3NA 5ER0A 5BVAA 2YR4A 3K7TA 3DK4A 1CL0A 2XFQA 2YVGA 2GB0A 2C3DA 5BUKA 1PJ6A 1NEKA 2C66A 1LJ1A 2B7SA 2DKIA 2YLZA 3DJGX 2WETA 1S2QA 1S2YA 3ICSA 3F29A 2XLSA 4AOSA 2GR1A 3AB1A 4GDEA 2WHDA 3SFEA 2OT4A 5JCNA 5GSNA 3UOVA 3P4PA 4K7ZA 2E5VA 1GRTA 3BNHA 3VRAA 3ICRA 3DJDA 1Q9IA 4OPDA 1H84A 1LVLA 1M64A 2YG5A 2VOUA 3SQPA 1M1PA 2BK4A 1L9CA 2VRLA 5CQFA 4YTMA 4CCQA 5J60A 1GXFA 2WPEA 1GALA 4UDQA 3SXQA 1Z6LA 1PBCA 3GMBA 3CGCA 1E1NA 4O5QA 4ZCDA 2Z5XA 3T2YA 4B65A 2O9ZA 4BV6A 4GDPA 1BGNA 1XPQA 2EQ9A 4GRTA 4U8MA 2GEWA 3SFDA 1NENA 1OJ9A 2JB3A 3GWDA 3H4KA 4KPRA 2YLWA 2YLXA 4B67A 2WOVA 1E1MA 4Q5BA 1KFYA 2XFOA 2IVEA 2V60A 1PJ7A 2ZBWA 2YR6A 4PABA 4RSLA 4AP3A 1OAHA 3AYJA 2WBAA 2CULA 2XVIA 2BCPA 2ACZA 2GVCA 3AE4A 4H4TA 3SZ0A 2BC1A 1VQWA 4JQ9A 1QDBA 3LXDA 3CPJG 4HB9A 2A87A 1AOGA 3URHA 3MMOA 5IQ4A 4H4PA 4II2A 1ZX9A 4A99A 4U8PA 3NTDA 2BC0A 2WS3A 3GDPA 2VRMA 3LB8A 1TDNA 3NK1X 4G9KA 1Y0PA 4YKFA 1O94A 3PO7A 3M0OA 2EQ8A 2WPCA 3NH3X 4G74A 4GAVA 3UKHA 3UKKA 4EQRA 3BNJA 1FCDA 1OJTA 2RABA 2WOWA 4Y4LA 3L8KA 3KD9A 2ZZBA 2BRAA 3G5RA 2B9WA 1DXLA 3NK2X 1FS8A 2RF7A 2C67A 3AE5A 3NK0X 1NPXA 1BVBA 3D1CA 2Y6QA 4OPUA 1N4WA 3GM6A 3UKQA 2YWLA 2BYBA 2XLRA 3ISHA 2CDUA 3QFBA 4DSGA 2V3AA 3P4RA 2VVMA 3VRBA 4REKA 2YQUA 1E7PA 1FOHA 3FMWA 4IV9A 2R45A 3AE3A 5HHFA 4NTEA 1JNRA 4B64A 4CY6A 1MO9A 3V3NA 1KNRA 3DA1A 1NHPA 1IUUA 2HQMA 3AD8B 1Q1WA 2LFCA 1GTEA 5KVIA 1Y56A 2UZZA 2BRYA 2YG4A 3NYFA 5JCKA 2GAHB 2B9XA 1REOA 4FDCB 2TPRA 4X9NA 3UP4A 5M10A 2OLNA 3UTHA 5KMPA 5EOWA 3UKFA 4GAPA 4J34A 3AWIA 4EMIA 1NG3A 2XVJA 4TM0A 1SEZA 2GF3A 4B1BA 1P2HA 5HXIA 2R4JA 1OJDA 1FS9A 1ZY8A 1D4DA 4B63A 3DGZA 4YTPA 1GRAA 3C96A 4GR1A 5U63A 2RDZA 2V6OA 4A6NA 1GRBA 1NG4A 4JDRA 4G6HA 3DJJA 5KRQA 3BNFA 4NNJA 4C74A 3SM8A 1BZLA 3CGBA 1YQ3A 3AXBA 3IHMA 1D7YA 4CY8A 4Z2TA 4Y4MA 2OA1A 3K7QX 3NNEA 3DMEA 1ZKQA 2WOIA 2BS2A 2H88A 3BHKA 3NN6X 3T2KA 1IUSA 3RKHA 2JK6A 3V76A 1JRXA 2YG3A 3UOXA 1TYPA 2WP6A 1CBOA 1KF6A 4WCTA 3COXA 2R46A 3EF6A 4E0VA 3IWAA 1RP0A 2AAQA 1GRFA 3RP8A 5GRTA 4I59A 4AP1A 2VQBA 1DJQA 1LPFA 4TM4A 1B5QA 1JRYA 1KSUA 3LJPA 4USRA 3AEDA 4TLZA 1PXBA 3G5QA 4U2SA 5JCLA 2NVKX 2JKCA 4A6NB 1JEHA 2WESA 2GMJA 1S3BA 2WU5A 3ITJA 1E6EA 1M1QA 2YVFA 4OPTA 1GNDA 4YXDA 1HYUA 4UDPA 4NTCA 5KNLA 2F5ZA 5C2TA 3SCEA 1H81A 3GRTA 3TORA 3P4QA 4JY2A 3BI4A 4IVOB 4HA6A 4G6GA 5KWFA 2E81A 3UKAA 4Z2RA 4TM1A 1GREA 2WDQA 4XWRA 3DK9A 3CGEA 4GUVA 3GD3A 1TDEA 1VDCA 1PBBA 3P4SA 1GPEA 4H4XA 1ZK7A 5EB5A 4IA6A 1DNCA 1H6VA 4L3YA 2XVHA 4ICYA 4H4VA 3AEGA 4APNA 5TR3A 2WU2A 1GEUA 3KPKA 5KMSA 1D4CA 1K0IA 3CPHG 4FX9A 1CF3A 2GV8A 2C75A 3GYIA 3OC4A 3GD4A 1IUVA 4J36A 4A9WA 2XFPA 3M13A 3AYLA 4IVMB 1XANA 1EL5A 4OPCA
chains in the Genus database with same CATH topology
1TYTA 3BNMA 1NHQA 2AQJA 3CNSA 3FIMB 1O5WA 4H4YA 4I58A 4II3A 4Z2UA 3GMCA 4TLXA 1Q1RA 2EQ7A 4BK2A 3NHOX 2C65A 2B7RA 1NDAA 2XVEA 3QSMA 3UTEA 1D7LA 3UP5A 2A89A 1FL2A 1KNPA 1RSGA 2C73A 2Q0KA 3D1IA 3FBSA 5FS7A 2R0CA 3KA7A 1F8SA 4D04A 3CIRA 1E39A 3K30A 1BWCA 4DGKA 1PBDA 1GERA 3ABVA 4P9SA 3UOZA 3UKPA 4EIPA 2R0PA 2CVJA 2RGJA 3V3OA 1BKWA 1QO8A 3R9UA 1ZOVA 5KVHA 1S3EA 3NRNA 5FMHA 4Y4NA 1L0VA 4J57A 4EQXA 4DNAA 2GQFA 4YSZA 2PYXA 2YLTA 4OPLA 2BS4A 1YQZA 3GWFA 2YG7A 1GU6A 4Z25A 4G73A 1ZP0A 2EQ6A 3I6DA 4UP3A 3Q6JA 3T0KA 4BK3A 2ZZCA 4K8DA 1UKVG 3QSEA 4CCRA 5FS8A 4AT0A 3AEEA 3VR8A 3ZYXA 3DJEA 3SYIA 4WX1A 4PAAA 2BK3A 3G5SA 3QJ4A 1X31B 3T37A 4U8KA 4U8IA 2XLPA 4BK1A 4H2RA 4BJYA 5HY5A 1H7WA 3DH9A 1QLBA 2X99A 4OCGA 3VQRA 2V5ZA 2YVJA 1GETA 3AE8A 4C3XA 1H7XA 4YSHA 1MOKA 3K7MX 3CGDA 2XCGA 3NIXA 2J7AA 1GRGA 1GT8A 1PDHA 5JCMA 2VQ7A 1GV4A 3JSKA 4NZHA 2WPFA 2OAMA 4BJZA 2R4EA 5L46A 1CC6A 4H4WA 2RGOA 1M6IA 1KSSA 2QCUA 2X50A 2VVLA 4NTDA 3LZXA 2XDOA 3VR9A 1PS9A 2BCGG 4A65A 2FJBA 4YSXA 2B76A 2VR0A 2OLOA 2NPXA 2PHHA 3T31A 3ICTA 4RG3A 2JB2A 4A7AA 3S5WA 4L3XA 1Y56B 3HZLA 4Z24A 4JNAA 3SZWA 2XYOA 3P9UA 4H4ZA 4ECHA 3GSIA 2C64A 4CNKA 2APGA 2WP9A 2Q6UA 2Y6RA 3CNDA 2GQWA 2E1MA 3F8DA 4J31A 3UU9A 1F3PA 1LTXR 2Q7VA 3CNTA 3CMMA 4OPGA 5FS6A 4Z44A 4XWZA 2BA9A 3RHAA 2YLRA 5HYMA 3PVCA 4M52A 2RGHA 4Q17A 4EQWA 5KOXA 4Q4UA 3C4AA 1B37A 2BXRA 4A79A 3RP7A 4K5SA 2WDRA 3AEBA 3FO3A 2C72A 3IF9A 4H50A 2X8CA 4H7UA 5C3JA 1N4UA 1FS7A 4IA5A 4H4RA 1N1PA 3EANA 4L38A 5IQ1A 2A8XA 3BI2A 1EL7A 2GR0A 3GDNA 1OJAA 2WEUA 3L1TA 4O5UA 2YLSA 1E1LA 3HYXA 1RYIA 2GMHA 1XHCA 1ZDLA 2JBVA 3B6DA 4K5RA 2R9ZA 3QSSA 2WQYA 3NYCA 2X8HA 1IUXA 2FJAA 1GSNA 3SZCA 1MXTA 3GYJA 3SY4A 4ADWA 1KDGA 3FG2P 3AYIA 4U2TA 4C5OA 1ELIA 4EM3A 4FK1A 2W0HA 3H8IA 5IPYA 1QJDA 2GAGB 3RP6A 3AE7A 1VG9A 3AECA 4WJYA 3CTYA 2XFNA 1VG0A 3LOVA 1SP3A 2E4GA 2Z5YA 3PS9A 4B66A 1CJ4A 5EB4A 3O0HA 2I0ZA 2YAUA 2BABA 3D8XA 5DBJA 2FJDA 1EBDA 1GOSA 1K4QA 3DGHA 3GRSA 1CHUA 3ALMA 3AE9A 3UCLA 4CNJA 1B4VA 3F8RA 4YWOA 1FECA 5EBKA 3QVPA 3SGLA 1NHRA 1EL8A 2C70A 2QA1A 3NYEA 1XDIA 3QVRA 4EM4A 1JNZA 1OJCA 2V61A 2XVFA 4H2NA 1F8RA 2VZ2A 3S61A 4CRTA 4EMWA 4XXGA 1DOEA 4EIQA 1TDFA 1YQ4A 4AOXA 4Q5CA 4NEWA 4KX6A 1CJ3A 1JOAA 4NEVA 1M1RA 2BACA 1NAAA 1IJHA 4GF7A 3UBRA 3NTAA 3ZDNA 4H4UA 2GR3A 1ZOYA 3QFAA 3SX6A 4CBQA 3M12A 2J3NA 3KLJA 4AT2A 2FBWA 3LZWA 1K0JA 5LV9A 1V59A 2Q0LA 5JCIA 4K2XA 5KXJA 3AD7B 3KU9A 3HYWA 3II4A 3LG1A 3ATQA 1ONFA 3FPZA 2BS3A 3ATRA 4UDRA 4EMJA 2WP5A 4C3YA 4ZN0A 3AD9B 2BXSA 1DJNA 3UTGA 1O95A 5BRTA 4ZCCA 1JU2A 1H86A 1PHHA 4H2QA 1L9DA 3I3LA 3P1WA 4H4SA 4YSYA 2K3VA 1H83A 2GR2A 1ZMCA 4X4JA 4TM3A 1GESA 2OALA 3NT6A 2BK5A 1GRHA 2V3BA 4GCMA 4YTNA 3UTFA 4H2PA 3B3RA 2B9YA 1H82A 1FT5A 3AE1A 5M0ZA 4FK1C 2ZO5A 1LV0A 2CFYA 3CN8A 3E1TA 4C77A 1NHSA 3NN0X 1D4EA 1TRBA 2DKHA 1FEAA 3AE6A 2GRTA 1LQUA 2C7GA 2JB1A 3VRDB 4DSHA 3UOYA 4NWZA 4U8NA 1LQTA 3LGQA 1CC2A 3S7WA 3NKSA 4JY3A 4USQA 3UKLA 1PXAA 3SZFA 1PN0A 1W4XA 1CJ2A 2YM1A 3KPFA 4J56A 1K0LA 5KOWA 3KVEA 4YKGA 4JNQA 5BULA 1FT6A 2R0GA 3ALJA 3IHGA 1FEBA 3OZ2A 1P2EA 3NLCA 1B8SA 2ZZ0A 4N9XA 3AEAA 5KMQA 1IUTA 1JNIA 1EL9A 4YT0A 1YY5A 3BHFA 2TMDA 3TTBA 1D5TA 3CNPA 1F8WA 4H4QA 2JAEA 1PBEA 4U2LA 3GYXA 2YM2A 3T2ZA 1E1KA 3REDA 1TDOA 3EPTA 3WE0A 4D03A 1F6MA 2IIDA 1DOCA 2GH5A 3CPIG 4RG4A 4U8OA 1PBFA 3T14A 5KMRA 4X9MA 4MJWA 4U8JA 4LIIA 3SXIA 2E80A 4LU6A 3LADA 1DOBA 2VVLG 3CNJA 4A5LA 4B69A 2AR8A 2XFUA 4Z26A 1PXCA 3OWMA 1JRZA 4Z43A 4JN9A 1CC4A 2QA2A 4BURA 4J33A 3F8PA 3BNUA 4J2WA 4B68A 3AEFA 3HYVA 5U1OA 5J7XA 4Q1OA 2C3CA 4LA1A 1BF3A 3EAOA 1L9EA 2H89A 2C4CA 1N4VA 2XLUA 3ADAB 3BI5A 3H8LA 1PJ5A 5FS9A 4OVIA 5CKUA 1ZMDA 2C76A 3ALLA 3NGCX 2ARDA 3Q9TA 4OPIA 4U8LA 4L3ZA 1BGJA 1IUWA 3BNGA 3C4NA 3NG7X 2XLTA 3DK8A 3IC9A 2YG6A 2IVDA 3AE2A 4EQSA 3RNMA 4Q0TA 1VRQB 1COYA 2X8GA 2WDVA 1YKJA 3KKJA 5U25A 4K22A 1GTHA 1DODA 3L1RA 2YR5A 2QAEA 1TDKA 1CJCA 2FJEA 2X3NA 5ER0A 5BVAA 2YR4A 3K7TA 3DK4A 1CL0A 2XFQA 2YVGA 2GB0A 2C3DA 5BUKA 1PJ6A 1NEKA 2C66A 1LJ1A 2B7SA 2DKIA 2YLZA 3DJGX 2WETA 1S2QA 1S2YA 3ICSA 3F29A 2XLSA 4AOSA 2GR1A 3AB1A 4GDEA 2WHDA 3SFEA 2OT4A 5JCNA 5GSNA 3UOVA 3P4PA 4K7ZA 2E5VA 1GRTA 3BNHA 3VRAA 3ICRA 3DJDA 1Q9IA 4OPDA 1H84A 1LVLA 1M64A 2YG5A 2VOUA 3SQPA 1M1PA 2BK4A 1L9CA 2VRLA 5CQFA 4YTMA 4CCQA 5J60A 1GXFA 2WPEA 1GALA 4UDQA 3SXQA 1Z6LA 1PBCA 3GMBA 3CGCA 1E1NA 4O5QA 4ZCDA 2Z5XA 3T2YA 4B65A 2O9ZA 4BV6A 4GDPA 1BGNA 1XPQA 2EQ9A 4GRTA 4U8MA 2GEWA 3SFDA 1NENA 1OJ9A 2JB3A 3GWDA 3H4KA 4KPRA 2YLWA 2YLXA 4B67A 2WOVA 1E1MA 4Q5BA 1KFYA 2XFOA 2IVEA 2V60A 1PJ7A 2ZBWA 2YR6A 4PABA 4RSLA 4AP3A 1OAHA 3AYJA 2WBAA 2CULA 2XVIA 2BCPA 2ACZA 2GVCA 3AE4A 4H4TA 3SZ0A 2BC1A 1VQWA 4JQ9A 1QDBA 3LXDA 3CPJG 4HB9A 2A87A 1AOGA 3URHA 3MMOA 5IQ4A 4H4PA 4II2A 1ZX9A 4A99A 4U8PA 3NTDA 2BC0A 2WS3A 3GDPA 2VRMA 3LB8A 1TDNA 3NK1X 4G9KA 1Y0PA 4YKFA 1O94A 3PO7A 3M0OA 2EQ8A 2WPCA 3NH3X 4G74A 4GAVA 3UKHA 3UKKA 4EQRA 3BNJA 1FCDA 1OJTA 2RABA 2WOWA 4Y4LA 3L8KA 3KD9A 2ZZBA 2BRAA 3G5RA 2B9WA 1DXLA 3NK2X 1FS8A 2RF7A 2C67A 3AE5A 3NK0X 1NPXA 1BVBA 3D1CA 2Y6QA 4OPUA 1N4WA 3GM6A 3UKQA 2YWLA 2BYBA 2XLRA 3ISHA 2CDUA 3QFBA 4DSGA 2V3AA 3P4RA 2VVMA 3VRBA 4REKA 2YQUA 1E7PA 1FOHA 3FMWA 4IV9A 2R45A 3AE3A 5HHFA 4NTEA 1JNRA 4B64A 4CY6A 1MO9A 3V3NA 1KNRA 3DA1A 1NHPA 1IUUA 2HQMA 3AD8B 1Q1WA 2LFCA 1GTEA 5KVIA 1Y56A 2UZZA 2BRYA 2YG4A 3NYFA 5JCKA 2GAHB 2B9XA 1REOA 4FDCB 2TPRA 4X9NA 3UP4A 5M10A 2OLNA 3UTHA 5KMPA 5EOWA 3UKFA 4GAPA 4J34A 3AWIA 4EMIA 1NG3A 2XVJA 4TM0A 1SEZA 2GF3A 4B1BA 1P2HA 5HXIA 2R4JA 1OJDA 1FS9A 1ZY8A 1D4DA 4B63A 3DGZA 4YTPA 1GRAA 3C96A 4GR1A 5U63A 2RDZA 2V6OA 4A6NA 1GRBA 1NG4A 4JDRA 4G6HA 3DJJA 5KRQA 3BNFA 4NNJA 4C74A 3SM8A 1BZLA 3CGBA 1YQ3A 3AXBA 3IHMA 1D7YA 4CY8A 4Z2TA 4Y4MA 2OA1A 3K7QX 3NNEA 3DMEA 1ZKQA 2WOIA 2BS2A 2H88A 3BHKA 3NN6X 3T2KA 1IUSA 3RKHA 2JK6A 3V76A 1JRXA 2YG3A 3UOXA 1TYPA 2WP6A 1CBOA 1KF6A 4WCTA 3COXA 2R46A 3EF6A 4E0VA 3IWAA 1RP0A 2AAQA 1GRFA 3RP8A 5GRTA 4I59A 4AP1A 2VQBA 1DJQA 1LPFA 4TM4A 1B5QA 1JRYA 1KSUA 3LJPA 4USRA 3AEDA 4TLZA 1PXBA 3G5QA 4U2SA 5JCLA 2NVKX 2JKCA 4A6NB 1JEHA 2WESA 2GMJA 1S3BA 2WU5A 3ITJA 1E6EA 1M1QA 2YVFA 4OPTA 1GNDA 4YXDA 1HYUA 4UDPA 4NTCA 5KNLA 2F5ZA 5C2TA 3SCEA 1H81A 3GRTA 3TORA 3P4QA 4JY2A 3BI4A 4IVOB 4HA6A 4G6GA 5KWFA 2E81A 3UKAA 4Z2RA 4TM1A 1GREA 2WDQA 4XWRA 3DK9A 3CGEA 4GUVA 3GD3A 1TDEA 1VDCA 1PBBA 3P4SA 1GPEA 4H4XA 1ZK7A 5EB5A 4IA6A 1DNCA 1H6VA 4L3YA 2XVHA 4ICYA 4H4VA 3AEGA 4APNA 5TR3A 2WU2A 1GEUA 3KPKA 5KMSA 1D4CA 1K0IA 3CPHG 4FX9A 1CF3A 2GV8A 2C75A 3GYIA 3OC4A 3GD4A 1IUVA 4J36A 4A9WA 2XFPA 3M13A 3AYLA 4IVMB 1XANA 1EL5A 4OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYT A;  3BNM A;  1NHQ A;  2AQJ A;  3CNS A;  3FIM B;  1O5W A;  4H4Y A;  4I58 A;  4Z2U A;  3GMC A;  4TLX A;  1Q1R A;  2EQ7 A;  4BK2 A;  3NHO X;  2C65 A;  2B7R A;  1NDA A;  2XVE A;  3QSM A;  3UTE A;  1D7L A;  3UP5 A;  2A89 A;  1FL2 A;  1KNP A;  1RSG A;  2C73 A;  2Q0K A;  3D1I A;  3FBS A;  5FS7 A;  2R0C A;  3KA7 A;  1F8S A;  4D04 A;  3CIR A;  1E39 A;  3K30 A;  1BWC A;  4DGK A;  1PBD A;  1GER A;  3ABV A;  4P9S A;  3UOZ A;  3UKP A;  4EIP A;  2R0P A;  2CVJ A;  2RGJ A;  3V3O A;  1BKW A;  1QO8 A;  3R9U A;  1ZOV A;  5KVH A;  1S3E A;  3NRN A;  5FMH A;  4Y4N A;  1L0V A;  4J57 A;  4EQX A;  4DNA A;  2GQF A;  4YSZ A;  2PYX A;  2YLT A;  4OPL A;  2BS4 A;  1YQZ A;  3GWF A;  2YG7 A;  1GU6 A;  4Z25 A;  1ZP0 A;  2EQ6 A;  3I6D A;  4UP3 A;  3Q6J A;  4BK3 A;  2ZZC A;  4K8D A;  1UKV G;  3QSE A;  4CCR A;  5FS8 A;  4AT0 A;  3AEE A;  3VR8 A;  3ZYX A;  3DJE A;  4WX1 A;  4PAA A;  2BK3 A;  3G5S A;  3QJ4 A;  1X31 B;  3T37 A;  4U8K A;  4U8I A;  2XLP A;  4BK1 A;  4H2R A;  4BJY A;  5HY5 A;  1H7W A;  3DH9 A;  1QLB A;  2X99 A;  4OCG A;  3VQR A;  2V5Z A;  2YVJ A;  1GET A;  3AE8 A;  4C3X A;  1H7X A;  4YSH A;  1MOK A;  3K7M X;  3CGD A;  2XCG A;  3NIX A;  2J7A A;  1GRG A;  1GT8 A;  1PDH A;  5JCM A;  2VQ7 A;  1GV4 A;  3JSK A;  4NZH A;  2WPF A;  2OAM A;  4BJZ A;  2R4E A;  5L46 A;  1CC6 A;  4H4W A;  2RGO A;  1M6I A;  1KSS A;  2QCU A;  2X50 A;  2VVL A;  4NTD A;  3LZX A;  2XDO A;  3VR9 A;  1PS9 A;  2BCG G;  4A65 A;  2FJB A;  4YSX A;  2B76 A;  2VR0 A;  2OLO A;  2NPX A;  2PHH A;  3ICT A;  4RG3 A;  2JB2 A;  3S5W A;  4L3X A;  1Y56 B;  3HZL A;  4Z24 A;  4JNA A;  2XYO A;  3P9U A;  4H4Z A;  4ECH A;  3GSI A;  2C64 A;  4CNK A;  2APG A;  2WP9 A;  2Q6U A;  2Y6R A;  3CND A;  2GQW A;  2E1M A;  3F8D A;  4J31 A;  3UU9 A;  1F3P A;  1LTX R;  2Q7V A;  3CNT A;  4OPG A;  5FS6 A;  4Z44 A;  5HYM A;  4XWZ A;  2BA9 A;  3RHA A;  2YLR A;  3PVC A;  4M52 A;  2RGH A;  4Q17 A;  4EQW A;  5KOX A;  4Q4U A;  3C4A A;  1B37 A;  2BXR A;  4A79 A;  3RP7 A;  4K5S A;  2WDR A;  3AEB A;  3FO3 A;  2C72 A;  3IF9 A;  4H50 A;  2X8C A;  4H7U A;  5C3J A;  1N4U A;  1FS7 A;  4IA5 A;  4H4R A;  1N1P A;  3EAN A;  4L38 A;  5IQ1 A;  2A8X A;  3BI2 A;  1EL7 A;  2GR0 A;  3GDN A;  1OJA A;  2WEU A;  3L1T A;  4O5U A;  2YLS A;  1E1L A;  1RYI A;  2GMH A;  1XHC A;  1ZDL A;  2JBV A;  3B6D A;  4K5R A;  2R9Z A;  3QSS A;  2WQY A;  3NYC A;  2X8H A;  1IUX A;  2FJA A;  1GSN A;  1MXT A;  3GYJ A;  4ADW A;  1KDG A;  3FG2 P;  3AYI A;  4U2T A;  4C5O A;  1ELI A;  4EM3 A;  4FK1 A;  2W0H A;  3H8I A;  5IPY A;  1QJD A;  2GAG B;  3RP6 A;  3AE7 A;  1VG9 A;  3AEC A;  4WJY A;  3CTY A;  2XFN A;  1VG0 A;  3LOV A;  1SP3 A;  2E4G A;  2Z5Y A;  3PS9 A;  4B66 A;  1CJ4 A;  5EB4 A;  3O0H A;  2I0Z A;  2YAU A;  2BAB A;  3D8X A;  5DBJ A;  2FJD A;  1EBD A;  1GOS A;  1K4Q A;  3DGH A;  3GRS A;  1CHU A;  3ALM A;  3AE9 A;  3UCL A;  4CNJ A;  1B4V A;  3F8R A;  4YWO A;  1FEC A;  5EBK A;  3QVP A;  3SGL A;  1NHR A;  1EL8 A;  2C70 A;  2QA1 A;  3NYE A;  1XDI A;  3QVR A;  4EM4 A;  1JNZ A;  1OJC A;  2V61 A;  2XVF A;  4H2N A;  1F8R A;  2VZ2 A;  3S61 A;  4CRT A;  4EMW A;  4XXG A;  1DOE A;  4EIQ A;  1TDF A;  1YQ4 A;  4AOX A;  4Q5C A;  4NEW A;  4KX6 A;  1CJ3 A;  1JOA A;  4NEV A;  1M1R A;  2BAC A;  1NAA A;  1IJH A;  4GF7 A;  3UBR A;  3NTA A;  3ZDN A;  4H4U A;  2GR3 A;  1ZOY A;  3QFA A;  4CBQ A;  3M12 A;  2J3N A;  3KLJ A;  4AT2 A;  2FBW A;  3LZW A;  1K0J A;  5LV9 A;  1V59 A;  2Q0L A;  5JCI A;  4K2X A;  5KXJ A;  3AD7 B;  3KU9 A;  3II4 A;  4UDR A;  3LG1 A;  3ATQ A;  1ONF A;  3FPZ A;  2BS3 A;  3ATR A;  3VRD B;  4EMJ A;  2WP5 A;  4C3Y A;  4ZN0 A;  3AD9 B;  2BXS A;  1DJN A;  3UTG A;  1O95 A;  5BRT A;  4ZCC A;  1JU2 A;  1H86 A;  1PHH A;  4H2Q A;  1L9D A;  3I3L A;  3P1W A;  4H4S A;  4YSY A;  2K3V A;  1H83 A;  2GR2 A;  1ZMC A;  4X4J A;  4TM3 A;  1GES A;  2OAL A;  3NT6 A;  2BK5 A;  1GRH A;  2V3B A;  4GCM A;  4YTN A;  3UTF A;  4H2P A;  3B3R A;  2B9Y A;  1H82 A;  1FT5 A;  3AE1 A;  5M0Z A;  4FK1 C;  2ZO5 A;  1LV0 A;  2CFY A;  3CN8 A;  3E1T A;  4C77 A;  1NHS A;  3NN0 X;  1D4E A;  1TRB A;  2DKH A;  1FEA A;  3AE6 A;  2GRT A;  1LQU A;  2C7G A;  2JB1 A;  4DSH A;  3UOY A;  4U8N A;  1LQT A;  3LGQ A;  1CC2 A;  3S7W A;  3NKS A;  4JY3 A;  4USQ A;  3UKL A;  1PXA A;  1PN0 A;  1W4X A;  1CJ2 A;  2YM1 A;  3KPF A;  4J56 A;  1K0L A;  5KOW A;  3KVE A;  4YKG A;  4JNQ A;  5BUL A;  1FT6 A;  2R0G A;  3ALJ A;  3IHG A;  1FEB A;  3OZ2 A;  1P2E A;  3NLC A;  1B8S A;  2ZZ0 A;  4N9X A;  3AEA A;  1IUT A;  1JNI A;  1EL9 A;  4YT0 A;  1YY5 A;  3BHF A;  2TMD A;  3TTB A;  1D5T A;  3CNP A;  1F8W A;  4H4Q A;  2JAE A;  1PBE A;  4U2L A;  3GYX A;  2YM2 A;  3WE0 A;  1E1K A;  3RED A;  1TDO A;  3EPT A;  4D03 A;  1F6M A;  2IID A;  1DOC A;  2GH5 A;  3CPI G;  4RG4 A;  4U8O A;  1PBF A;  4X9M A;  4MJW A;  4U8J A;  4LII A;  2E80 A;  4LU6 A;  3LAD A;  1DOB A;  2VVL G;  3CNJ A;  4A5L A;  4B69 A;  2AR8 A;  2XFU A;  4Z26 A;  1PXC A;  3OWM A;  1JRZ A;  4Z43 A;  4JN9 A;  1CC4 A;  2QA2 A;  4BUR A;  4J33 A;  3F8P A;  3BNU A;  4J2W A;  4B68 A;  3AEF A;  5U1O A;  5J7X A;  4Q1O A;  2C3C A;  4LA1 A;  1BF3 A;  3EAO A;  1L9E A;  2H89 A;  1N4V A;  2XLU A;  3ADA B;  3BI5 A;  3H8L A;  1PJ5 A;  5FS9 A;  4OVI A;  5CKU A;  1ZMD A;  2C76 A;  3ALL A;  3NGC X;  2ARD A;  3Q9T A;  4OPI A;  4U8L A;  4L3Z A;  1BGJ A;  1IUW A;  3BNG A;  3C4N A;  3NG7 X;  2XLT A;  3DK8 A;  3IC9 A;  2YG6 A;  2IVD A;  3AE2 A;  4EQS A;  3RNM A;  4Q0T A;  1VRQ B;  1COY A;  2X8G A;  2WDV A;  1YKJ A;  3KKJ A;  5U25 A;  4K22 A;  1GTH A;  1DOD A;  3L1R A;  2YR5 A;  2QAE A;  1TDK A;  1CJC A;  2FJE A;  2X3N A;  5ER0 A;  5BVA A;  2YR4 A;  3K7T A;  3DK4 A;  1CL0 A;  2XFQ A;  2YVG A;  2GB0 A;  2C3D A;  5BUK A;  1PJ6 A;  1NEK A;  2C66 A;  1LJ1 A;  2B7S A;  2DKI A;  2YLZ A;  3DJG X;  2WET A;  1S2Q A;  1S2Y A;  3ICS A;  3F29 A;  2XLS A;  4AOS A;  2GR1 A;  3AB1 A;  4GDE A;  2WHD A;  3SFE A;  2OT4 A;  5JCN A;  5GSN A;  3UOV A;  3P4P A;  4K7Z A;  2E5V A;  1GRT A;  3BNH A;  3VRA A;  3ICR A;  3DJD A;  1Q9I A;  4OPD A;  1H84 A;  1LVL A;  1M64 A;  2YG5 A;  2VOU A;  3SQP A;  1M1P A;  2BK4 A;  1L9C A;  2VRL A;  5CQF A;  4YTM A;  4CCQ A;  5J60 A;  1GXF A;  2WPE A;  1GAL A;  4UDQ A;  3SXQ A;  1Z6L A;  1PBC A;  3GMB A;  3CGC A;  1E1N A;  4O5Q A;  4ZCD A;  2Z5X A;  4B65 A;  2O9Z A;  4BV6 A;  4GDP A;  1BGN A;  1XPQ A;  2EQ9 A;  4GRT A;  4U8M A;  2GEW A;  3SFD A;  1NEN A;  1OJ9 A;  2JB3 A;  3GWD A;  3H4K A;  4KPR A;  2YLW A;  2YLX A;  4B67 A;  2WOV A;  1E1M A;  4Q5B A;  1KFY A;  2XFO A;  2IVE A;  2V60 A;  1PJ7 A;  2ZBW A;  2YR6 A;  4PAB A;  4RSL A;  4AP3 A;  1OAH A;  3AYJ A;  2WBA A;  2CUL A;  2XVI A;  2BCP A;  2ACZ A;  2GVC A;  3AE4 A;  4H4T A;  2BC1 A;  1VQW A;  4JQ9 A;  1QDB A;  3LXD A;  3CPJ G;  4HB9 A;  2A87 A;  1AOG A;  3URH A;  3MMO A;  5IQ4 A;  4H4P A;  1ZX9 A;  4A99 A;  4U8P A;  3NTD A;  2BC0 A;  2WS3 A;  3GDP A;  2VRM A;  3LB8 A;  1TDN A;  3NK1 X;  4A7A A;  1Y0P A;  4YKF A;  1O94 A;  3PO7 A;  3M0O A;  2EQ8 A;  2WPC A;  3NH3 X;  3UKH A;  3UKK A;  4EQR A;  3BNJ A;  1FCD A;  1OJT A;  2RAB A;  2WOW A;  4Y4L A;  3L8K A;  3KD9 A;  2ZZB A;  3G5R A;  2B9W A;  1DXL A;  3NK2 X;  1FS8 A;  2RF7 A;  2C67 A;  3AE5 A;  3NK0 X;  1NPX A;  1BVB A;  3D1C A;  2Y6Q A;  4OPU A;  1N4W A;  3GM6 A;  3UKQ A;  2YWL A;  2BYB A;  2XLR A;  3ISH A;  2CDU A;  3QFB A;  4DSG A;  2V3A A;  3P4R A;  2VVM A;  3VRB A;  4REK A;  2YQU A;  1E7P A;  1FOH A;  3FMW A;  4IV9 A;  2R45 A;  3AE3 A;  5HHF A;  4NTE A;  1JNR A;  4B64 A;  4CY6 A;  1MO9 A;  3V3N A;  1KNR A;  3DA1 A;  1NHP A;  1IUU A;  2HQM A;  3AD8 B;  1Q1W A;  2LFC A;  1GTE A;  5KVI A;  1Y56 A;  2UZZ A;  5JCK A;  2YG4 A;  3NYF A;  2GAH B;  2B9X A;  1REO A;  4FDC B;  2TPR A;  4X9N A;  3UP4 A;  5M10 A;  2OLN A;  3UTH A;  5EOW A;  3UKF A;  4J34 A;  4EMI A;  3AWI A;  1NG3 A;  2XVJ A;  4TM0 A;  1SEZ A;  2GF3 A;  4B1B A;  1P2H A;  5HXI A;  2R4J A;  1OJD A;  1FS9 A;  1ZY8 A;  1D4D A;  4B63 A;  3DGZ A;  4YTP A;  1GRA A;  3C96 A;  4GR1 A;  5U63 A;  2RDZ A;  2V6O A;  4A6N A;  1GRB A;  1NG4 A;  4JDR A;  3DJJ A;  5KRQ A;  3BNF A;  4C74 A;  3SM8 A;  1BZL A;  3CGB A;  1YQ3 A;  3AXB A;  3IHM A;  1D7Y A;  4CY8 A;  4Z2T A;  4Y4M A;  2OA1 A;  3K7Q X;  3NNE A;  3DME A;  1ZKQ A;  2WOI A;  2BS2 A;  2H88 A;  3BHK A;  3NN6 X;  1IUS A;  3RKH A;  2JK6 A;  3V76 A;  1JRX A;  2YG3 A;  3UOX A;  1TYP A;  2WP6 A;  1CBO A;  1KF6 A;  4WCT A;  3COX A;  2R46 A;  3EF6 A;  4E0V A;  3IWA A;  1RP0 A;  2AAQ A;  1GRF A;  3RP8 A;  5GRT A;  4I59 A;  4AP1 A;  2VQB A;  1DJQ A;  1LPF A;  4TM4 A;  1B5Q A;  1JRY A;  1KSU A;  3LJP A;  4USR A;  3AED A;  4TLZ A;  1PXB A;  3G5Q A;  4U2S A;  5JCL A;  2NVK X;  2JKC A;  4A6N B;  1JEH A;  2WES A;  2GMJ A;  1S3B A;  2WU5 A;  3ITJ A;  1E6E A;  1M1Q A;  2YVF A;  4OPT A;  1GND A;  4YXD A;  1HYU A;  4UDP A;  4NTC A;  2F5Z A;  5C2T A;  3SCE A;  1H81 A;  3GRT A;  3TOR A;  3P4Q A;  4JY2 A;  3BI4 A;  4IVO B;  4HA6 A;  5KWF A;  2E81 A;  3UKA A;  4Z2R A;  4TM1 A;  1GRE A;  2WDQ A;  4XWR A;  3DK9 A;  3CGE A;  4GUV A;  3GD3 A;  1TDE A;  1VDC A;  1PBB A;  3P4S A;  1GPE A;  4H4X A;  1ZK7 A;  5EB5 A;  4IA6 A;  1DNC A;  1H6V A;  4L3Y A;  2XVH A;  4ICY A;  4H4V A;  3AEG A;  4APN A;  5TR3 A;  2WU2 A;  1GEU A;  1D4C A;  1K0I A;  3CPH G;  4FX9 A;  1CF3 A;  2GV8 A;  2C75 A;  3GYI A;  3OC4 A;  3GD4 A;  1IUV A;  4J36 A;  4A9W A;  2XFP A;  3M13 A;  3AYL A;  4IVM B;  1XAN A;  1EL5 A;  4OPC A; 
#chains in the Genus database with same CATH topology
 1TYT A;  3BNM A;  1NHQ A;  2AQJ A;  3CNS A;  3FIM B;  1O5W A;  4H4Y A;  4I58 A;  4II3 A;  4Z2U A;  3GMC A;  4TLX A;  1Q1R A;  2EQ7 A;  4BK2 A;  3NHO X;  2C65 A;  2B7R A;  1NDA A;  2XVE A;  3QSM A;  3UTE A;  1D7L A;  3UP5 A;  2A89 A;  1FL2 A;  1KNP A;  1RSG A;  2C73 A;  2Q0K A;  3D1I A;  3FBS A;  5FS7 A;  2R0C A;  3KA7 A;  1F8S A;  4D04 A;  3CIR A;  1E39 A;  3K30 A;  1BWC A;  4DGK A;  1PBD A;  1GER A;  3ABV A;  4P9S A;  3UOZ A;  3UKP A;  4EIP A;  2R0P A;  2CVJ A;  2RGJ A;  3V3O A;  1BKW A;  1QO8 A;  3R9U A;  1ZOV A;  5KVH A;  1S3E A;  3NRN A;  5FMH A;  4Y4N A;  1L0V A;  4J57 A;  4EQX A;  4DNA A;  2GQF A;  4YSZ A;  2PYX A;  2YLT A;  4OPL A;  2BS4 A;  1YQZ A;  3GWF A;  2YG7 A;  1GU6 A;  4Z25 A;  4G73 A;  1ZP0 A;  2EQ6 A;  3I6D A;  4UP3 A;  3Q6J A;  3T0K A;  4BK3 A;  2ZZC A;  4K8D A;  1UKV G;  3QSE A;  4CCR A;  5FS8 A;  4AT0 A;  3AEE A;  3VR8 A;  3ZYX A;  3DJE A;  3SYI A;  4WX1 A;  4PAA A;  2BK3 A;  3G5S A;  3QJ4 A;  1X31 B;  3T37 A;  4U8K A;  4U8I A;  2XLP A;  4BK1 A;  4H2R A;  4BJY A;  5HY5 A;  1H7W A;  3DH9 A;  1QLB A;  2X99 A;  4OCG A;  3VQR A;  2V5Z A;  2YVJ A;  1GET A;  3AE8 A;  4C3X A;  1H7X A;  4YSH A;  1MOK A;  3K7M X;  3CGD A;  2XCG A;  3NIX A;  2J7A A;  1GRG A;  1GT8 A;  1PDH A;  5JCM A;  2VQ7 A;  1GV4 A;  3JSK A;  4NZH A;  2WPF A;  2OAM A;  4BJZ A;  2R4E A;  5L46 A;  1CC6 A;  4H4W A;  2RGO A;  1M6I A;  1KSS A;  2QCU A;  2X50 A;  2VVL A;  4NTD A;  3LZX A;  2XDO A;  3VR9 A;  1PS9 A;  2BCG G;  4A65 A;  2FJB A;  4YSX A;  2B76 A;  2VR0 A;  2OLO A;  2NPX A;  2PHH A;  3T31 A;  3ICT A;  4RG3 A;  2JB2 A;  4A7A A;  3S5W A;  4L3X A;  1Y56 B;  3HZL A;  4Z24 A;  4JNA A;  3SZW A;  2XYO A;  3P9U A;  4H4Z A;  4ECH A;  3GSI A;  2C64 A;  4CNK A;  2APG A;  2WP9 A;  2Q6U A;  2Y6R A;  3CND A;  2GQW A;  2E1M A;  3F8D A;  4J31 A;  3UU9 A;  1F3P A;  1LTX R;  2Q7V A;  3CNT A;  3CMM A;  4OPG A;  5FS6 A;  4Z44 A;  4XWZ A;  2BA9 A;  3RHA A;  2YLR A;  5HYM A;  3PVC A;  4M52 A;  2RGH A;  4Q17 A;  4EQW A;  5KOX A;  4Q4U A;  3C4A A;  1B37 A;  2BXR A;  4A79 A;  3RP7 A;  4K5S A;  2WDR A;  3AEB A;  3FO3 A;  2C72 A;  3IF9 A;  4H50 A;  2X8C A;  4H7U A;  5C3J A;  1N4U A;  1FS7 A;  4IA5 A;  4H4R A;  1N1P A;  3EAN A;  4L38 A;  5IQ1 A;  2A8X A;  3BI2 A;  1EL7 A;  2GR0 A;  3GDN A;  1OJA A;  2WEU A;  3L1T A;  4O5U A;  2YLS A;  1E1L A;  3HYX A;  1RYI A;  2GMH A;  1XHC A;  1ZDL A;  2JBV A;  3B6D A;  4K5R A;  2R9Z A;  3QSS A;  2WQY A;  3NYC A;  2X8H A;  1IUX A;  2FJA A;  1GSN A;  3SZC A;  1MXT A;  3GYJ A;  3SY4 A;  4ADW A;  1KDG A;  3FG2 P;  3AYI A;  4U2T A;  4C5O A;  1ELI A;  4EM3 A;  4FK1 A;  2W0H A;  3H8I A;  5IPY A;  1QJD A;  2GAG B;  3RP6 A;  3AE7 A;  1VG9 A;  3AEC A;  4WJY A;  3CTY A;  2XFN A;  1VG0 A;  3LOV A;  1SP3 A;  2E4G A;  2Z5Y A;  3PS9 A;  4B66 A;  1CJ4 A;  5EB4 A;  3O0H A;  2I0Z A;  2YAU A;  2BAB A;  3D8X A;  5DBJ A;  2FJD A;  1EBD A;  1GOS A;  1K4Q A;  3DGH A;  3GRS A;  1CHU A;  3ALM A;  3AE9 A;  3UCL A;  4CNJ A;  1B4V A;  3F8R A;  4YWO A;  1FEC A;  5EBK A;  3QVP A;  3SGL A;  1NHR A;  1EL8 A;  2C70 A;  2QA1 A;  3NYE A;  1XDI A;  3QVR A;  4EM4 A;  1JNZ A;  1OJC A;  2V61 A;  2XVF A;  4H2N A;  1F8R A;  2VZ2 A;  3S61 A;  4CRT A;  4EMW A;  4XXG A;  1DOE A;  4EIQ A;  1TDF A;  1YQ4 A;  4AOX A;  4Q5C A;  4NEW A;  4KX6 A;  1CJ3 A;  1JOA A;  4NEV A;  1M1R A;  2BAC A;  1NAA A;  1IJH A;  4GF7 A;  3UBR A;  3NTA A;  3ZDN A;  4H4U A;  2GR3 A;  1ZOY A;  3QFA A;  3SX6 A;  4CBQ A;  3M12 A;  2J3N A;  3KLJ A;  4AT2 A;  2FBW A;  3LZW A;  1K0J A;  5LV9 A;  1V59 A;  2Q0L A;  5JCI A;  2CZS A;  4K2X A;  5KXJ A;  3AD7 B;  3KU9 A;  3HYW A;  3II4 A;  3LG1 A;  3ATQ A;  1ONF A;  3FPZ A;  2BS3 A;  3ATR A;  4UDR A;  4EMJ A;  2WP5 A;  4C3Y A;  4ZN0 A;  3AD9 B;  2BXS A;  1DJN A;  3UTG A;  1O95 A;  5BRT A;  4ZCC A;  1JU2 A;  1H86 A;  1PHH A;  4H2Q A;  1L9D A;  3I3L A;  3P1W A;  4H4S A;  4YSY A;  2K3V A;  1H83 A;  2GR2 A;  1ZMC A;  4X4J A;  4TM3 A;  1GES A;  2OAL A;  3NT6 A;  2BK5 A;  1GRH A;  2V3B A;  4GCM A;  4YTN A;  3UTF A;  4H2P A;  3B3R A;  2B9Y A;  1H82 A;  1FT5 A;  3AE1 A;  5M0Z A;  4FK1 C;  2ZO5 A;  1LV0 A;  2CFY A;  3CN8 A;  3E1T A;  4C77 A;  1NHS A;  3NN0 X;  1D4E A;  1TRB A;  2DKH A;  1FEA A;  3AE6 A;  2GRT A;  1LQU A;  2C7G A;  2JB1 A;  3VRD B;  4DSH A;  3UOY A;  4NWZ A;  4U8N A;  1LQT A;  3LGQ A;  1CC2 A;  3S7W A;  3NKS A;  4JY3 A;  4USQ A;  3UKL A;  1PXA A;  3SZF A;  1PN0 A;  1W4X A;  1CJ2 A;  2YM1 A;  3KPF A;  4J56 A;  1K0L A;  5KOW A;  3KVE A;  4YKG A;  4JNQ A;  5BUL A;  1FT6 A;  2R0G A;  3ALJ A;  3IHG A;  1FEB A;  3OZ2 A;  1P2E A;  3NLC A;  1B8S A;  2ZZ0 A;  4N9X A;  3AEA A;  5KMQ A;  1IUT A;  1JNI A;  1EL9 A;  4YT0 A;  1YY5 A;  3BHF A;  2TMD A;  3TTB A;  1D5T A;  3CNP A;  1F8W A;  4H4Q A;  2JAE A;  1PBE A;  4U2L A;  3GYX A;  2YM2 A;  3T2Z A;  1E1K A;  3RED A;  1TDO A;  3EPT A;  3WE0 A;  4D03 A;  1F6M A;  2IID A;  1DOC A;  2GH5 A;  3CPI G;  4RG4 A;  4U8O A;  1PBF A;  3T14 A;  5KMR A;  4X9M A;  4MJW A;  4U8J A;  4LII A;  3SXI A;  2E80 A;  4LU6 A;  3LAD A;  1DOB A;  2VVL G;  3CNJ A;  4A5L A;  4B69 A;  2AR8 A;  2XFU A;  4Z26 A;  1PXC A;  3OWM A;  1JRZ A;  4Z43 A;  4JN9 A;  1CC4 A;  2QA2 A;  4BUR A;  4J33 A;  3F8P A;  3BNU A;  4J2W A;  4B68 A;  3AEF A;  3HYV A;  5U1O A;  5J7X A;  4Q1O A;  2C3C A;  4LA1 A;  1BF3 A;  3EAO A;  1L9E A;  2H89 A;  2C4C A;  1N4V A;  2XLU A;  3ADA B;  3BI5 A;  3H8L A;  1PJ5 A;  5FS9 A;  4OVI A;  5CKU A;  1ZMD A;  2C76 A;  3ALL A;  3NGC X;  2ARD A;  3Q9T A;  4OPI A;  4U8L A;  4L3Z A;  1BGJ A;  1IUW A;  3BNG A;  3C4N A;  3NG7 X;  2XLT A;  3DK8 A;  3IC9 A;  2YG6 A;  2IVD A;  3AE2 A;  4EQS A;  3RNM A;  4Q0T A;  1VRQ B;  1COY A;  2X8G A;  2WDV A;  1YKJ A;  3KKJ A;  5U25 A;  4K22 A;  1GTH A;  1DOD A;  3L1R A;  2YR5 A;  2QAE A;  1TDK A;  1CJC A;  2FJE A;  2X3N A;  5ER0 A;  5BVA A;  2YR4 A;  3K7T A;  3DK4 A;  1CL0 A;  2XFQ A;  2YVG A;  2GB0 A;  2C3D A;  5BUK A;  1PJ6 A;  1NEK A;  2C66 A;  1LJ1 A;  2B7S A;  2DKI A;  2YLZ A;  3DJG X;  2WET A;  1S2Q A;  1S2Y A;  3ICS A;  3F29 A;  2XLS A;  4AOS A;  2GR1 A;  3AB1 A;  4GDE A;  2WHD A;  3SFE A;  2OT4 A;  5JCN A;  5GSN A;  3UOV A;  3P4P A;  4K7Z A;  2E5V A;  1GRT A;  3BNH A;  3VRA A;  3ICR A;  3DJD A;  1Q9I A;  4OPD A;  1H84 A;  1LVL A;  1M64 A;  2YG5 A;  2VOU A;  3SQP A;  1M1P A;  2BK4 A;  1L9C A;  2VRL A;  5CQF A;  4YTM A;  4CCQ A;  5J60 A;  1GXF A;  2WPE A;  1GAL A;  4UDQ A;  3SXQ A;  1Z6L A;  1PBC A;  3GMB A;  3CGC A;  1E1N A;  4O5Q A;  4ZCD A;  2Z5X A;  3T2Y A;  4B65 A;  2O9Z A;  4BV6 A;  4GDP A;  1BGN A;  1XPQ A;  2EQ9 A;  4GRT A;  4U8M A;  2GEW A;  3SFD A;  1NEN A;  1OJ9 A;  2JB3 A;  3GWD A;  3H4K A;  4KPR A;  2YLW A;  2YLX A;  4B67 A;  2WOV A;  1E1M A;  4Q5B A;  1KFY A;  2XFO A;  2IVE A;  2V60 A;  1PJ7 A;  2ZBW A;  2YR6 A;  4PAB A;  4RSL A;  4AP3 A;  1OAH A;  3AYJ A;  2WBA A;  2CUL A;  2XVI A;  2BCP A;  2ACZ A;  2GVC A;  3AE4 A;  4H4T A;  3SZ0 A;  2BC1 A;  1VQW A;  4JQ9 A;  1QDB A;  3LXD A;  3CPJ G;  4HB9 A;  2A87 A;  1AOG A;  3URH A;  3MMO A;  5IQ4 A;  4H4P A;  4II2 A;  1ZX9 A;  4A99 A;  4U8P A;  3NTD A;  2BC0 A;  2WS3 A;  3GDP A;  2VRM A;  3LB8 A;  1TDN A;  3NK1 X;  4G9K A;  1Y0P A;  4YKF A;  1O94 A;  3PO7 A;  3M0O A;  2EQ8 A;  2WPC A;  3NH3 X;  4G74 A;  4GAV A;  3UKH A;  3UKK A;  4EQR A;  3BNJ A;  1FCD A;  1OJT A;  2RAB A;  2WOW A;  4Y4L A;  3L8K A;  3KD9 A;  2ZZB A;  2BRA A;  3G5R A;  2B9W A;  1DXL A;  3NK2 X;  1FS8 A;  2RF7 A;  2C67 A;  3AE5 A;  3NK0 X;  1NPX A;  1BVB A;  3D1C A;  2Y6Q A;  4OPU A;  1N4W A;  3GM6 A;  3UKQ A;  2YWL A;  2BYB A;  2XLR A;  3ISH A;  2CDU A;  3QFB A;  4DSG A;  2V3A A;  3P4R A;  2VVM A;  3VRB A;  4REK A;  2YQU A;  1E7P A;  1FOH A;  3FMW A;  4IV9 A;  2R45 A;  3AE3 A;  5HHF A;  4NTE A;  1JNR A;  4B64 A;  4CY6 A;  1MO9 A;  3V3N A;  1KNR A;  3DA1 A;  1NHP A;  1IUU A;  2HQM A;  3AD8 B;  1Q1W A;  2LFC A;  1GTE A;  5KVI A;  1Y56 A;  2UZZ A;  2BRY A;  2YG4 A;  3NYF A;  5JCK A;  2GAH B;  2B9X A;  1REO A;  4FDC B;  2TPR A;  4X9N A;  3UP4 A;  5M10 A;  2OLN A;  3UTH A;  5KMP A;  5EOW A;  3UKF A;  4GAP A;  4J34 A;  3AWI A;  4EMI A;  1NG3 A;  2XVJ A;  4TM0 A;  1SEZ A;  2GF3 A;  4B1B A;  1P2H A;  5HXI A;  2R4J A;  1OJD A;  1FS9 A;  1ZY8 A;  1D4D A;  4B63 A;  3DGZ A;  4YTP A;  1GRA A;  3C96 A;  4GR1 A;  5U63 A;  2RDZ A;  2V6O A;  4A6N A;  1GRB A;  1NG4 A;  4JDR A;  4G6H A;  3DJJ A;  5KRQ A;  3BNF A;  4NNJ A;  4C74 A;  3SM8 A;  1BZL A;  3CGB A;  1YQ3 A;  3AXB A;  3IHM A;  1D7Y A;  4CY8 A;  4Z2T A;  4Y4M A;  2OA1 A;  3K7Q X;  3NNE A;  3DME A;  1ZKQ A;  2WOI A;  2BS2 A;  2H88 A;  3BHK A;  3NN6 X;  3T2K A;  1IUS A;  3RKH A;  2JK6 A;  3V76 A;  1JRX A;  2YG3 A;  3UOX A;  1TYP A;  2WP6 A;  1CBO A;  1KF6 A;  4WCT A;  3COX A;  2R46 A;  3EF6 A;  4E0V A;  3IWA A;  1RP0 A;  2AAQ A;  1GRF A;  3RP8 A;  5GRT A;  4I59 A;  4AP1 A;  2VQB A;  1DJQ A;  1LPF A;  4TM4 A;  1B5Q A;  1JRY A;  1KSU A;  3LJP A;  4USR A;  3AED A;  4TLZ A;  1PXB A;  3G5Q A;  4U2S A;  5JCL A;  2NVK X;  2JKC A;  4A6N B;  1JEH A;  2WES A;  2GMJ A;  1S3B A;  2WU5 A;  3ITJ A;  1E6E A;  1M1Q A;  2YVF A;  4OPT A;  1GND A;  4YXD A;  1HYU A;  4UDP A;  4NTC A;  5KNL A;  2F5Z A;  5C2T A;  3SCE A;  1H81 A;  3GRT A;  3TOR A;  3P4Q A;  4JY2 A;  3BI4 A;  4IVO B;  4HA6 A;  4G6G A;  5KWF A;  2E81 A;  3UKA A;  4Z2R A;  4TM1 A;  1GRE A;  2WDQ A;  4XWR A;  3DK9 A;  3CGE A;  4GUV A;  3GD3 A;  1TDE A;  1VDC A;  1PBB A;  3P4S A;  1GPE A;  4H4X A;  1ZK7 A;  5EB5 A;  4IA6 A;  1DNC A;  1H6V A;  4L3Y A;  2XVH A;  4ICY A;  4H4V A;  3AEG A;  4APN A;  5TR3 A;  2WU2 A;  1GEU A;  3KPK A;  5KMS A;  1D4C A;  1K0I A;  3CPH G;  4FX9 A;  1CF3 A;  2GV8 A;  2C75 A;  3GYI A;  3OC4 A;  3GD4 A;  1IUV A;  4J36 A;  4A9W A;  2XFP A;  3M13 A;  3AYL A;  4IVM B;  1XAN A;  1EL5 A;  4OPC A; 
#chains in the Genus database with same CATH homology
 1TYT A;  3BNM A;  1NHQ A;  2AQJ A;  3CNS A;  3FIM B;  1O5W A;  4H4Y A;  4I58 A;  4II3 A;  4Z2U A;  3GMC A;  4TLX A;  1Q1R A;  2EQ7 A;  4BK2 A;  3NHO X;  2C65 A;  2B7R A;  1NDA A;  2XVE A;  3QSM A;  3UTE A;  1D7L A;  3UP5 A;  2A89 A;  1FL2 A;  1KNP A;  1RSG A;  2C73 A;  2Q0K A;  3D1I A;  3FBS A;  5FS7 A;  2R0C A;  3KA7 A;  1F8S A;  4D04 A;  3CIR A;  1E39 A;  3K30 A;  1BWC A;  4DGK A;  1PBD A;  1GER A;  3ABV A;  4P9S A;  3UOZ A;  3UKP A;  4EIP A;  2R0P A;  2CVJ A;  2RGJ A;  3V3O A;  1BKW A;  1QO8 A;  3R9U A;  1ZOV A;  5KVH A;  1S3E A;  3NRN A;  5FMH A;  4Y4N A;  1L0V A;  4J57 A;  4EQX A;  4DNA A;  2GQF A;  4YSZ A;  2PYX A;  2YLT A;  4OPL A;  2BS4 A;  1YQZ A;  3GWF A;  2YG7 A;  1GU6 A;  4Z25 A;  4G73 A;  1ZP0 A;  2EQ6 A;  3I6D A;  4UP3 A;  3Q6J A;  3T0K A;  4BK3 A;  2ZZC A;  4K8D A;  1UKV G;  3QSE A;  4CCR A;  5FS8 A;  4AT0 A;  3AEE A;  3VR8 A;  3ZYX A;  3DJE A;  3SYI A;  4WX1 A;  4PAA A;  2BK3 A;  3G5S A;  3QJ4 A;  1X31 B;  3T37 A;  4U8K A;  4U8I A;  2XLP A;  4BK1 A;  4H2R A;  4BJY A;  5HY5 A;  1H7W A;  3DH9 A;  1QLB A;  2X99 A;  4OCG A;  3VQR A;  2V5Z A;  2YVJ A;  1GET A;  3AE8 A;  4C3X A;  1H7X A;  4YSH A;  1MOK A;  3K7M X;  3CGD A;  2XCG A;  3NIX A;  2J7A A;  1GRG A;  1GT8 A;  1PDH A;  5JCM A;  2VQ7 A;  1GV4 A;  3JSK A;  4NZH A;  2WPF A;  2OAM A;  4BJZ A;  2R4E A;  5L46 A;  1CC6 A;  4H4W A;  2RGO A;  1M6I A;  1KSS A;  2QCU A;  2X50 A;  2VVL A;  4NTD A;  3LZX A;  2XDO A;  3VR9 A;  1PS9 A;  2BCG G;  4A65 A;  2FJB A;  4YSX A;  2B76 A;  2VR0 A;  2OLO A;  2NPX A;  2PHH A;  3T31 A;  3ICT A;  4RG3 A;  2JB2 A;  4A7A A;  3S5W A;  4L3X A;  1Y56 B;  3HZL A;  4Z24 A;  4JNA A;  3SZW A;  2XYO A;  3P9U A;  4H4Z A;  4ECH A;  3GSI A;  2C64 A;  4CNK A;  2APG A;  2WP9 A;  2Q6U A;  2Y6R A;  3CND A;  2GQW A;  2E1M A;  3F8D A;  4J31 A;  3UU9 A;  1F3P A;  1LTX R;  2Q7V A;  3CNT A;  3CMM A;  4OPG A;  5FS6 A;  4Z44 A;  4XWZ A;  2BA9 A;  3RHA A;  2YLR A;  5HYM A;  3PVC A;  4M52 A;  2RGH A;  4Q17 A;  4EQW A;  5KOX A;  4Q4U A;  3C4A A;  1B37 A;  2BXR A;  4A79 A;  3RP7 A;  4K5S A;  2WDR A;  3AEB A;  3FO3 A;  2C72 A;  3IF9 A;  4H50 A;  2X8C A;  4H7U A;  5C3J A;  1N4U A;  1FS7 A;  4IA5 A;  4H4R A;  1N1P A;  3EAN A;  4L38 A;  5IQ1 A;  2A8X A;  3BI2 A;  1EL7 A;  2GR0 A;  3GDN A;  1OJA A;  2WEU A;  3L1T A;  4O5U A;  2YLS A;  1E1L A;  3HYX A;  1RYI A;  2GMH A;  1XHC A;  1ZDL A;  2JBV A;  3B6D A;  4K5R A;  2R9Z A;  3QSS A;  2WQY A;  3NYC A;  2X8H A;  1IUX A;  2FJA A;  1GSN A;  3SZC A;  1MXT A;  3GYJ A;  3SY4 A;  4ADW A;  1KDG A;  3FG2 P;  3AYI A;  4U2T A;  4C5O A;  1ELI A;  4EM3 A;  4FK1 A;  2W0H A;  3H8I A;  5IPY A;  1QJD A;  2GAG B;  3RP6 A;  3AE7 A;  1VG9 A;  3AEC A;  4WJY A;  3CTY A;  2XFN A;  1VG0 A;  3LOV A;  1SP3 A;  2E4G A;  2Z5Y A;  3PS9 A;  4B66 A;  1CJ4 A;  5EB4 A;  3O0H A;  2I0Z A;  2YAU A;  2BAB A;  3D8X A;  5DBJ A;  2FJD A;  1EBD A;  1GOS A;  1K4Q A;  3DGH A;  3GRS A;  1CHU A;  3ALM A;  3AE9 A;  3UCL A;  4CNJ A;  1B4V A;  3F8R A;  4YWO A;  1FEC A;  5EBK A;  3QVP A;  3SGL A;  1NHR A;  1EL8 A;  2C70 A;  2QA1 A;  3NYE A;  1XDI A;  3QVR A;  4EM4 A;  1JNZ A;  1OJC A;  2V61 A;  2XVF A;  4H2N A;  1F8R A;  2VZ2 A;  3S61 A;  4CRT A;  4EMW A;  4XXG A;  1DOE A;  4EIQ A;  1TDF A;  1YQ4 A;  4AOX A;  4Q5C A;  4NEW A;  4KX6 A;  1CJ3 A;  1JOA A;  4NEV A;  1M1R A;  2BAC A;  1NAA A;  1IJH A;  4GF7 A;  3UBR A;  3NTA A;  3ZDN A;  4H4U A;  2GR3 A;  1ZOY A;  3QFA A;  3SX6 A;  4CBQ A;  3M12 A;  2J3N A;  3KLJ A;  4AT2 A;  2FBW A;  3LZW A;  1K0J A;  5LV9 A;  1V59 A;  2Q0L A;  5JCI A;  4K2X A;  5KXJ A;  3AD7 B;  3KU9 A;  3HYW A;  3II4 A;  3LG1 A;  3ATQ A;  1ONF A;  3FPZ A;  2BS3 A;  3ATR A;  4UDR A;  4EMJ A;  2WP5 A;  4C3Y A;  4ZN0 A;  3AD9 B;  2BXS A;  1DJN A;  3UTG A;  1O95 A;  5BRT A;  4ZCC A;  1JU2 A;  1H86 A;  1PHH A;  4H2Q A;  1L9D A;  3I3L A;  3P1W A;  4H4S A;  4YSY A;  2K3V A;  1H83 A;  2GR2 A;  1ZMC A;  4X4J A;  4TM3 A;  1GES A;  2OAL A;  3NT6 A;  2BK5 A;  1GRH A;  2V3B A;  4GCM A;  4YTN A;  3UTF A;  4H2P A;  3B3R A;  2B9Y A;  1H82 A;  1FT5 A;  3AE1 A;  5M0Z A;  4FK1 C;  2ZO5 A;  1LV0 A;  2CFY A;  3CN8 A;  3E1T A;  4C77 A;  1NHS A;  3NN0 X;  1D4E A;  1TRB A;  2DKH A;  1FEA A;  3AE6 A;  2GRT A;  1LQU A;  2C7G A;  2JB1 A;  3VRD B;  4DSH A;  3UOY A;  4NWZ A;  4U8N A;  1LQT A;  3LGQ A;  1CC2 A;  3S7W A;  3NKS A;  4JY3 A;  4USQ A;  3UKL A;  1PXA A;  3SZF A;  1PN0 A;  1W4X A;  1CJ2 A;  2YM1 A;  3KPF A;  4J56 A;  1K0L A;  5KOW A;  3KVE A;  4YKG A;  4JNQ A;  5BUL A;  1FT6 A;  2R0G A;  3ALJ A;  3IHG A;  1FEB A;  3OZ2 A;  1P2E A;  3NLC A;  1B8S A;  2ZZ0 A;  4N9X A;  3AEA A;  5KMQ A;  1IUT A;  1JNI A;  1EL9 A;  4YT0 A;  1YY5 A;  3BHF A;  2TMD A;  3TTB A;  1D5T A;  3CNP A;  1F8W A;  4H4Q A;  2JAE A;  1PBE A;  4U2L A;  3GYX A;  2YM2 A;  3T2Z A;  1E1K A;  3RED A;  1TDO A;  3EPT A;  3WE0 A;  4D03 A;  1F6M A;  2IID A;  1DOC A;  2GH5 A;  3CPI G;  4RG4 A;  4U8O A;  1PBF A;  3T14 A;  5KMR A;  4X9M A;  4MJW A;  4U8J A;  4LII A;  3SXI A;  2E80 A;  4LU6 A;  3LAD A;  1DOB A;  2VVL G;  3CNJ A;  4A5L A;  4B69 A;  2AR8 A;  2XFU A;  4Z26 A;  1PXC A;  3OWM A;  1JRZ A;  4Z43 A;  4JN9 A;  1CC4 A;  2QA2 A;  4BUR A;  4J33 A;  3F8P A;  3BNU A;  4J2W A;  4B68 A;  3AEF A;  3HYV A;  5U1O A;  5J7X A;  4Q1O A;  2C3C A;  4LA1 A;  1BF3 A;  3EAO A;  1L9E A;  2H89 A;  2C4C A;  1N4V A;  2XLU A;  3ADA B;  3BI5 A;  3H8L A;  1PJ5 A;  5FS9 A;  4OVI A;  5CKU A;  1ZMD A;  2C76 A;  3ALL A;  3NGC X;  2ARD A;  3Q9T A;  4OPI A;  4U8L A;  4L3Z A;  1BGJ A;  1IUW A;  3BNG A;  3C4N A;  3NG7 X;  2XLT A;  3DK8 A;  3IC9 A;  2YG6 A;  2IVD A;  3AE2 A;  4EQS A;  3RNM A;  4Q0T A;  1VRQ B;  1COY A;  2X8G A;  2WDV A;  1YKJ A;  3KKJ A;  5U25 A;  4K22 A;  1GTH A;  1DOD A;  3L1R A;  2YR5 A;  2QAE A;  1TDK A;  1CJC A;  2FJE A;  2X3N A;  5ER0 A;  5BVA A;  2YR4 A;  3K7T A;  3DK4 A;  1CL0 A;  2XFQ A;  2YVG A;  2GB0 A;  2C3D A;  5BUK A;  1PJ6 A;  1NEK A;  2C66 A;  1LJ1 A;  2B7S A;  2DKI A;  2YLZ A;  3DJG X;  2WET A;  1S2Q A;  1S2Y A;  3ICS A;  3F29 A;  2XLS A;  4AOS A;  2GR1 A;  3AB1 A;  4GDE A;  2WHD A;  3SFE A;  2OT4 A;  5JCN A;  5GSN A;  3UOV A;  3P4P A;  4K7Z A;  2E5V A;  1GRT A;  3BNH A;  3VRA A;  3ICR A;  3DJD A;  1Q9I A;  4OPD A;  1H84 A;  1LVL A;  1M64 A;  2YG5 A;  2VOU A;  3SQP A;  1M1P A;  2BK4 A;  1L9C A;  2VRL A;  5CQF A;  4YTM A;  4CCQ A;  5J60 A;  1GXF A;  2WPE A;  1GAL A;  4UDQ A;  3SXQ A;  1Z6L A;  1PBC A;  3GMB A;  3CGC A;  1E1N A;  4O5Q A;  4ZCD A;  2Z5X A;  3T2Y A;  4B65 A;  2O9Z A;  4BV6 A;  4GDP A;  1BGN A;  1XPQ A;  2EQ9 A;  4GRT A;  4U8M A;  2GEW A;  3SFD A;  1NEN A;  1OJ9 A;  2JB3 A;  3GWD A;  3H4K A;  4KPR A;  2YLW A;  2YLX A;  4B67 A;  2WOV A;  1E1M A;  4Q5B A;  1KFY A;  2XFO A;  2IVE A;  2V60 A;  1PJ7 A;  2ZBW A;  2YR6 A;  4PAB A;  4RSL A;  4AP3 A;  1OAH A;  3AYJ A;  2WBA A;  2CUL A;  2XVI A;  2BCP A;  2ACZ A;  2GVC A;  3AE4 A;  4H4T A;  3SZ0 A;  2BC1 A;  1VQW A;  4JQ9 A;  1QDB A;  3LXD A;  3CPJ G;  4HB9 A;  2A87 A;  1AOG A;  3URH A;  3MMO A;  5IQ4 A;  4H4P A;  4II2 A;  1ZX9 A;  4A99 A;  4U8P A;  3NTD A;  2BC0 A;  2WS3 A;  3GDP A;  2VRM A;  3LB8 A;  1TDN A;  3NK1 X;  4G9K A;  1Y0P A;  4YKF A;  1O94 A;  3PO7 A;  3M0O A;  2EQ8 A;  2WPC A;  3NH3 X;  4G74 A;  4GAV A;  3UKH A;  3UKK A;  4EQR A;  3BNJ A;  1FCD A;  1OJT A;  2RAB A;  2WOW A;  4Y4L A;  3L8K A;  3KD9 A;  2ZZB A;  2BRA A;  3G5R A;  2B9W A;  1DXL A;  3NK2 X;  1FS8 A;  2RF7 A;  2C67 A;  3AE5 A;  3NK0 X;  1NPX A;  1BVB A;  3D1C A;  2Y6Q A;  4OPU A;  1N4W A;  3GM6 A;  3UKQ A;  2YWL A;  2BYB A;  2XLR A;  3ISH A;  2CDU A;  3QFB A;  4DSG A;  2V3A A;  3P4R A;  2VVM A;  3VRB A;  4REK A;  2YQU A;  1E7P A;  1FOH A;  3FMW A;  4IV9 A;  2R45 A;  3AE3 A;  5HHF A;  4NTE A;  1JNR A;  4B64 A;  4CY6 A;  1MO9 A;  3V3N A;  1KNR A;  3DA1 A;  1NHP A;  1IUU A;  2HQM A;  3AD8 B;  1Q1W A;  2LFC A;  1GTE A;  5KVI A;  1Y56 A;  2UZZ A;  2BRY A;  2YG4 A;  3NYF A;  5JCK A;  2GAH B;  2B9X A;  1REO A;  4FDC B;  2TPR A;  4X9N A;  3UP4 A;  5M10 A;  2OLN A;  3UTH A;  5KMP A;  5EOW A;  3UKF A;  4GAP A;  4J34 A;  3AWI A;  4EMI A;  1NG3 A;  2XVJ A;  4TM0 A;  1SEZ A;  2GF3 A;  4B1B A;  1P2H A;  5HXI A;  2R4J A;  1OJD A;  1FS9 A;  1ZY8 A;  1D4D A;  4B63 A;  3DGZ A;  4YTP A;  1GRA A;  3C96 A;  4GR1 A;  5U63 A;  2RDZ A;  2V6O A;  4A6N A;  1GRB A;  1NG4 A;  4JDR A;  4G6H A;  3DJJ A;  5KRQ A;  3BNF A;  4NNJ A;  4C74 A;  3SM8 A;  1BZL A;  3CGB A;  1YQ3 A;  3AXB A;  3IHM A;  1D7Y A;  4CY8 A;  4Z2T A;  4Y4M A;  2OA1 A;  3K7Q X;  3NNE A;  3DME A;  1ZKQ A;  2WOI A;  2BS2 A;  2H88 A;  3BHK A;  3NN6 X;  3T2K A;  1IUS A;  3RKH A;  2JK6 A;  3V76 A;  1JRX A;  2YG3 A;  3UOX A;  1TYP A;  2WP6 A;  1CBO A;  1KF6 A;  4WCT A;  3COX A;  2R46 A;  3EF6 A;  4E0V A;  3IWA A;  1RP0 A;  2AAQ A;  1GRF A;  3RP8 A;  5GRT A;  4I59 A;  4AP1 A;  2VQB A;  1DJQ A;  1LPF A;  4TM4 A;  1B5Q A;  1JRY A;  1KSU A;  3LJP A;  4USR A;  3AED A;  4TLZ A;  1PXB A;  3G5Q A;  4U2S A;  5JCL A;  2NVK X;  2JKC A;  4A6N B;  1JEH A;  2WES A;  2GMJ A;  1S3B A;  2WU5 A;  3ITJ A;  1E6E A;  1M1Q A;  2YVF A;  4OPT A;  1GND A;  4YXD A;  1HYU A;  4UDP A;  4NTC A;  5KNL A;  2F5Z A;  5C2T A;  3SCE A;  1H81 A;  3GRT A;  3TOR A;  3P4Q A;  4JY2 A;  3BI4 A;  4IVO B;  4HA6 A;  4G6G A;  5KWF A;  2E81 A;  3UKA A;  4Z2R A;  4TM1 A;  1GRE A;  2WDQ A;  4XWR A;  3DK9 A;  3CGE A;  4GUV A;  3GD3 A;  1TDE A;  1VDC A;  1PBB A;  3P4S A;  1GPE A;  4H4X A;  1ZK7 A;  5EB5 A;  4IA6 A;  1DNC A;  1H6V A;  4L3Y A;  2XVH A;  4ICY A;  4H4V A;  3AEG A;  4APN A;  5TR3 A;  2WU2 A;  1GEU A;  3KPK A;  5KMS A;  1D4C A;  1K0I A;  3CPH G;  4FX9 A;  1CF3 A;  2GV8 A;  2C75 A;  3GYI A;  3OC4 A;  3GD4 A;  1IUV A;  4J36 A;  4A9W A;  2XFP A;  3M13 A;  3AYL A;  4IVM B;  1XAN A;  1EL5 A;  4OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...