1JRZA

Crystal structure of arg402tyr mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTYDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C
total genus 194
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrzA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrzA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrzA01
3F8RA 3NGCX 1S3BA 3AD9B 3QSMA 1BZLA 3FMWA 1TRBA 3EF6A 3URHA 1ZKQA 2CVJA 1KFYA 3TTBA 4GCMA 4I58A 2XFPA 1N1PA 1DNCA 5IQ1A 4Y4MA 2H88A 3RP7A 1SP3A 2Q6UA 1E1NA 3L8KA 2BC0A 4K7ZA 3OC4A 4GDEA 4NEWA 4Z2RA 3BNFA 1ZOYA 1RSGA 2C64A 1MO9A 2APGA 4KX6A 4B63A 1OJCA 5BULA 3UOXA 3C4AA 5EB5A 5C2TA 5KOXA 3HZLA 4J33A 1GREA 1VDCA 1D4CA 1M1RA 2QAEA 2VR0A 1D5TA 2YG6A 2JB3A 3P4SA 2B76A 3AE3A 4IA6A 3DK8A 2XFOA 1OJTA 3RP8A 1PXCA 1LPFA 1GRAA 4U2SA 1KSSA 3AE8A 4AP1A 4D04A 2FJAA 3IC9A 2C75A 4YSZA 4YKGA 4C5OA 1BGJA 2YG4A 1RP0A 3P4QA 1SEZA 1CJ2A 2WPFA 2YWLA 4GF7A 3COXA 4Z26A 1JNZA 4H4UA 1OJAA 1F3PA 4L3ZA 3AEGA 4L3XA 2Y6RA 3ICSA 3VQRA 4BJZA 4YSXA 1GXFA 5FS8A 1Q1RA 1DOBA 2GMHA 2GR3A 4CRTA 2V3BA 3VRDB 4U8KA 3JSKA 5M0ZA 3NNEA 1GEUA 2B7RA 4EIPA 2Z5YA 3ICRA 4OPDA 2GRTA 3SXQA 4GRTA 4H4YA 4YWOA 3AEBA 2BA9A 2YLWA 2Q0LA 4K2XA 4IV9A 3UTFA 2JB1A 4AP3A 3CPHG 2BK5A 3NYFA 4EMWA 2XVIA 3QVRA 2EQ9A 1NHQA 1JNRA 1CHUA 4YTPA 4AOSA 2R0GA 1LQTA 5KXJA 3F29A 1EL9A 1MOKA 3NYCA 5M10A 1P2EA 3GYXA 3ABVA 3BHKA 2GAGB 1ZK7A 2BK4A 2YR4A 5KRQA 2YVFA 4LIIA 1PHHA 3V3NA 2B9XA 1NHSA 3C4NA 3SGLA 4YSHA 3P4PA 3B3RA 4H4ZA 3LG1A 1GERA 3RNMA 3BNGA 1NAAA 2JAEA 1PJ5A 1E1KA 2WHDA 2B9YA 1CJCA 1H84A 4CBQA 3V3OA 1PJ7A 3NTDA 2OALA 4NZHA 2BXRA 2JK6A 5CQFA 3UKLA 3PO7A 2WETA 2YQUA 1M6IA 3DK9A 4J34A 2DKIA 2GEWA 4A6NA 3KPFA 3H8IA 1Y0PA 1BWCA 3D8XA 1EL5A 3DMEA 2IVDA 4Q4UA 4H2PA 3UP5A 1K0JA 3UU9A 1L9DA 5U25A 1FOHA 2W0HA 3NKSA 4UDQA 1HYUA 4LA1A 1O94A 2JB2A 3RHAA 4B64A 2YVGA 1LTXR 1L9CA 4Z2TA 3UKAA 4E0VA 5HY5A 2B7SA 3NTAA 3NT6A 1E7PA 2CFYA 3SFEA 1FL2A 3FPZA 2XFNA 3CIRA 1XPQA 4RG4A 3ADAB 3AYIA 5U63A 3AB1A 1FT5A 2WDRA 1XHCA 2YLTA 3R9UA 2WP9A 3VRAA 4B67A 3AEEA 2E80A 2C7GA 3O0HA 4H4VA 5FS6A 3IHMA 3RKHA 2XLPA 3DJEA 5JCLA 4IVMB 4NTDA 3CPIG 2VQBA 2QA2A 2ACZA 4H4WA 2A89A 4BK3A 4YSYA 3KVEA 1BF3A 4FK1A 4A6NB 4TM4A 1D7LA 3UTHA 3ALJA 3L1RA 3LZXA 4EM4A 5JCKA 3G5SA 2PHHA 5FS9A 4M52A 2YLZA 3BHFA 1YQ4A 3NYEA 1FT6A 2BC1A 3K30A 4OPIA 1D4EA 3AEDA 4MJWA 1QJDA 1EBDA 2C67A 4IVOB 3UKKA 4BJYA 4J2WA 1NEKA 2AAQA 2YG3A 3ATQA 1N4VA 2BYBA 1H6VA 1LV0A 4FX9A 2Q7VA 1FECA 3EANA 4CCQA 2R4JA 3AXBA 3I6DA 4JDRA 4CNKA 1RYIA 4Z2UA 3QSEA 3UKPA 4Z25A 2VVLA 3NK2X 3OWMA 2RGJA 2OLOA 1EL8A 2VZ2A 3IHGA 2XFQA 2A87A 3K7TA 2WEUA 4U8OA 3P9UA 2VVLG 3SCEA 3GRTA 3REDA 2RF7A 3CNJA 5FS7A 3DA1A 1TDKA 1JRXA 3D1IA 3PS9A 4X9MA 3BNMA 4H4PA 3UKQA 2EQ8A 1E6EA 4HA6A 5BRTA 1M1PA 4L3YA 1GRHA 2XFUA 3SFDA 3CGCA 2C3CA 2VVMA 4EIQA 1JOAA 1BKWA 3UOYA 1O5WA 2C76A 4OPTA 4ADWA 3NH3X 1KNPA 2OA1A 4ZCCA 3BI5A 1NDAA 2EQ7A 2WU2A 1FS7A 1PBFA 3GSIA 4Q0TA 3QSSA 3CNSA 3GDNA 4CY6A 2BS2A 2WDQA 2WOVA 4J31A 1N4UA 3DGZA 1AOGA 3BI4A 3II4A 3SM8A 3ZYXA 4X4JA 1JU2A 1VQWA 2C65A 2X8HA 3P4RA 1TDEA 1Y56A 3LJPA 3G5QA 2OT4A 1PS9A 1ZX9A 2TMDA 3ALLA 3S5WA 2B9WA 5KOWA 2YG7A 3QFAA 4A5LA 1LQUA 1DODA 1Q1WA 2YM1A 2LFCA 1GALA 4OPGA 4U8PA 1H7XA 4U8MA 3UBRA 2V3AA 1GRGA 3NK1X 2FJDA 2IVEA 2V61A 4TM0A 3KLJA 4U8NA 1YQ3A 2GVCA 4EQWA 1GRFA 5JCNA 5JCIA 4J56A 1TDFA 2XYOA 1IUTA 2WQYA 3CGBA 1CJ3A 2YR6A 1XANA 2BS4A 3ALMA 3NRNA 4X9NA 1DXLA 4JNAA 2R45A 2YR5A 3CN8A 2AQJA 1CC6A 4HB9A 4TM3A 3GMBA 4A65A 2X3NA 3AE6A 1H81A 3AEAA 2XVHA 1GSNA 5DBJA 3UKHA 3LB8A 3UKFA 2C3DA 3QJ4A 3AYLA 3CNTA 4JY2A 5JCMA 2BS3A 4JY3A 2E5VA 3UOVA 3GD3A 4IA5A 1B4VA 2BK3A 3B6DA 3GMCA 1X31B 2H89A 1CBOA 1ZDLA 4NEVA 1GPEA 2XLTA 4OCGA 1PDHA 2R0PA 2V6OA 1N4WA 4UDPA 1D4DA 3UP4A 2ZZBA 2YLXA 3M12A 1Q9IA 1LVLA 2BACA 1DJNA 3G5RA 2Z5XA 3RP6A 1EL7A 3T37A 3AE1A 1CF3A 1K0LA 2C66A 3NN0X 4U2LA 3DJJA 2ZBWA 1CC4A 2XLUA 2XVEA 4B66A 3SQPA 2XDOA 1OJ9A 4H4QA 1NHPA 4OPLA 3KKJA 1GTEA 4CY8A 1FS8A 3GYIA 4D03A 3TORA 3E1TA 1B37A 5KVIA 4EM3A 4APNA 2JKCA 1FEBA 3H4KA 2YG5A 1VG0A 4UDRA 5C3JA 4B1BA 4YTMA 3UTGA 2JBVA 3ZDNA 2GMJA 1V59A 2VRMA 4GR1A 2WBAA 5U1OA 4AT0A 3GYJA 2GR0A 2DKHA 4GUVA 2R0CA 1MXTA 2C73A 4TLZA 2BABA 1H83A 3BI2A 4EMJA 1CJ4A 1DOCA 2AR8A 1FCDA 4A9WA 4BURA 1DOEA 4CCRA 3NN6X 1D7YA 4UP3A 2WPCA 4H2RA 4U2TA 1NPXA 3AE2A 1FS9A 4U8LA 4H4TA 4TLXA 4Y4LA 5FMHA 3AE4A 1PXAA 3AYJA 1S3EA 1GRTA 4OVIA 3I3LA 2GQFA 2E1MA 2V60A 2CULA 3IWAA 5HYMA 2GB0A 2GR2A 4FDCB 4J36A 1P2HA 1Z6LA 1DJQA 3VR8A 3DJDA 2RGHA 2YLRA 3K7QX 3UTEA 5HXIA 2V5ZA 3ITJA 4Z43A 1JEHA 3LGQA 1TYTA 1M64A 4Q5CA 1VRQB 2WOWA 2QCUA 2WP6A 1TDNA 3QFBA 2ZZCA 4ZCDA 4EQRA 4K5SA 4NTEA 4KPRA 3OZ2A 2VRLA 1GRBA 4PABA 4BK1A 3BNHA 3CPJG 3EPTA 3S61A 5BVAA 4A99A 1QLBA 1M1QA 1KDGA 1ONFA 1E1MA 3GDPA 3ICTA 2RDZA 1PBEA 3AEFA 4DGKA 1BVBA 3FG2P 2WOIA 5BUKA 2WP5A 4C3XA 3Q9TA 4YTNA 1LJ1A 4C77A 2I0ZA 4O5UA 4RSLA 3EAOA 1GU6A 2NPXA 4B69A 4XWRA 1F8WA 2XCGA 4C3YA 1KSUA 1NG3A 1PN0A 1JRYA 1L0VA 4EQSA 4H4SA 3CGDA 5J7XA 1TDOA 1IUSA 1B5QA 1H7WA 1W4XA 3NG7X 1XDIA 4H2NA 3DH9A 4Y4NA 3LADA 3WE0A 2WESA 3AWIA 5EB4A 2ARDA 1H82A 4Z44A 4B65A 1YY5A 4JQ9A 3S7WA 1YQZA 2WPEA 4ECHA 1UKVG 1BGNA 2Q0KA 3CTYA 1IUXA 1CL0A 3DK4A 5IPYA 1PBDA 2XVJA 2C72A 2OLNA 4WX1A 1H86A 1VG9A 2GAHB 4Z24A 2BCPA 4O5QA 2ZO5A 1F8RA 1E1LA 1ZMCA 3Q6JA 5LV9A 2K3VA 5KVHA 3GD4A 4Q5BA 4TM1A 3KU9A 3FIMB 4XWZA 3L1TA 1PBCA 2X99A 2X8CA 2FBWA 3AECA 3GRSA 3IF9A 4LU6A 2CDUA 4C74A 3NHOX 2E4GA 2OAMA 1F6MA 4WCTA 1JNIA 4YT0A 5EBKA 2XLRA 4A7AA 3DJGX 4K5RA 5GSNA 1ZMDA 3BNJA 4K22A 4H4RA 4DSGA 5TR3A 1COYA 1B8SA 4YKFA 1REOA 2GQWA 4USRA 1GT8A 4BK2A 1PBBA 5CKUA 1FEAA 3KA7A 5IQ4A 1E39A 2GV8A 1OAHA 3V76A 3LZWA 1K4QA 1S2QA 2C70A 3CGEA 1NHRA 2VOUA 3F8DA 3GWFA 3ATRA 2F5ZA 3P1WA 3DGHA 5L46A 3AE9A 1GOSA 4BV6A 1GV4A 4A79A 2FJEA 4EQXA 1ELIA 5ER0A 3UOZA 3NK0X 3VR9A 2WS3A 1QO8A 3M0OA 1CC2A 1IUVA 4U8JA 1NG4A 2RGOA 1O95A 3LOVA 2NVKX 4OPUA 3PVCA 3AE5A 1KF6A 4ZN0A 2WU5A 2X50A 5EOWA 3NLCA 3UCLA 1ZY8A 3QVPA 1Y56B 4AOXA 1GETA 1ZOVA 2XVFA 3K7MX 3LXDA 4N9XA 2BCGG 2VQ7A 2BXSA 3C96A 4Q17A 4L38A 3FO3A 1PJ6A 2R4EA 2O9ZA 2EQ6A 3BNUA 2E81A 4J57A 4REKA 5HHFA 2YVJA 1PXBA 4OPCA 1GNDA 2XLSA 1OJDA 3KD9A 3AE7A 4H50A 4JNQA 1YKJA 5KWFA 4DNAA 1IUWA 1K0IA 2YM2A 4EMIA 3CNPA 4USQA 3ISHA 2J3NA 2GH5A 3F8PA 3NIXA 2YAUA 1GESA 2GR1A 1L9EA 1TYPA 4H2QA 4FK1C 1IJHA 2J7AA 4B68A 1JRZA 4DSHA 4U8IA 4RG3A 4PAAA 4P9SA 1F8SA 2YLSA 3AD7B 3M13A 4ICYA 1S2YA 2IIDA 3AD8B 4Q1OA 4I59A 2R46A 2ZZ0A 4JN9A 2GF3A 2R9ZA 4GDPA 3GWDA 4K8DA 4H7UA 3VRBA 1IUUA 2QA1A 3MMOA 3FBSA 5J60A 1GTHA 3CNDA 3D1CA 3GM6A 1KNRA 1ZP0A 1NENA 1QDBA 2RABA 4H4XA 4AT2A 2PYXA 2Y6QA 4XXGA 4YXDA 2TPRA 2X8GA 4NTCA 2WDVA 5GRTA 2HQMA 3H8LA 2A8XA 2UZZA 4CNJA 4WJYA 2FJBA
chains in the Genus database with same CATH superfamily
3F8RA 3NGCX 1S3BA 3AD9B 3QSMA 1BZLA 3FMWA 1TRBA 3EF6A 3URHA 1ZKQA 2CVJA 1KFYA 3TTBA 4GCMA 4I58A 2XFPA 1N1PA 1DNCA 5IQ1A 3SZWA 4Y4MA 2H88A 3RP7A 1SP3A 2Q6UA 4G6GA 1E1NA 3L8KA 2BC0A 4K7ZA 3OC4A 4GDEA 4NEWA 4Z2RA 3BNFA 1ZOYA 1RSGA 2C64A 1MO9A 2APGA 4KX6A 4B63A 1OJCA 5BULA 3UOXA 3C4AA 5EB5A 5C2TA 5KOXA 3HZLA 4J33A 1GREA 1VDCA 1D4CA 1M1RA 2QAEA 2VR0A 1D5TA 2YG6A 2JB3A 3P4SA 2B76A 3AE3A 4IA6A 3DK8A 2XFOA 1OJTA 3RP8A 1PXCA 1LPFA 1GRAA 4U2SA 1KSSA 3AE8A 4AP1A 4D04A 2FJAA 3IC9A 2C75A 4YSZA 4YKGA 4C5OA 1BGJA 2YG4A 1RP0A 3P4QA 1SEZA 1CJ2A 2WPFA 2YWLA 4GF7A 3COXA 4Z26A 1JNZA 4H4UA 1OJAA 1F3PA 4L3ZA 3AEGA 4L3XA 2Y6RA 3ICSA 4NWZA 3VQRA 4BJZA 1GXFA 4YSXA 5FS8A 1Q1RA 1DOBA 2GMHA 2GR3A 4CRTA 2V3BA 3VRDB 4U8KA 3JSKA 5M0ZA 3NNEA 1GEUA 2B7RA 4EIPA 2Z5YA 3ICRA 4OPDA 2GRTA 3SXQA 4GRTA 4H4YA 4YWOA 3AEBA 2BA9A 2YLWA 2Q0LA 4K2XA 3SXIA 4IV9A 3UTFA 2JB1A 4AP3A 3CPHG 2BK5A 3NYFA 4EMWA 2XVIA 3QVRA 2EQ9A 1NHQA 1JNRA 1CHUA 4YTPA 4AOSA 2R0GA 1LQTA 5KXJA 3F29A 1EL9A 1MOKA 3NYCA 5M10A 1P2EA 3GYXA 3ABVA 3BHKA 2GAGB 1ZK7A 2BK4A 2YR4A 5KRQA 2YVFA 4LIIA 1PHHA 3V3NA 2B9XA 1NHSA 3C4NA 3SGLA 4YSHA 3P4PA 3B3RA 4H4ZA 3LG1A 1GERA 3RNMA 3BNGA 1NAAA 4G6HA 2JAEA 1PJ5A 1E1KA 2WHDA 2B9YA 1CJCA 1H84A 4CBQA 3V3OA 1PJ7A 3NTDA 2OALA 4NZHA 2BXRA 2JK6A 5CQFA 3UKLA 3PO7A 2WETA 2YQUA 1M6IA 3DK9A 4J34A 3T2KA 2DKIA 2GEWA 4A6NA 3KPFA 3H8IA 1Y0PA 1BWCA 3D8XA 1EL5A 3DMEA 2IVDA 4Q4UA 4H2PA 3UP5A 1K0JA 3UU9A 1L9DA 5U25A 1FOHA 2W0HA 3NKSA 4UDQA 1HYUA 4LA1A 1O94A 2JB2A 3RHAA 4B64A 2YVGA 1LTXR 1L9CA 4Z2TA 3UKAA 4E0VA 5HY5A 2B7SA 3NTAA 3NT6A 1E7PA 2CFYA 3SFEA 1FL2A 3FPZA 3T2ZA 2XFNA 3CIRA 1XPQA 4RG4A 3ADAB 3AYIA 5U63A 3AB1A 1FT5A 2WDRA 1XHCA 2YLTA 3R9UA 2WP9A 3VRAA 4B67A 3AEEA 2E80A 2C7GA 3O0HA 4H4VA 5FS6A 3IHMA 3RKHA 2XLPA 3DJEA 5JCLA 4IVMB 4NTDA 3CPIG 2VQBA 2QA2A 2ACZA 4H4WA 2A89A 4BK3A 4YSYA 3KVEA 1BF3A 4G9KA 4FK1A 4A6NB 4TM4A 1D7LA 3UTHA 3ALJA 3L1RA 3LZXA 4EM4A 5JCKA 3G5SA 2PHHA 5FS9A 4M52A 2YLZA 3BHFA 1YQ4A 3NYEA 1FT6A 2BC1A 3K30A 4OPIA 1D4EA 3AEDA 4MJWA 1QJDA 1EBDA 3HYWA 2C67A 4IVOB 3UKKA 4BJYA 4J2WA 1NEKA 2AAQA 2YG3A 3ATQA 1N4VA 2BYBA 1H6VA 1LV0A 4FX9A 2Q7VA 1FECA 3EANA 4CCQA 2R4JA 3AXBA 3I6DA 4JDRA 4CNKA 1RYIA 4Z2UA 3QSEA 3UKPA 4Z25A 2VVLA 3NK2X 3OWMA 2RGJA 2OLOA 1EL8A 2VZ2A 3IHGA 2XFQA 2A87A 3K7TA 2WEUA 4U8OA 3P9UA 2VVLG 3SCEA 3GRTA 3REDA 2RF7A 3CNJA 5FS7A 3DA1A 1TDKA 1JRXA 3D1IA 3PS9A 4X9MA 3BNMA 4H4PA 3UKQA 2EQ8A 1E6EA 4HA6A 5BRTA 1M1PA 4L3YA 1GRHA 2XFUA 3CMMA 3SFDA 3SYIA 3CGCA 5KNLA 2C3CA 2VVMA 4EIQA 1JOAA 3HYVA 3SZ0A 1BKWA 3UOYA 1O5WA 2C76A 4OPTA 4ADWA 3NH3X 1KNPA 2OA1A 4ZCCA 3BI5A 1NDAA 2EQ7A 2WU2A 1FS7A 1PBFA 3GSIA 4Q0TA 3QSSA 3CNSA 3GDNA 4CY6A 2BS2A 2WDQA 2WOVA 4J31A 1N4UA 3DGZA 1AOGA 4II2A 3BI4A 3II4A 3SM8A 3ZYXA 4X4JA 3SZCA 1JU2A 1VQWA 2C65A 2X8HA 3P4RA 1TDEA 1Y56A 3LJPA 3G5QA 2OT4A 4II3A 5KMPA 1PS9A 1ZX9A 2TMDA 3ALLA 3S5WA 2B9WA 5KOWA 2YG7A 3QFAA 4A5LA 1LQUA 1DODA 1Q1WA 2YM1A 2LFCA 1GALA 4OPGA 4U8PA 1H7XA 4U8MA 3UBRA 2V3AA 1GRGA 3NK1X 2FJDA 2IVEA 2V61A 4TM0A 3KLJA 4U8NA 1YQ3A 2GVCA 4EQWA 1GRFA 5JCNA 5JCIA 4J56A 1TDFA 2XYOA 1IUTA 2WQYA 3CGBA 5KMSA 1CJ3A 2YR6A 1XANA 2BS4A 3ALMA 3NRNA 4X9NA 1DXLA 4JNAA 2R45A 2YR5A 3SY4A 3CN8A 2AQJA 1CC6A 4HB9A 4TM3A 3GMBA 4A65A 2X3NA 3AE6A 1H81A 3AEAA 2XVHA 1GSNA 5DBJA 3UKHA 3LB8A 3UKFA 2C3DA 3QJ4A 3AYLA 3CNTA 4JY2A 5JCMA 3HYXA 2BS3A 4JY3A 2E5VA 3UOVA 3GD3A 4IA5A 1B4VA 2BK3A 3B6DA 3GMCA 1X31B 2H89A 4NNJA 1CBOA 1ZDLA 4NEVA 1GPEA 2XLTA 4OCGA 1PDHA 2R0PA 2V6OA 1N4WA 4UDPA 1D4DA 3UP4A 2ZZBA 2YLXA 3M12A 1Q9IA 1LVLA 2BACA 1DJNA 3G5RA 2Z5XA 3RP6A 1EL7A 3T37A 3AE1A 1CF3A 1K0LA 2C66A 3NN0X 4U2LA 3DJJA 2ZBWA 1CC4A 2XLUA 2XVEA 4B66A 3SQPA 2XDOA 1OJ9A 4H4QA 1NHPA 4OPLA 3KKJA 1GTEA 4CY8A 1FS8A 3GYIA 4D03A 3TORA 3E1TA 1B37A 5KVIA 4EM3A 4APNA 2JKCA 1FEBA 3H4KA 2YG5A 1VG0A 4UDRA 5C3JA 4B1BA 4YTMA 3UTGA 2C4CA 2JBVA 3SZFA 3ZDNA 2GMJA 1V59A 2VRMA 4GR1A 2WBAA 5U1OA 4AT0A 3GYJA 2GR0A 4GAVA 2DKHA 4GUVA 2R0CA 1MXTA 2C73A 4TLZA 2BABA 1H83A 3BI2A 4G73A 4EMJA 1CJ4A 1DOCA 2AR8A 1FCDA 4A9WA 4BURA 1DOEA 4CCRA 2BRYA 3NN6X 1D7YA 4UP3A 2WPCA 4H2RA 4U2TA 1NPXA 3AE2A 1FS9A 4U8LA 4H4TA 4TLXA 4Y4LA 5FMHA 3AE4A 1PXAA 3AYJA 1S3EA 1GRTA 4OVIA 3I3LA 2GQFA 2E1MA 2V60A 2CULA 3IWAA 5HYMA 2GB0A 2GR2A 4FDCB 4J36A 1P2HA 1Z6LA 1DJQA 3VR8A 3DJDA 2RGHA 2YLRA 3K7QX 3UTEA 5HXIA 2V5ZA 3ITJA 4Z43A 1JEHA 3LGQA 1TYTA 1M64A 4Q5CA 1VRQB 2WOWA 2QCUA 2WP6A 1TDNA 3QFBA 2ZZCA 4ZCDA 4EQRA 4K5SA 4NTEA 4KPRA 3OZ2A 2VRLA 1GRBA 4PABA 4BK1A 3BNHA 3CPJG 3EPTA 3S61A 5BVAA 4A99A 1QLBA 1M1QA 3T31A 1KDGA 1ONFA 1E1MA 3GDPA 3ICTA 2RDZA 1PBEA 3AEFA 4DGKA 1BVBA 3FG2P 2WOIA 5BUKA 2WP5A 4C3XA 3Q9TA 4YTNA 1LJ1A 4C77A 2I0ZA 4O5UA 4RSLA 3EAOA 1GU6A 2NPXA 4B69A 4XWRA 1F8WA 2XCGA 4C3YA 1KSUA 1NG3A 1PN0A 1JRYA 1L0VA 4EQSA 4H4SA 3CGDA 5J7XA 1TDOA 1IUSA 1B5QA 1H7WA 1W4XA 3NG7X 1XDIA 3T2YA 4H2NA 3DH9A 4Y4NA 3LADA 3WE0A 2WESA 3AWIA 5EB4A 2ARDA 1H82A 4Z44A 4B65A 1YY5A 4JQ9A 3S7WA 1YQZA 2WPEA 4ECHA 1UKVG 1BGNA 2Q0KA 3CTYA 1IUXA 1CL0A 3DK4A 5IPYA 1PBDA 2XVJA 2C72A 4GAPA 2OLNA 2CZSA 4WX1A 1H86A 1VG9A 2GAHB 4Z24A 5KMQA 2BCPA 4O5QA 2ZO5A 1F8RA 1E1LA 1ZMCA 3Q6JA 5LV9A 2K3VA 5KVHA 3GD4A 4Q5BA 4TM1A 3KU9A 3FIMB 4XWZA 3L1TA 1PBCA 2X99A 2X8CA 2FBWA 3AECA 3GRSA 3IF9A 4LU6A 2CDUA 4C74A 3NHOX 2E4GA 2OAMA 1F6MA 5KMRA 4WCTA 1JNIA 4YT0A 5EBKA 2XLRA 4A7AA 3DJGX 4K5RA 5GSNA 1ZMDA 3BNJA 4K22A 4H4RA 4DSGA 5TR3A 1COYA 1B8SA 4YKFA 1REOA 2GQWA 4USRA 1GT8A 4BK2A 1PBBA 3T0KA 5CKUA 1FEAA 3T14A 3KA7A 5IQ4A 1E39A 2GV8A 1OAHA 3V76A 3LZWA 1K4QA 1S2QA 2C70A 3CGEA 1NHRA 2VOUA 3F8DA 3GWFA 3ATRA 2F5ZA 3P1WA 3DGHA 5L46A 3AE9A 1GOSA 4BV6A 1GV4A 4A79A 2FJEA 4EQXA 1ELIA 5ER0A 3UOZA 3NK0X 3VR9A 2WS3A 1QO8A 3M0OA 1CC2A 1IUVA 4U8JA 1NG4A 2RGOA 1O95A 3LOVA 2NVKX 4OPUA 3PVCA 3AE5A 1KF6A 4ZN0A 2WU5A 2X50A 5EOWA 3NLCA 3UCLA 1ZY8A 3QVPA 1Y56B 4AOXA 1GETA 1ZOVA 2XVFA 3K7MX 3LXDA 4N9XA 2BCGG 2VQ7A 4G74A 2BXSA 3C96A 3SX6A 4Q17A 4L38A 3FO3A 1PJ6A 2R4EA 2O9ZA 2EQ6A 3BNUA 2E81A 4J57A 4REKA 5HHFA 2BRAA 2YVJA 1PXBA 4OPCA 1GNDA 2XLSA 1OJDA 3KD9A 3AE7A 4H50A 4JNQA 1YKJA 5KWFA 4DNAA 1IUWA 1K0IA 2YM2A 4EMIA 3CNPA 4USQA 3ISHA 2J3NA 2GH5A 3F8PA 3NIXA 2YAUA 1GESA 2GR1A 1L9EA 1TYPA 4H2QA 4FK1C 1IJHA 2J7AA 4B68A 1JRZA 4DSHA 4U8IA 4RG3A 4PAAA 4P9SA 1F8SA 2YLSA 3AD7B 3M13A 4ICYA 1S2YA 2IIDA 3AD8B 4Q1OA 4I59A 2R46A 2ZZ0A 4JN9A 2GF3A 2R9ZA 4GDPA 3GWDA 4K8DA 3KPKA 4H7UA 3VRBA 1IUUA 2QA1A 3MMOA 3FBSA 5J60A 1GTHA 3CNDA 3D1CA 3GM6A 1KNRA 1ZP0A 1NENA 1QDBA 2RABA 4H4XA 4AT2A 2PYXA 2Y6QA 4XXGA 4YXDA 2TPRA 2X8GA 4NTCA 2WDVA 5GRTA 2HQMA 3H8LA 2A8XA 2UZZA 4CNJA 4WJYA 2FJBA
chains in the Genus database with same CATH topology
3F8RA 3NGCX 1S3BA 3AD9B 3QSMA 1BZLA 3FMWA 1TRBA 3EF6A 3URHA 1ZKQA 2CVJA 1KFYA 3TTBA 4GCMA 4I58A 2XFPA 1N1PA 1DNCA 5IQ1A 3SZWA 4Y4MA 2H88A 3RP7A 1SP3A 2Q6UA 4G6GA 1E1NA 3L8KA 2BC0A 4K7ZA 3OC4A 4GDEA 4NEWA 4Z2RA 3BNFA 1ZOYA 1RSGA 2C64A 1MO9A 2APGA 4KX6A 4B63A 1OJCA 5BULA 3UOXA 3C4AA 5EB5A 5C2TA 5KOXA 3HZLA 4J33A 1GREA 1VDCA 1D4CA 1M1RA 2QAEA 2VR0A 1D5TA 2YG6A 2JB3A 3P4SA 2B76A 3AE3A 4IA6A 3DK8A 2XFOA 1OJTA 3RP8A 1PXCA 1LPFA 1GRAA 4U2SA 1KSSA 3AE8A 4AP1A 4D04A 2FJAA 3IC9A 2C75A 4YSZA 4YKGA 4C5OA 1BGJA 2YG4A 1RP0A 3P4QA 1SEZA 1CJ2A 2WPFA 2YWLA 4GF7A 3COXA 4Z26A 1JNZA 4H4UA 1OJAA 1F3PA 4L3ZA 3AEGA 4L3XA 2Y6RA 3ICSA 4NWZA 3VQRA 4BJZA 1GXFA 4YSXA 5FS8A 1Q1RA 1DOBA 2GMHA 2GR3A 4CRTA 2V3BA 3VRDB 4U8KA 3JSKA 5M0ZA 3NNEA 1GEUA 2B7RA 4EIPA 2Z5YA 3ICRA 4OPDA 2GRTA 3SXQA 4GRTA 4H4YA 4YWOA 3AEBA 2BA9A 2YLWA 2Q0LA 4K2XA 3SXIA 4IV9A 3UTFA 2JB1A 4AP3A 3CPHG 2BK5A 3NYFA 4EMWA 2XVIA 3QVRA 2EQ9A 1NHQA 1JNRA 1CHUA 4YTPA 4AOSA 2R0GA 1LQTA 5KXJA 3F29A 1EL9A 1MOKA 3NYCA 5M10A 1P2EA 3GYXA 3ABVA 3BHKA 2GAGB 1ZK7A 2BK4A 2YR4A 5KRQA 2YVFA 4LIIA 1PHHA 3V3NA 2B9XA 1NHSA 3C4NA 3SGLA 4YSHA 3P4PA 3B3RA 4H4ZA 3LG1A 1GERA 3RNMA 3BNGA 1NAAA 4G6HA 2JAEA 1PJ5A 1E1KA 2WHDA 2B9YA 1CJCA 1H84A 4CBQA 3V3OA 1PJ7A 3NTDA 2OALA 4NZHA 2BXRA 2JK6A 5CQFA 3UKLA 3PO7A 2WETA 2YQUA 1M6IA 3DK9A 4J34A 3T2KA 2DKIA 2GEWA 4A6NA 3KPFA 3H8IA 1Y0PA 1BWCA 3D8XA 1EL5A 3DMEA 2IVDA 4Q4UA 4H2PA 3UP5A 1K0JA 3UU9A 1L9DA 5U25A 1FOHA 2W0HA 3NKSA 4UDQA 1HYUA 4LA1A 1O94A 2JB2A 3RHAA 4B64A 2YVGA 1LTXR 1L9CA 4Z2TA 3UKAA 4E0VA 5HY5A 2B7SA 3NTAA 3NT6A 1E7PA 2CFYA 3SFEA 1FL2A 3FPZA 3T2ZA 2XFNA 3CIRA 1XPQA 4RG4A 3ADAB 3AYIA 5U63A 3AB1A 1FT5A 2WDRA 1XHCA 2YLTA 3R9UA 2WP9A 3VRAA 4B67A 3AEEA 2E80A 2C7GA 3O0HA 4H4VA 5FS6A 3IHMA 3RKHA 2XLPA 3DJEA 5JCLA 4IVMB 4NTDA 3CPIG 2VQBA 2QA2A 2ACZA 4H4WA 2A89A 4BK3A 4YSYA 3KVEA 1BF3A 4G9KA 4FK1A 4A6NB 4TM4A 1D7LA 3UTHA 3ALJA 3L1RA 3LZXA 4EM4A 5JCKA 3G5SA 2PHHA 5FS9A 4M52A 2YLZA 3BHFA 1YQ4A 3NYEA 1FT6A 2BC1A 3K30A 4OPIA 1D4EA 3AEDA 4MJWA 1QJDA 1EBDA 3HYWA 2C67A 4IVOB 3UKKA 4BJYA 4J2WA 1NEKA 2AAQA 2YG3A 3ATQA 1N4VA 2BYBA 1H6VA 1LV0A 4FX9A 2Q7VA 1FECA 3EANA 4CCQA 2R4JA 3AXBA 3I6DA 4JDRA 4CNKA 1RYIA 4Z2UA 3QSEA 3UKPA 4Z25A 2VVLA 3NK2X 3OWMA 2RGJA 2OLOA 1EL8A 2VZ2A 3IHGA 2XFQA 2A87A 3K7TA 2WEUA 4U8OA 3P9UA 2VVLG 3SCEA 3GRTA 3REDA 2RF7A 3CNJA 5FS7A 3DA1A 1TDKA 1JRXA 3D1IA 3PS9A 4X9MA 3BNMA 4H4PA 3UKQA 2EQ8A 1E6EA 4HA6A 5BRTA 1M1PA 4L3YA 1GRHA 2XFUA 3CMMA 3SFDA 3SYIA 3CGCA 5KNLA 2C3CA 2VVMA 4EIQA 1JOAA 3HYVA 3SZ0A 1BKWA 3UOYA 1O5WA 2C76A 4OPTA 4ADWA 3NH3X 1KNPA 2OA1A 4ZCCA 3BI5A 1NDAA 2EQ7A 2WU2A 1FS7A 1PBFA 3GSIA 4Q0TA 3QSSA 3CNSA 3GDNA 4CY6A 2BS2A 2WDQA 2WOVA 4J31A 1N4UA 3DGZA 1AOGA 4II2A 3BI4A 3II4A 3SM8A 3ZYXA 4X4JA 3SZCA 1JU2A 1VQWA 2C65A 2X8HA 3P4RA 1TDEA 1Y56A 3LJPA 3G5QA 2OT4A 4II3A 5KMPA 1PS9A 1ZX9A 2TMDA 3ALLA 3S5WA 2B9WA 5KOWA 2YG7A 3QFAA 4A5LA 1LQUA 1DODA 1Q1WA 2YM1A 2LFCA 1GALA 4OPGA 4U8PA 1H7XA 4U8MA 3UBRA 2V3AA 1GRGA 3NK1X 2FJDA 2IVEA 2V61A 4TM0A 3KLJA 4U8NA 1YQ3A 2GVCA 4EQWA 1GRFA 5JCNA 5JCIA 4J56A 1TDFA 2XYOA 1IUTA 2WQYA 3CGBA 5KMSA 1CJ3A 2YR6A 1XANA 2BS4A 3ALMA 3NRNA 4X9NA 1DXLA 4JNAA 2R45A 2YR5A 3SY4A 3CN8A 2AQJA 1CC6A 4HB9A 4TM3A 3GMBA 4A65A 2X3NA 3AE6A 1H81A 3AEAA 2XVHA 1GSNA 5DBJA 3UKHA 3LB8A 3UKFA 2C3DA 3QJ4A 3AYLA 3CNTA 4JY2A 5JCMA 3HYXA 2BS3A 4JY3A 2E5VA 3UOVA 3GD3A 4IA5A 1B4VA 2BK3A 3B6DA 3GMCA 1X31B 2H89A 4NNJA 1CBOA 1ZDLA 4NEVA 1GPEA 2XLTA 4OCGA 1PDHA 2R0PA 2V6OA 1N4WA 4UDPA 1D4DA 3UP4A 2ZZBA 2YLXA 3M12A 1Q9IA 1LVLA 2BACA 1DJNA 3G5RA 2Z5XA 3RP6A 1EL7A 3T37A 3AE1A 1CF3A 1K0LA 2C66A 3NN0X 4U2LA 3DJJA 2ZBWA 1CC4A 2XLUA 2XVEA 4B66A 3SQPA 2XDOA 1OJ9A 4H4QA 1NHPA 4OPLA 3KKJA 1GTEA 4CY8A 1FS8A 3GYIA 4D03A 3TORA 3E1TA 1B37A 5KVIA 4EM3A 4APNA 2JKCA 1FEBA 3H4KA 2YG5A 1VG0A 4UDRA 5C3JA 4B1BA 4YTMA 3UTGA 2C4CA 2JBVA 3SZFA 3ZDNA 2GMJA 1V59A 2VRMA 4GR1A 2WBAA 5U1OA 4AT0A 3GYJA 2GR0A 4GAVA 2DKHA 4GUVA 2R0CA 1MXTA 2C73A 4TLZA 2BABA 1H83A 3BI2A 4G73A 4EMJA 1CJ4A 1DOCA 2AR8A 1FCDA 4A9WA 4BURA 1DOEA 4CCRA 2BRYA 3NN6X 1D7YA 4UP3A 2WPCA 4H2RA 4U2TA 1NPXA 3AE2A 1FS9A 4U8LA 4H4TA 4TLXA 4Y4LA 5FMHA 3AE4A 1PXAA 3AYJA 1S3EA 1GRTA 4OVIA 3I3LA 2GQFA 2E1MA 2V60A 2CULA 3IWAA 5HYMA 2GB0A 2GR2A 4FDCB 4J36A 1P2HA 1Z6LA 1DJQA 3VR8A 3DJDA 2RGHA 2YLRA 3K7QX 3UTEA 5HXIA 2V5ZA 3ITJA 4Z43A 1JEHA 3LGQA 1TYTA 1M64A 4Q5CA 1VRQB 2WOWA 2QCUA 2WP6A 1TDNA 3QFBA 2ZZCA 4ZCDA 4EQRA 4K5SA 4NTEA 4KPRA 3OZ2A 2VRLA 1GRBA 4PABA 4BK1A 3BNHA 3CPJG 3EPTA 3S61A 5BVAA 4A99A 1QLBA 1M1QA 3T31A 1KDGA 1ONFA 1E1MA 3GDPA 3ICTA 2RDZA 1PBEA 3AEFA 4DGKA 1BVBA 3FG2P 2WOIA 5BUKA 2WP5A 4C3XA 3Q9TA 4YTNA 1LJ1A 4C77A 2I0ZA 4O5UA 4RSLA 3EAOA 1GU6A 2NPXA 4B69A 4XWRA 1F8WA 2XCGA 4C3YA 1KSUA 1NG3A 1PN0A 1JRYA 1L0VA 4EQSA 4H4SA 3CGDA 5J7XA 1TDOA 1IUSA 1B5QA 1H7WA 1W4XA 3NG7X 1XDIA 3T2YA 4H2NA 3DH9A 4Y4NA 3LADA 3WE0A 2WESA 3AWIA 5EB4A 2ARDA 1H82A 4Z44A 4B65A 1YY5A 4JQ9A 3S7WA 1YQZA 2WPEA 4ECHA 1UKVG 1BGNA 2Q0KA 3CTYA 1IUXA 1CL0A 3DK4A 5IPYA 1PBDA 2XVJA 2C72A 4GAPA 2OLNA 4WX1A 1H86A 1VG9A 2GAHB 4Z24A 5KMQA 2BCPA 4O5QA 2ZO5A 1F8RA 1E1LA 1ZMCA 3Q6JA 5LV9A 2K3VA 5KVHA 3GD4A 4Q5BA 4TM1A 3KU9A 3FIMB 4XWZA 3L1TA 1PBCA 2X99A 2X8CA 2FBWA 3AECA 3GRSA 3IF9A 4LU6A 2CDUA 4C74A 3NHOX 2E4GA 2OAMA 1F6MA 5KMRA 4WCTA 1JNIA 4YT0A 5EBKA 2XLRA 4A7AA 3DJGX 4K5RA 5GSNA 1ZMDA 3BNJA 4K22A 4H4RA 4DSGA 5TR3A 1COYA 1B8SA 4YKFA 1REOA 2GQWA 4USRA 1GT8A 4BK2A 1PBBA 3T0KA 5CKUA 1FEAA 3T14A 3KA7A 5IQ4A 1E39A 2GV8A 1OAHA 3V76A 3LZWA 1K4QA 1S2QA 2C70A 3CGEA 1NHRA 2VOUA 3F8DA 3GWFA 3ATRA 2F5ZA 3P1WA 3DGHA 5L46A 3AE9A 1GOSA 4BV6A 1GV4A 4A79A 2FJEA 4EQXA 1ELIA 5ER0A 3UOZA 3NK0X 3VR9A 2WS3A 1QO8A 3M0OA 1CC2A 1IUVA 4U8JA 1NG4A 2RGOA 1O95A 3LOVA 2NVKX 4OPUA 3PVCA 3AE5A 1KF6A 4ZN0A 2WU5A 2X50A 5EOWA 3NLCA 3UCLA 1ZY8A 3QVPA 1Y56B 4AOXA 1GETA 1ZOVA 2XVFA 3K7MX 3LXDA 4N9XA 2BCGG 2VQ7A 4G74A 2BXSA 3C96A 3SX6A 4Q17A 4L38A 3FO3A 1PJ6A 2R4EA 2O9ZA 2EQ6A 3BNUA 2E81A 4J57A 4REKA 5HHFA 2BRAA 2YVJA 1PXBA 4OPCA 1GNDA 2XLSA 1OJDA 3KD9A 3AE7A 4H50A 4JNQA 1YKJA 5KWFA 4DNAA 1IUWA 1K0IA 2YM2A 4EMIA 3CNPA 4USQA 3ISHA 2J3NA 2GH5A 3F8PA 3NIXA 2YAUA 1GESA 2GR1A 1L9EA 1TYPA 4H2QA 4FK1C 1IJHA 2J7AA 4B68A 1JRZA 4DSHA 4U8IA 4RG3A 4PAAA 4P9SA 1F8SA 2YLSA 3AD7B 3M13A 4ICYA 1S2YA 2IIDA 3AD8B 4Q1OA 4I59A 2R46A 2ZZ0A 4JN9A 2GF3A 2R9ZA 4GDPA 3GWDA 4K8DA 3KPKA 4H7UA 3VRBA 1IUUA 2QA1A 3MMOA 3FBSA 5J60A 1GTHA 3CNDA 3D1CA 3GM6A 1KNRA 1ZP0A 1NENA 1QDBA 2RABA 4H4XA 4AT2A 2PYXA 2Y6QA 4XXGA 4YXDA 2TPRA 2X8GA 4NTCA 2WDVA 5GRTA 2HQMA 3H8LA 2A8XA 2UZZA 4CNJA 4WJYA 2FJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8R A;  3NGC X;  1S3B A;  3AD9 B;  3QSM A;  1BZL A;  3FMW A;  1TRB A;  3EF6 A;  3URH A;  1ZKQ A;  2CVJ A;  1KFY A;  3TTB A;  4GCM A;  4I58 A;  2XFP A;  1N1P A;  1DNC A;  5IQ1 A;  4Y4M A;  2H88 A;  3RP7 A;  1SP3 A;  2Q6U A;  1E1N A;  3L8K A;  2BC0 A;  4K7Z A;  3OC4 A;  4GDE A;  4NEW A;  4Z2R A;  3BNF A;  1ZOY A;  1RSG A;  2C64 A;  1MO9 A;  2APG A;  4KX6 A;  4B63 A;  1OJC A;  5BUL A;  3UOX A;  3C4A A;  5EB5 A;  5C2T A;  5KOX A;  3HZL A;  4J33 A;  1GRE A;  1VDC A;  1D4C A;  1M1R A;  2QAE A;  2VR0 A;  1D5T A;  2YG6 A;  2JB3 A;  3P4S A;  2B76 A;  3AE3 A;  4IA6 A;  3DK8 A;  2XFO A;  1OJT A;  3RP8 A;  1PXC A;  1LPF A;  1GRA A;  4U2S A;  1KSS A;  3AE8 A;  4AP1 A;  4D04 A;  2FJA A;  3IC9 A;  2C75 A;  4YSZ A;  4YKG A;  4C5O A;  1BGJ A;  2YG4 A;  1RP0 A;  3P4Q A;  1SEZ A;  1CJ2 A;  2WPF A;  2YWL A;  4GF7 A;  3COX A;  4Z26 A;  1JNZ A;  4H4U A;  1OJA A;  1F3P A;  4L3Z A;  3AEG A;  4L3X A;  2Y6R A;  3ICS A;  3VQR A;  4BJZ A;  4YSX A;  1GXF A;  5FS8 A;  1Q1R A;  1DOB A;  2GMH A;  2GR3 A;  4CRT A;  2V3B A;  3VRD B;  4U8K A;  3JSK A;  5M0Z A;  3NNE A;  1GEU A;  2B7R A;  4EIP A;  2Z5Y A;  3ICR A;  4OPD A;  2GRT A;  3SXQ A;  4GRT A;  4H4Y A;  4YWO A;  3AEB A;  2BA9 A;  2YLW A;  2Q0L A;  4K2X A;  4IV9 A;  3UTF A;  2JB1 A;  4AP3 A;  3CPH G;  2BK5 A;  3NYF A;  4EMW A;  2XVI A;  3QVR A;  2EQ9 A;  1NHQ A;  1JNR A;  1CHU A;  4YTP A;  4AOS A;  2R0G A;  1LQT A;  5KXJ A;  3F29 A;  1EL9 A;  1MOK A;  3NYC A;  5M10 A;  1P2E A;  3GYX A;  3ABV A;  3BHK A;  2GAG B;  1ZK7 A;  2BK4 A;  2YR4 A;  5KRQ A;  2YVF A;  4LII A;  1PHH A;  3V3N A;  2B9X A;  1NHS A;  3C4N A;  3SGL A;  4YSH A;  3P4P A;  3B3R A;  4H4Z A;  3LG1 A;  1GER A;  3RNM A;  3BNG A;  1NAA A;  2JAE A;  1PJ5 A;  1E1K A;  2WHD A;  2B9Y A;  1CJC A;  1H84 A;  4CBQ A;  3V3O A;  1PJ7 A;  3NTD A;  2OAL A;  4NZH A;  2BXR A;  2JK6 A;  5CQF A;  3UKL A;  3PO7 A;  2WET A;  2YQU A;  1M6I A;  3DK9 A;  4J34 A;  2DKI A;  2GEW A;  4A6N A;  3KPF A;  3H8I A;  1Y0P A;  1BWC A;  3D8X A;  1EL5 A;  3DME A;  2IVD A;  4Q4U A;  4H2P A;  3UP5 A;  1K0J A;  3UU9 A;  1L9D A;  5U25 A;  1FOH A;  2W0H A;  3NKS A;  4UDQ A;  1HYU A;  4LA1 A;  1O94 A;  2JB2 A;  3RHA A;  4B64 A;  2YVG A;  1LTX R;  1L9C A;  4Z2T A;  3UKA A;  4E0V A;  5HY5 A;  2B7S A;  3NTA A;  3NT6 A;  1E7P A;  2CFY A;  3SFE A;  1FL2 A;  3FPZ A;  2XFN A;  3CIR A;  1XPQ A;  4RG4 A;  3ADA B;  3AYI A;  5U63 A;  3AB1 A;  1FT5 A;  2WDR A;  1XHC A;  2YLT A;  3R9U A;  2WP9 A;  3VRA A;  4B67 A;  3AEE A;  2E80 A;  2C7G A;  3O0H A;  4H4V A;  5FS6 A;  3IHM A;  3RKH A;  2XLP A;  3DJE A;  5JCL A;  4IVM B;  4NTD A;  3CPI G;  2VQB A;  2QA2 A;  2ACZ A;  4H4W A;  2A89 A;  4BK3 A;  4YSY A;  3KVE A;  1BF3 A;  4FK1 A;  4A6N B;  4TM4 A;  1D7L A;  3UTH A;  3ALJ A;  3L1R A;  3LZX A;  4EM4 A;  5JCK A;  3G5S A;  2PHH A;  5FS9 A;  4M52 A;  2YLZ A;  3BHF A;  1YQ4 A;  3NYE A;  1FT6 A;  2BC1 A;  3K30 A;  4OPI A;  1D4E A;  3AED A;  4MJW A;  1QJD A;  1EBD A;  2C67 A;  4IVO B;  3UKK A;  4BJY A;  4J2W A;  1NEK A;  2AAQ A;  2YG3 A;  3ATQ A;  1N4V A;  2BYB A;  1H6V A;  1LV0 A;  4FX9 A;  2Q7V A;  1FEC A;  3EAN A;  4CCQ A;  2R4J A;  3AXB A;  3I6D A;  4JDR A;  4CNK A;  1RYI A;  4Z2U A;  3QSE A;  3UKP A;  4Z25 A;  2VVL A;  3NK2 X;  3OWM A;  2RGJ A;  2OLO A;  1EL8 A;  2VZ2 A;  3IHG A;  2XFQ A;  2A87 A;  3K7T A;  2WEU A;  4U8O A;  3P9U A;  2VVL G;  3SCE A;  3GRT A;  3RED A;  2RF7 A;  3CNJ A;  5FS7 A;  3DA1 A;  1TDK A;  1JRX A;  3D1I A;  3PS9 A;  4X9M A;  3BNM A;  4H4P A;  3UKQ A;  2EQ8 A;  1E6E A;  4HA6 A;  5BRT A;  1M1P A;  4L3Y A;  1GRH A;  2XFU A;  3SFD A;  3CGC A;  2C3C A;  2VVM A;  4EIQ A;  1JOA A;  1BKW A;  3UOY A;  1O5W A;  2C76 A;  4OPT A;  4ADW A;  3NH3 X;  1KNP A;  2OA1 A;  4ZCC A;  3BI5 A;  1NDA A;  2EQ7 A;  2WU2 A;  1FS7 A;  1PBF A;  3GSI A;  4Q0T A;  3QSS A;  3CNS A;  3GDN A;  4CY6 A;  2BS2 A;  2WDQ A;  2WOV A;  4J31 A;  1N4U A;  3DGZ A;  1AOG A;  3BI4 A;  3II4 A;  3SM8 A;  3ZYX A;  4X4J A;  1JU2 A;  1VQW A;  2C65 A;  2X8H A;  3P4R A;  1TDE A;  1Y56 A;  3LJP A;  3G5Q A;  2OT4 A;  1PS9 A;  1ZX9 A;  2TMD A;  3ALL A;  3S5W A;  2B9W A;  5KOW A;  2YG7 A;  3QFA A;  4A5L A;  1LQU A;  1DOD A;  1Q1W A;  2YM1 A;  2LFC A;  1GAL A;  4OPG A;  4U8P A;  1H7X A;  4U8M A;  3UBR A;  2V3A A;  1GRG A;  3NK1 X;  2FJD A;  2IVE A;  2V61 A;  4TM0 A;  3KLJ A;  4U8N A;  1YQ3 A;  2GVC A;  4EQW A;  1GRF A;  5JCN A;  5JCI A;  4J56 A;  1TDF A;  2XYO A;  1IUT A;  2WQY A;  3CGB A;  1CJ3 A;  2YR6 A;  1XAN A;  2BS4 A;  3ALM A;  3NRN A;  4X9N A;  1DXL A;  4JNA A;  2R45 A;  2YR5 A;  3CN8 A;  2AQJ A;  1CC6 A;  4HB9 A;  4TM3 A;  3GMB A;  4A65 A;  2X3N A;  3AE6 A;  1H81 A;  3AEA A;  2XVH A;  1GSN A;  5DBJ A;  3UKH A;  3LB8 A;  3UKF A;  2C3D A;  3QJ4 A;  3AYL A;  3CNT A;  4JY2 A;  5JCM A;  2BS3 A;  4JY3 A;  2E5V A;  3UOV A;  3GD3 A;  4IA5 A;  1B4V A;  2BK3 A;  3B6D A;  3GMC A;  1X31 B;  2H89 A;  1CBO A;  1ZDL A;  4NEV A;  1GPE A;  2XLT A;  4OCG A;  1PDH A;  2R0P A;  2V6O A;  1N4W A;  4UDP A;  1D4D A;  3UP4 A;  2ZZB A;  2YLX A;  3M12 A;  1Q9I A;  1LVL A;  2BAC A;  1DJN A;  3G5R A;  2Z5X A;  3RP6 A;  1EL7 A;  3T37 A;  3AE1 A;  1CF3 A;  1K0L A;  2C66 A;  3NN0 X;  4U2L A;  3DJJ A;  2ZBW A;  1CC4 A;  2XLU A;  2XVE A;  4B66 A;  3SQP A;  2XDO A;  1OJ9 A;  4H4Q A;  1NHP A;  4OPL A;  3KKJ A;  1GTE A;  4CY8 A;  1FS8 A;  3GYI A;  4D03 A;  3TOR A;  3E1T A;  1B37 A;  5KVI A;  4EM3 A;  4APN A;  2JKC A;  1FEB A;  3H4K A;  2YG5 A;  1VG0 A;  4UDR A;  5C3J A;  4B1B A;  4YTM A;  3UTG A;  2JBV A;  3ZDN A;  2GMJ A;  1V59 A;  2VRM A;  4GR1 A;  2WBA A;  5U1O A;  4AT0 A;  3GYJ A;  2GR0 A;  2DKH A;  4GUV A;  2R0C A;  1MXT A;  2C73 A;  4TLZ A;  2BAB A;  1H83 A;  3BI2 A;  4EMJ A;  1CJ4 A;  1DOC A;  2AR8 A;  1FCD A;  4A9W A;  4BUR A;  1DOE A;  4CCR A;  3NN6 X;  1D7Y A;  4UP3 A;  2WPC A;  4H2R A;  4U2T A;  1NPX A;  3AE2 A;  1FS9 A;  4U8L A;  4H4T A;  4TLX A;  4Y4L A;  5FMH A;  3AE4 A;  1PXA A;  3AYJ A;  1S3E A;  1GRT A;  4OVI A;  3I3L A;  2GQF A;  2E1M A;  2V60 A;  2CUL A;  3IWA A;  5HYM A;  2GB0 A;  2GR2 A;  4FDC B;  4J36 A;  1P2H A;  1Z6L A;  1DJQ A;  3VR8 A;  3DJD A;  2RGH A;  2YLR A;  3K7Q X;  3UTE A;  5HXI A;  2V5Z A;  3ITJ A;  4Z43 A;  1JEH A;  3LGQ A;  1TYT A;  1M64 A;  4Q5C A;  1VRQ B;  2WOW A;  2QCU A;  2WP6 A;  1TDN A;  3QFB A;  2ZZC A;  4ZCD A;  4EQR A;  4K5S A;  4NTE A;  4KPR A;  3OZ2 A;  2VRL A;  1GRB A;  4PAB A;  4BK1 A;  3BNH A;  3CPJ G;  3EPT A;  3S61 A;  5BVA A;  4A99 A;  1QLB A;  1M1Q A;  1KDG A;  1ONF A;  1E1M A;  3GDP A;  3ICT A;  2RDZ A;  1PBE A;  3AEF A;  4DGK A;  1BVB A;  3FG2 P;  2WOI A;  5BUK A;  2WP5 A;  4C3X A;  3Q9T A;  4YTN A;  1LJ1 A;  4C77 A;  2I0Z A;  4O5U A;  4RSL A;  3EAO A;  1GU6 A;  2NPX A;  4B69 A;  4XWR A;  1F8W A;  2XCG A;  4C3Y A;  1KSU A;  1NG3 A;  1PN0 A;  1JRY A;  1L0V A;  4EQS A;  4H4S A;  3CGD A;  5J7X A;  1TDO A;  1IUS A;  1B5Q A;  1H7W A;  1W4X A;  3NG7 X;  1XDI A;  4H2N A;  3DH9 A;  4Y4N A;  3LAD A;  3WE0 A;  2WES A;  3AWI A;  5EB4 A;  2ARD A;  1H82 A;  4Z44 A;  4B65 A;  1YY5 A;  4JQ9 A;  3S7W A;  1YQZ A;  2WPE A;  4ECH A;  1UKV G;  1BGN A;  2Q0K A;  3CTY A;  1IUX A;  1CL0 A;  3DK4 A;  5IPY A;  1PBD A;  2XVJ A;  2C72 A;  2OLN A;  4WX1 A;  1H86 A;  1VG9 A;  2GAH B;  4Z24 A;  2BCP A;  4O5Q A;  2ZO5 A;  1F8R A;  1E1L A;  1ZMC A;  3Q6J A;  5LV9 A;  2K3V A;  5KVH A;  3GD4 A;  4Q5B A;  4TM1 A;  3KU9 A;  3FIM B;  4XWZ A;  3L1T A;  1PBC A;  2X99 A;  2X8C A;  2FBW A;  3AEC A;  3GRS A;  3IF9 A;  4LU6 A;  2CDU A;  4C74 A;  3NHO X;  2E4G A;  2OAM A;  1F6M A;  4WCT A;  1JNI A;  4YT0 A;  5EBK A;  2XLR A;  4A7A A;  3DJG X;  4K5R A;  5GSN A;  1ZMD A;  3BNJ A;  4K22 A;  4H4R A;  4DSG A;  5TR3 A;  1COY A;  1B8S A;  4YKF A;  1REO A;  2GQW A;  4USR A;  1GT8 A;  4BK2 A;  1PBB A;  5CKU A;  1FEA A;  3KA7 A;  5IQ4 A;  1E39 A;  2GV8 A;  1OAH A;  3V76 A;  3LZW A;  1K4Q A;  1S2Q A;  2C70 A;  3CGE A;  1NHR A;  2VOU A;  3F8D A;  3GWF A;  3ATR A;  2F5Z A;  3P1W A;  3DGH A;  5L46 A;  3AE9 A;  1GOS A;  4BV6 A;  1GV4 A;  4A79 A;  2FJE A;  4EQX A;  1ELI A;  5ER0 A;  3UOZ A;  3NK0 X;  3VR9 A;  2WS3 A;  1QO8 A;  3M0O A;  1CC2 A;  1IUV A;  4U8J A;  1NG4 A;  2RGO A;  1O95 A;  3LOV A;  2NVK X;  4OPU A;  3PVC A;  3AE5 A;  1KF6 A;  4ZN0 A;  2WU5 A;  2X50 A;  5EOW A;  3NLC A;  3UCL A;  1ZY8 A;  3QVP A;  1Y56 B;  4AOX A;  1GET A;  1ZOV A;  2XVF A;  3K7M X;  3LXD A;  4N9X A;  2BCG G;  2VQ7 A;  2BXS A;  3C96 A;  4Q17 A;  4L38 A;  3FO3 A;  1PJ6 A;  2R4E A;  2O9Z A;  2EQ6 A;  3BNU A;  2E81 A;  4J57 A;  4REK A;  5HHF A;  2YVJ A;  1PXB A;  4OPC A;  1GND A;  2XLS A;  1OJD A;  3KD9 A;  3AE7 A;  4H50 A;  4JNQ A;  1YKJ A;  5KWF A;  4DNA A;  1IUW A;  1K0I A;  2YM2 A;  4EMI A;  3CNP A;  4USQ A;  3ISH A;  2J3N A;  2GH5 A;  3F8P A;  3NIX A;  2YAU A;  1GES A;  2GR1 A;  1L9E A;  1TYP A;  4H2Q A;  4FK1 C;  1IJH A;  2J7A A;  4B68 A;  1JRZ A;  4DSH A;  4U8I A;  4RG3 A;  4PAA A;  4P9S A;  1F8S A;  2YLS A;  3AD7 B;  3M13 A;  4ICY A;  1S2Y A;  2IID A;  3AD8 B;  4Q1O A;  4I59 A;  2R46 A;  2ZZ0 A;  4JN9 A;  2GF3 A;  2R9Z A;  4GDP A;  3GWD A;  4K8D A;  4H7U A;  3VRB A;  1IUU A;  2QA1 A;  3MMO A;  3FBS A;  5J60 A;  1GTH A;  3CND A;  3D1C A;  3GM6 A;  1KNR A;  1ZP0 A;  1NEN A;  1QDB A;  2RAB A;  4H4X A;  4AT2 A;  2PYX A;  2Y6Q A;  4XXG A;  4YXD A;  2TPR A;  2X8G A;  4NTC A;  2WDV A;  5GRT A;  2HQM A;  3H8L A;  2A8X A;  2UZZ A;  4CNJ A;  4WJY A;  2FJB A; 
#chains in the Genus database with same CATH topology
 3F8R A;  3NGC X;  1S3B A;  3AD9 B;  3QSM A;  1BZL A;  3FMW A;  1TRB A;  3EF6 A;  3URH A;  1ZKQ A;  2CVJ A;  1KFY A;  3TTB A;  4GCM A;  4I58 A;  2XFP A;  1N1P A;  1DNC A;  5IQ1 A;  3SZW A;  4Y4M A;  2H88 A;  3RP7 A;  1SP3 A;  2Q6U A;  4G6G A;  1E1N A;  3L8K A;  2BC0 A;  4K7Z A;  3OC4 A;  4GDE A;  4NEW A;  4Z2R A;  3BNF A;  1ZOY A;  1RSG A;  2C64 A;  1MO9 A;  2APG A;  4KX6 A;  4B63 A;  1OJC A;  5BUL A;  3UOX A;  3C4A A;  5EB5 A;  5C2T A;  5KOX A;  3HZL A;  4J33 A;  1GRE A;  1VDC A;  1D4C A;  1M1R A;  2QAE A;  2VR0 A;  1D5T A;  2YG6 A;  2JB3 A;  3P4S A;  2B76 A;  3AE3 A;  4IA6 A;  3DK8 A;  2XFO A;  1OJT A;  3RP8 A;  1PXC A;  1LPF A;  1GRA A;  4U2S A;  1KSS A;  3AE8 A;  4AP1 A;  4D04 A;  2FJA A;  3IC9 A;  2C75 A;  4YSZ A;  4YKG A;  4C5O A;  1BGJ A;  2YG4 A;  1RP0 A;  3P4Q A;  1SEZ A;  1CJ2 A;  2WPF A;  2YWL A;  4GF7 A;  3COX A;  4Z26 A;  1JNZ A;  4H4U A;  1OJA A;  1F3P A;  4L3Z A;  3AEG A;  4L3X A;  2Y6R A;  3ICS A;  4NWZ A;  3VQR A;  4BJZ A;  1GXF A;  4YSX A;  5FS8 A;  1Q1R A;  1DOB A;  2GMH A;  2GR3 A;  4CRT A;  2V3B A;  3VRD B;  4U8K A;  3JSK A;  5M0Z A;  3NNE A;  1GEU A;  2B7R A;  4EIP A;  2Z5Y A;  3ICR A;  4OPD A;  2GRT A;  3SXQ A;  4GRT A;  4H4Y A;  4YWO A;  3AEB A;  2BA9 A;  2YLW A;  2Q0L A;  4K2X A;  3SXI A;  4IV9 A;  3UTF A;  2JB1 A;  4AP3 A;  3CPH G;  2BK5 A;  3NYF A;  4EMW A;  2XVI A;  3QVR A;  2EQ9 A;  1NHQ A;  1JNR A;  1CHU A;  4YTP A;  4AOS A;  2R0G A;  1LQT A;  5KXJ A;  3F29 A;  1EL9 A;  1MOK A;  3NYC A;  5M10 A;  1P2E A;  3GYX A;  3ABV A;  3BHK A;  2GAG B;  1ZK7 A;  2BK4 A;  2YR4 A;  5KRQ A;  2YVF A;  4LII A;  1PHH A;  3V3N A;  2B9X A;  1NHS A;  3C4N A;  3SGL A;  4YSH A;  3P4P A;  3B3R A;  4H4Z A;  3LG1 A;  1GER A;  3RNM A;  3BNG A;  1NAA A;  4G6H A;  2JAE A;  1PJ5 A;  1E1K A;  2WHD A;  2B9Y A;  1CJC A;  1H84 A;  4CBQ A;  3V3O A;  1PJ7 A;  3NTD A;  2OAL A;  4NZH A;  2BXR A;  2JK6 A;  5CQF A;  3UKL A;  3PO7 A;  2WET A;  2YQU A;  1M6I A;  3DK9 A;  4J34 A;  3T2K A;  2DKI A;  2GEW A;  4A6N A;  3KPF A;  3H8I A;  1Y0P A;  1BWC A;  3D8X A;  1EL5 A;  3DME A;  2IVD A;  4Q4U A;  4H2P A;  3UP5 A;  1K0J A;  3UU9 A;  1L9D A;  5U25 A;  1FOH A;  2W0H A;  3NKS A;  4UDQ A;  1HYU A;  4LA1 A;  1O94 A;  2JB2 A;  3RHA A;  4B64 A;  2YVG A;  1LTX R;  1L9C A;  4Z2T A;  3UKA A;  4E0V A;  5HY5 A;  2B7S A;  3NTA A;  3NT6 A;  1E7P A;  2CFY A;  3SFE A;  1FL2 A;  3FPZ A;  3T2Z A;  2XFN A;  3CIR A;  1XPQ A;  4RG4 A;  3ADA B;  3AYI A;  5U63 A;  3AB1 A;  1FT5 A;  2WDR A;  1XHC A;  2YLT A;  3R9U A;  2WP9 A;  3VRA A;  4B67 A;  3AEE A;  2E80 A;  2C7G A;  3O0H A;  4H4V A;  5FS6 A;  3IHM A;  3RKH A;  2XLP A;  3DJE A;  5JCL A;  4IVM B;  4NTD A;  3CPI G;  2VQB A;  2QA2 A;  2ACZ A;  4H4W A;  2A89 A;  4BK3 A;  4YSY A;  3KVE A;  1BF3 A;  4G9K A;  4FK1 A;  4A6N B;  4TM4 A;  1D7L A;  3UTH A;  3ALJ A;  3L1R A;  3LZX A;  4EM4 A;  5JCK A;  3G5S A;  2PHH A;  5FS9 A;  4M52 A;  2YLZ A;  3BHF A;  1YQ4 A;  3NYE A;  1FT6 A;  2BC1 A;  3K30 A;  4OPI A;  1D4E A;  3AED A;  4MJW A;  1QJD A;  1EBD A;  3HYW A;  2C67 A;  4IVO B;  3UKK A;  4BJY A;  4J2W A;  1NEK A;  2AAQ A;  2YG3 A;  3ATQ A;  1N4V A;  2BYB A;  1H6V A;  1LV0 A;  4FX9 A;  2Q7V A;  1FEC A;  3EAN A;  4CCQ A;  2R4J A;  3AXB A;  3I6D A;  4JDR A;  4CNK A;  1RYI A;  4Z2U A;  3QSE A;  3UKP A;  4Z25 A;  2VVL A;  3NK2 X;  3OWM A;  2RGJ A;  2OLO A;  1EL8 A;  2VZ2 A;  3IHG A;  2XFQ A;  2A87 A;  3K7T A;  2WEU A;  4U8O A;  3P9U A;  2VVL G;  3SCE A;  3GRT A;  3RED A;  2RF7 A;  3CNJ A;  5FS7 A;  3DA1 A;  1TDK A;  1JRX A;  3D1I A;  3PS9 A;  4X9M A;  3BNM A;  4H4P A;  3UKQ A;  2EQ8 A;  1E6E A;  4HA6 A;  5BRT A;  1M1P A;  4L3Y A;  1GRH A;  2XFU A;  3CMM A;  3SFD A;  3SYI A;  3CGC A;  5KNL A;  2C3C A;  2VVM A;  4EIQ A;  1JOA A;  3HYV A;  3SZ0 A;  1BKW A;  3UOY A;  1O5W A;  2C76 A;  4OPT A;  4ADW A;  3NH3 X;  1KNP A;  2OA1 A;  4ZCC A;  3BI5 A;  1NDA A;  2EQ7 A;  2WU2 A;  1FS7 A;  1PBF A;  3GSI A;  4Q0T A;  3QSS A;  3CNS A;  3GDN A;  4CY6 A;  2BS2 A;  2WDQ A;  2WOV A;  4J31 A;  1N4U A;  3DGZ A;  1AOG A;  4II2 A;  3BI4 A;  3II4 A;  3SM8 A;  3ZYX A;  4X4J A;  3SZC A;  1JU2 A;  1VQW A;  2C65 A;  2X8H A;  3P4R A;  1TDE A;  1Y56 A;  3LJP A;  3G5Q A;  2OT4 A;  4II3 A;  5KMP A;  1PS9 A;  1ZX9 A;  2TMD A;  3ALL A;  3S5W A;  2B9W A;  5KOW A;  2YG7 A;  3QFA A;  4A5L A;  1LQU A;  1DOD A;  1Q1W A;  2YM1 A;  2LFC A;  1GAL A;  4OPG A;  4U8P A;  1H7X A;  4U8M A;  3UBR A;  2V3A A;  1GRG A;  3NK1 X;  2FJD A;  2IVE A;  2V61 A;  4TM0 A;  3KLJ A;  4U8N A;  1YQ3 A;  2GVC A;  4EQW A;  1GRF A;  5JCN A;  5JCI A;  4J56 A;  1TDF A;  2XYO A;  1IUT A;  2WQY A;  3CGB A;  5KMS A;  1CJ3 A;  2YR6 A;  1XAN A;  2BS4 A;  3ALM A;  3NRN A;  4X9N A;  1DXL A;  4JNA A;  2R45 A;  2YR5 A;  3SY4 A;  3CN8 A;  2AQJ A;  1CC6 A;  4HB9 A;  4TM3 A;  3GMB A;  4A65 A;  2X3N A;  3AE6 A;  1H81 A;  3AEA A;  2XVH A;  1GSN A;  5DBJ A;  3UKH A;  3LB8 A;  3UKF A;  2C3D A;  3QJ4 A;  3AYL A;  3CNT A;  4JY2 A;  5JCM A;  3HYX A;  2BS3 A;  4JY3 A;  2E5V A;  3UOV A;  3GD3 A;  4IA5 A;  1B4V A;  2BK3 A;  3B6D A;  3GMC A;  1X31 B;  2H89 A;  4NNJ A;  1CBO A;  1ZDL A;  4NEV A;  1GPE A;  2XLT A;  4OCG A;  1PDH A;  2R0P A;  2V6O A;  1N4W A;  4UDP A;  1D4D A;  3UP4 A;  2ZZB A;  2YLX A;  3M12 A;  1Q9I A;  1LVL A;  2BAC A;  1DJN A;  3G5R A;  2Z5X A;  3RP6 A;  1EL7 A;  3T37 A;  3AE1 A;  1CF3 A;  1K0L A;  2C66 A;  3NN0 X;  4U2L A;  3DJJ A;  2ZBW A;  1CC4 A;  2XLU A;  2XVE A;  4B66 A;  3SQP A;  2XDO A;  1OJ9 A;  4H4Q A;  1NHP A;  4OPL A;  3KKJ A;  1GTE A;  4CY8 A;  1FS8 A;  3GYI A;  4D03 A;  3TOR A;  3E1T A;  1B37 A;  5KVI A;  4EM3 A;  4APN A;  2JKC A;  1FEB A;  3H4K A;  2YG5 A;  1VG0 A;  4UDR A;  5C3J A;  4B1B A;  4YTM A;  3UTG A;  2C4C A;  2JBV A;  3SZF A;  3ZDN A;  2GMJ A;  1V59 A;  2VRM A;  4GR1 A;  2WBA A;  5U1O A;  4AT0 A;  3GYJ A;  2GR0 A;  4GAV A;  2DKH A;  4GUV A;  2R0C A;  1MXT A;  2C73 A;  4TLZ A;  2BAB A;  1H83 A;  3BI2 A;  4G73 A;  4EMJ A;  1CJ4 A;  1DOC A;  2AR8 A;  1FCD A;  4A9W A;  4BUR A;  1DOE A;  4CCR A;  2BRY A;  3NN6 X;  1D7Y A;  4UP3 A;  2WPC A;  4H2R A;  4U2T A;  1NPX A;  3AE2 A;  1FS9 A;  4U8L A;  4H4T A;  4TLX A;  4Y4L A;  5FMH A;  3AE4 A;  1PXA A;  3AYJ A;  1S3E A;  1GRT A;  4OVI A;  3I3L A;  2GQF A;  2E1M A;  2V60 A;  2CUL A;  3IWA A;  5HYM A;  2GB0 A;  2GR2 A;  4FDC B;  4J36 A;  1P2H A;  1Z6L A;  1DJQ A;  3VR8 A;  3DJD A;  2RGH A;  2YLR A;  3K7Q X;  3UTE A;  5HXI A;  2V5Z A;  3ITJ A;  4Z43 A;  1JEH A;  3LGQ A;  1TYT A;  1M64 A;  4Q5C A;  1VRQ B;  2WOW A;  2QCU A;  2WP6 A;  1TDN A;  3QFB A;  2ZZC A;  4ZCD A;  4EQR A;  4K5S A;  4NTE A;  4KPR A;  3OZ2 A;  2VRL A;  1GRB A;  4PAB A;  4BK1 A;  3BNH A;  3CPJ G;  3EPT A;  3S61 A;  5BVA A;  4A99 A;  1QLB A;  1M1Q A;  3T31 A;  1KDG A;  1ONF A;  1E1M A;  3GDP A;  3ICT A;  2RDZ A;  1PBE A;  3AEF A;  4DGK A;  1BVB A;  3FG2 P;  2WOI A;  5BUK A;  2WP5 A;  4C3X A;  3Q9T A;  4YTN A;  1LJ1 A;  4C77 A;  2I0Z A;  4O5U A;  4RSL A;  3EAO A;  1GU6 A;  2NPX A;  4B69 A;  4XWR A;  1F8W A;  2XCG A;  4C3Y A;  1KSU A;  1NG3 A;  1PN0 A;  1JRY A;  1L0V A;  4EQS A;  4H4S A;  3CGD A;  5J7X A;  1TDO A;  1IUS A;  1B5Q A;  1H7W A;  1W4X A;  3NG7 X;  1XDI A;  3T2Y A;  4H2N A;  3DH9 A;  4Y4N A;  3LAD A;  3WE0 A;  2WES A;  3AWI A;  5EB4 A;  2ARD A;  1H82 A;  4Z44 A;  4B65 A;  1YY5 A;  4JQ9 A;  3S7W A;  1YQZ A;  2WPE A;  4ECH A;  1UKV G;  1BGN A;  2Q0K A;  3CTY A;  1IUX A;  1CL0 A;  3DK4 A;  5IPY A;  1PBD A;  2XVJ A;  2C72 A;  4GAP A;  2OLN A;  2CZS A;  4WX1 A;  1H86 A;  1VG9 A;  2GAH B;  4Z24 A;  5KMQ A;  2BCP A;  4O5Q A;  2ZO5 A;  1F8R A;  1E1L A;  1ZMC A;  3Q6J A;  5LV9 A;  2K3V A;  5KVH A;  3GD4 A;  4Q5B A;  4TM1 A;  3KU9 A;  3FIM B;  4XWZ A;  3L1T A;  1PBC A;  2X99 A;  2X8C A;  2FBW A;  3AEC A;  3GRS A;  3IF9 A;  4LU6 A;  2CDU A;  4C74 A;  3NHO X;  2E4G A;  2OAM A;  1F6M A;  5KMR A;  4WCT A;  1JNI A;  4YT0 A;  5EBK A;  2XLR A;  4A7A A;  3DJG X;  4K5R A;  5GSN A;  1ZMD A;  3BNJ A;  4K22 A;  4H4R A;  4DSG A;  5TR3 A;  1COY A;  1B8S A;  4YKF A;  1REO A;  2GQW A;  4USR A;  1GT8 A;  4BK2 A;  1PBB A;  3T0K A;  5CKU A;  1FEA A;  3T14 A;  3KA7 A;  5IQ4 A;  1E39 A;  2GV8 A;  1OAH A;  3V76 A;  3LZW A;  1K4Q A;  1S2Q A;  2C70 A;  3CGE A;  1NHR A;  2VOU A;  3F8D A;  3GWF A;  3ATR A;  2F5Z A;  3P1W A;  3DGH A;  5L46 A;  3AE9 A;  1GOS A;  4BV6 A;  1GV4 A;  4A79 A;  2FJE A;  4EQX A;  1ELI A;  5ER0 A;  3UOZ A;  3NK0 X;  3VR9 A;  2WS3 A;  1QO8 A;  3M0O A;  1CC2 A;  1IUV A;  4U8J A;  1NG4 A;  2RGO A;  1O95 A;  3LOV A;  2NVK X;  4OPU A;  3PVC A;  3AE5 A;  1KF6 A;  4ZN0 A;  2WU5 A;  2X50 A;  5EOW A;  3NLC A;  3UCL A;  1ZY8 A;  3QVP A;  1Y56 B;  4AOX A;  1GET A;  1ZOV A;  2XVF A;  3K7M X;  3LXD A;  4N9X A;  2BCG G;  2VQ7 A;  4G74 A;  2BXS A;  3C96 A;  3SX6 A;  4Q17 A;  4L38 A;  3FO3 A;  1PJ6 A;  2R4E A;  2O9Z A;  2EQ6 A;  3BNU A;  2E81 A;  4J57 A;  4REK A;  5HHF A;  2BRA A;  2YVJ A;  1PXB A;  4OPC A;  1GND A;  2XLS A;  1OJD A;  3KD9 A;  3AE7 A;  4H50 A;  4JNQ A;  1YKJ A;  5KWF A;  4DNA A;  1IUW A;  1K0I A;  2YM2 A;  4EMI A;  3CNP A;  4USQ A;  3ISH A;  2J3N A;  2GH5 A;  3F8P A;  3NIX A;  2YAU A;  1GES A;  2GR1 A;  1L9E A;  1TYP A;  4H2Q A;  4FK1 C;  1IJH A;  2J7A A;  4B68 A;  1JRZ A;  4DSH A;  4U8I A;  4RG3 A;  4PAA A;  4P9S A;  1F8S A;  2YLS A;  3AD7 B;  3M13 A;  4ICY A;  1S2Y A;  2IID A;  3AD8 B;  4Q1O A;  4I59 A;  2R46 A;  2ZZ0 A;  4JN9 A;  2GF3 A;  2R9Z A;  4GDP A;  3GWD A;  4K8D A;  3KPK A;  4H7U A;  3VRB A;  1IUU A;  2QA1 A;  3MMO A;  3FBS A;  5J60 A;  1GTH A;  3CND A;  3D1C A;  3GM6 A;  1KNR A;  1ZP0 A;  1NEN A;  1QDB A;  2RAB A;  4H4X A;  4AT2 A;  2PYX A;  2Y6Q A;  4XXG A;  4YXD A;  2TPR A;  2X8G A;  4NTC A;  2WDV A;  5GRT A;  2HQM A;  3H8L A;  2A8X A;  2UZZ A;  4CNJ A;  4WJY A;  2FJB A; 
#chains in the Genus database with same CATH homology
 3F8R A;  3NGC X;  1S3B A;  3AD9 B;  3QSM A;  1BZL A;  3FMW A;  1TRB A;  3EF6 A;  3URH A;  1ZKQ A;  2CVJ A;  1KFY A;  3TTB A;  4GCM A;  4I58 A;  2XFP A;  1N1P A;  1DNC A;  5IQ1 A;  3SZW A;  4Y4M A;  2H88 A;  3RP7 A;  1SP3 A;  2Q6U A;  4G6G A;  1E1N A;  3L8K A;  2BC0 A;  4K7Z A;  3OC4 A;  4GDE A;  4NEW A;  4Z2R A;  3BNF A;  1ZOY A;  1RSG A;  2C64 A;  1MO9 A;  2APG A;  4KX6 A;  4B63 A;  1OJC A;  5BUL A;  3UOX A;  3C4A A;  5EB5 A;  5C2T A;  5KOX A;  3HZL A;  4J33 A;  1GRE A;  1VDC A;  1D4C A;  1M1R A;  2QAE A;  2VR0 A;  1D5T A;  2YG6 A;  2JB3 A;  3P4S A;  2B76 A;  3AE3 A;  4IA6 A;  3DK8 A;  2XFO A;  1OJT A;  3RP8 A;  1PXC A;  1LPF A;  1GRA A;  4U2S A;  1KSS A;  3AE8 A;  4AP1 A;  4D04 A;  2FJA A;  3IC9 A;  2C75 A;  4YSZ A;  4YKG A;  4C5O A;  1BGJ A;  2YG4 A;  1RP0 A;  3P4Q A;  1SEZ A;  1CJ2 A;  2WPF A;  2YWL A;  4GF7 A;  3COX A;  4Z26 A;  1JNZ A;  4H4U A;  1OJA A;  1F3P A;  4L3Z A;  3AEG A;  4L3X A;  2Y6R A;  3ICS A;  4NWZ A;  3VQR A;  4BJZ A;  1GXF A;  4YSX A;  5FS8 A;  1Q1R A;  1DOB A;  2GMH A;  2GR3 A;  4CRT A;  2V3B A;  3VRD B;  4U8K A;  3JSK A;  5M0Z A;  3NNE A;  1GEU A;  2B7R A;  4EIP A;  2Z5Y A;  3ICR A;  4OPD A;  2GRT A;  3SXQ A;  4GRT A;  4H4Y A;  4YWO A;  3AEB A;  2BA9 A;  2YLW A;  2Q0L A;  4K2X A;  3SXI A;  4IV9 A;  3UTF A;  2JB1 A;  4AP3 A;  3CPH G;  2BK5 A;  3NYF A;  4EMW A;  2XVI A;  3QVR A;  2EQ9 A;  1NHQ A;  1JNR A;  1CHU A;  4YTP A;  4AOS A;  2R0G A;  1LQT A;  5KXJ A;  3F29 A;  1EL9 A;  1MOK A;  3NYC A;  5M10 A;  1P2E A;  3GYX A;  3ABV A;  3BHK A;  2GAG B;  1ZK7 A;  2BK4 A;  2YR4 A;  5KRQ A;  2YVF A;  4LII A;  1PHH A;  3V3N A;  2B9X A;  1NHS A;  3C4N A;  3SGL A;  4YSH A;  3P4P A;  3B3R A;  4H4Z A;  3LG1 A;  1GER A;  3RNM A;  3BNG A;  1NAA A;  4G6H A;  2JAE A;  1PJ5 A;  1E1K A;  2WHD A;  2B9Y A;  1CJC A;  1H84 A;  4CBQ A;  3V3O A;  1PJ7 A;  3NTD A;  2OAL A;  4NZH A;  2BXR A;  2JK6 A;  5CQF A;  3UKL A;  3PO7 A;  2WET A;  2YQU A;  1M6I A;  3DK9 A;  4J34 A;  3T2K A;  2DKI A;  2GEW A;  4A6N A;  3KPF A;  3H8I A;  1Y0P A;  1BWC A;  3D8X A;  1EL5 A;  3DME A;  2IVD A;  4Q4U A;  4H2P A;  3UP5 A;  1K0J A;  3UU9 A;  1L9D A;  5U25 A;  1FOH A;  2W0H A;  3NKS A;  4UDQ A;  1HYU A;  4LA1 A;  1O94 A;  2JB2 A;  3RHA A;  4B64 A;  2YVG A;  1LTX R;  1L9C A;  4Z2T A;  3UKA A;  4E0V A;  5HY5 A;  2B7S A;  3NTA A;  3NT6 A;  1E7P A;  2CFY A;  3SFE A;  1FL2 A;  3FPZ A;  3T2Z A;  2XFN A;  3CIR A;  1XPQ A;  4RG4 A;  3ADA B;  3AYI A;  5U63 A;  3AB1 A;  1FT5 A;  2WDR A;  1XHC A;  2YLT A;  3R9U A;  2WP9 A;  3VRA A;  4B67 A;  3AEE A;  2E80 A;  2C7G A;  3O0H A;  4H4V A;  5FS6 A;  3IHM A;  3RKH A;  2XLP A;  3DJE A;  5JCL A;  4IVM B;  4NTD A;  3CPI G;  2VQB A;  2QA2 A;  2ACZ A;  4H4W A;  2A89 A;  4BK3 A;  4YSY A;  3KVE A;  1BF3 A;  4G9K A;  4FK1 A;  4A6N B;  4TM4 A;  1D7L A;  3UTH A;  3ALJ A;  3L1R A;  3LZX A;  4EM4 A;  5JCK A;  3G5S A;  2PHH A;  5FS9 A;  4M52 A;  2YLZ A;  3BHF A;  1YQ4 A;  3NYE A;  1FT6 A;  2BC1 A;  3K30 A;  4OPI A;  1D4E A;  3AED A;  4MJW A;  1QJD A;  1EBD A;  3HYW A;  2C67 A;  4IVO B;  3UKK A;  4BJY A;  4J2W A;  1NEK A;  2AAQ A;  2YG3 A;  3ATQ A;  1N4V A;  2BYB A;  1H6V A;  1LV0 A;  4FX9 A;  2Q7V A;  1FEC A;  3EAN A;  4CCQ A;  2R4J A;  3AXB A;  3I6D A;  4JDR A;  4CNK A;  1RYI A;  4Z2U A;  3QSE A;  3UKP A;  4Z25 A;  2VVL A;  3NK2 X;  3OWM A;  2RGJ A;  2OLO A;  1EL8 A;  2VZ2 A;  3IHG A;  2XFQ A;  2A87 A;  3K7T A;  2WEU A;  4U8O A;  3P9U A;  2VVL G;  3SCE A;  3GRT A;  3RED A;  2RF7 A;  3CNJ A;  5FS7 A;  3DA1 A;  1TDK A;  1JRX A;  3D1I A;  3PS9 A;  4X9M A;  3BNM A;  4H4P A;  3UKQ A;  2EQ8 A;  1E6E A;  4HA6 A;  5BRT A;  1M1P A;  4L3Y A;  1GRH A;  2XFU A;  3CMM A;  3SFD A;  3SYI A;  3CGC A;  5KNL A;  2C3C A;  2VVM A;  4EIQ A;  1JOA A;  3HYV A;  3SZ0 A;  1BKW A;  3UOY A;  1O5W A;  2C76 A;  4OPT A;  4ADW A;  3NH3 X;  1KNP A;  2OA1 A;  4ZCC A;  3BI5 A;  1NDA A;  2EQ7 A;  2WU2 A;  1FS7 A;  1PBF A;  3GSI A;  4Q0T A;  3QSS A;  3CNS A;  3GDN A;  4CY6 A;  2BS2 A;  2WDQ A;  2WOV A;  4J31 A;  1N4U A;  3DGZ A;  1AOG A;  4II2 A;  3BI4 A;  3II4 A;  3SM8 A;  3ZYX A;  4X4J A;  3SZC A;  1JU2 A;  1VQW A;  2C65 A;  2X8H A;  3P4R A;  1TDE A;  1Y56 A;  3LJP A;  3G5Q A;  2OT4 A;  4II3 A;  5KMP A;  1PS9 A;  1ZX9 A;  2TMD A;  3ALL A;  3S5W A;  2B9W A;  5KOW A;  2YG7 A;  3QFA A;  4A5L A;  1LQU A;  1DOD A;  1Q1W A;  2YM1 A;  2LFC A;  1GAL A;  4OPG A;  4U8P A;  1H7X A;  4U8M A;  3UBR A;  2V3A A;  1GRG A;  3NK1 X;  2FJD A;  2IVE A;  2V61 A;  4TM0 A;  3KLJ A;  4U8N A;  1YQ3 A;  2GVC A;  4EQW A;  1GRF A;  5JCN A;  5JCI A;  4J56 A;  1TDF A;  2XYO A;  1IUT A;  2WQY A;  3CGB A;  5KMS A;  1CJ3 A;  2YR6 A;  1XAN A;  2BS4 A;  3ALM A;  3NRN A;  4X9N A;  1DXL A;  4JNA A;  2R45 A;  2YR5 A;  3SY4 A;  3CN8 A;  2AQJ A;  1CC6 A;  4HB9 A;  4TM3 A;  3GMB A;  4A65 A;  2X3N A;  3AE6 A;  1H81 A;  3AEA A;  2XVH A;  1GSN A;  5DBJ A;  3UKH A;  3LB8 A;  3UKF A;  2C3D A;  3QJ4 A;  3AYL A;  3CNT A;  4JY2 A;  5JCM A;  3HYX A;  2BS3 A;  4JY3 A;  2E5V A;  3UOV A;  3GD3 A;  4IA5 A;  1B4V A;  2BK3 A;  3B6D A;  3GMC A;  1X31 B;  2H89 A;  4NNJ A;  1CBO A;  1ZDL A;  4NEV A;  1GPE A;  2XLT A;  4OCG A;  1PDH A;  2R0P A;  2V6O A;  1N4W A;  4UDP A;  1D4D A;  3UP4 A;  2ZZB A;  2YLX A;  3M12 A;  1Q9I A;  1LVL A;  2BAC A;  1DJN A;  3G5R A;  2Z5X A;  3RP6 A;  1EL7 A;  3T37 A;  3AE1 A;  1CF3 A;  1K0L A;  2C66 A;  3NN0 X;  4U2L A;  3DJJ A;  2ZBW A;  1CC4 A;  2XLU A;  2XVE A;  4B66 A;  3SQP A;  2XDO A;  1OJ9 A;  4H4Q A;  1NHP A;  4OPL A;  3KKJ A;  1GTE A;  4CY8 A;  1FS8 A;  3GYI A;  4D03 A;  3TOR A;  3E1T A;  1B37 A;  5KVI A;  4EM3 A;  4APN A;  2JKC A;  1FEB A;  3H4K A;  2YG5 A;  1VG0 A;  4UDR A;  5C3J A;  4B1B A;  4YTM A;  3UTG A;  2C4C A;  2JBV A;  3SZF A;  3ZDN A;  2GMJ A;  1V59 A;  2VRM A;  4GR1 A;  2WBA A;  5U1O A;  4AT0 A;  3GYJ A;  2GR0 A;  4GAV A;  2DKH A;  4GUV A;  2R0C A;  1MXT A;  2C73 A;  4TLZ A;  2BAB A;  1H83 A;  3BI2 A;  4G73 A;  4EMJ A;  1CJ4 A;  1DOC A;  2AR8 A;  1FCD A;  4A9W A;  4BUR A;  1DOE A;  4CCR A;  2BRY A;  3NN6 X;  1D7Y A;  4UP3 A;  2WPC A;  4H2R A;  4U2T A;  1NPX A;  3AE2 A;  1FS9 A;  4U8L A;  4H4T A;  4TLX A;  4Y4L A;  5FMH A;  3AE4 A;  1PXA A;  3AYJ A;  1S3E A;  1GRT A;  4OVI A;  3I3L A;  2GQF A;  2E1M A;  2V60 A;  2CUL A;  3IWA A;  5HYM A;  2GB0 A;  2GR2 A;  4FDC B;  4J36 A;  1P2H A;  1Z6L A;  1DJQ A;  3VR8 A;  3DJD A;  2RGH A;  2YLR A;  3K7Q X;  3UTE A;  5HXI A;  2V5Z A;  3ITJ A;  4Z43 A;  1JEH A;  3LGQ A;  1TYT A;  1M64 A;  4Q5C A;  1VRQ B;  2WOW A;  2QCU A;  2WP6 A;  1TDN A;  3QFB A;  2ZZC A;  4ZCD A;  4EQR A;  4K5S A;  4NTE A;  4KPR A;  3OZ2 A;  2VRL A;  1GRB A;  4PAB A;  4BK1 A;  3BNH A;  3CPJ G;  3EPT A;  3S61 A;  5BVA A;  4A99 A;  1QLB A;  1M1Q A;  3T31 A;  1KDG A;  1ONF A;  1E1M A;  3GDP A;  3ICT A;  2RDZ A;  1PBE A;  3AEF A;  4DGK A;  1BVB A;  3FG2 P;  2WOI A;  5BUK A;  2WP5 A;  4C3X A;  3Q9T A;  4YTN A;  1LJ1 A;  4C77 A;  2I0Z A;  4O5U A;  4RSL A;  3EAO A;  1GU6 A;  2NPX A;  4B69 A;  4XWR A;  1F8W A;  2XCG A;  4C3Y A;  1KSU A;  1NG3 A;  1PN0 A;  1JRY A;  1L0V A;  4EQS A;  4H4S A;  3CGD A;  5J7X A;  1TDO A;  1IUS A;  1B5Q A;  1H7W A;  1W4X A;  3NG7 X;  1XDI A;  3T2Y A;  4H2N A;  3DH9 A;  4Y4N A;  3LAD A;  3WE0 A;  2WES A;  3AWI A;  5EB4 A;  2ARD A;  1H82 A;  4Z44 A;  4B65 A;  1YY5 A;  4JQ9 A;  3S7W A;  1YQZ A;  2WPE A;  4ECH A;  1UKV G;  1BGN A;  2Q0K A;  3CTY A;  1IUX A;  1CL0 A;  3DK4 A;  5IPY A;  1PBD A;  2XVJ A;  2C72 A;  4GAP A;  2OLN A;  4WX1 A;  1H86 A;  1VG9 A;  2GAH B;  4Z24 A;  5KMQ A;  2BCP A;  4O5Q A;  2ZO5 A;  1F8R A;  1E1L A;  1ZMC A;  3Q6J A;  5LV9 A;  2K3V A;  5KVH A;  3GD4 A;  4Q5B A;  4TM1 A;  3KU9 A;  3FIM B;  4XWZ A;  3L1T A;  1PBC A;  2X99 A;  2X8C A;  2FBW A;  3AEC A;  3GRS A;  3IF9 A;  4LU6 A;  2CDU A;  4C74 A;  3NHO X;  2E4G A;  2OAM A;  1F6M A;  5KMR A;  4WCT A;  1JNI A;  4YT0 A;  5EBK A;  2XLR A;  4A7A A;  3DJG X;  4K5R A;  5GSN A;  1ZMD A;  3BNJ A;  4K22 A;  4H4R A;  4DSG A;  5TR3 A;  1COY A;  1B8S A;  4YKF A;  1REO A;  2GQW A;  4USR A;  1GT8 A;  4BK2 A;  1PBB A;  3T0K A;  5CKU A;  1FEA A;  3T14 A;  3KA7 A;  5IQ4 A;  1E39 A;  2GV8 A;  1OAH A;  3V76 A;  3LZW A;  1K4Q A;  1S2Q A;  2C70 A;  3CGE A;  1NHR A;  2VOU A;  3F8D A;  3GWF A;  3ATR A;  2F5Z A;  3P1W A;  3DGH A;  5L46 A;  3AE9 A;  1GOS A;  4BV6 A;  1GV4 A;  4A79 A;  2FJE A;  4EQX A;  1ELI A;  5ER0 A;  3UOZ A;  3NK0 X;  3VR9 A;  2WS3 A;  1QO8 A;  3M0O A;  1CC2 A;  1IUV A;  4U8J A;  1NG4 A;  2RGO A;  1O95 A;  3LOV A;  2NVK X;  4OPU A;  3PVC A;  3AE5 A;  1KF6 A;  4ZN0 A;  2WU5 A;  2X50 A;  5EOW A;  3NLC A;  3UCL A;  1ZY8 A;  3QVP A;  1Y56 B;  4AOX A;  1GET A;  1ZOV A;  2XVF A;  3K7M X;  3LXD A;  4N9X A;  2BCG G;  2VQ7 A;  4G74 A;  2BXS A;  3C96 A;  3SX6 A;  4Q17 A;  4L38 A;  3FO3 A;  1PJ6 A;  2R4E A;  2O9Z A;  2EQ6 A;  3BNU A;  2E81 A;  4J57 A;  4REK A;  5HHF A;  2BRA A;  2YVJ A;  1PXB A;  4OPC A;  1GND A;  2XLS A;  1OJD A;  3KD9 A;  3AE7 A;  4H50 A;  4JNQ A;  1YKJ A;  5KWF A;  4DNA A;  1IUW A;  1K0I A;  2YM2 A;  4EMI A;  3CNP A;  4USQ A;  3ISH A;  2J3N A;  2GH5 A;  3F8P A;  3NIX A;  2YAU A;  1GES A;  2GR1 A;  1L9E A;  1TYP A;  4H2Q A;  4FK1 C;  1IJH A;  2J7A A;  4B68 A;  1JRZ A;  4DSH A;  4U8I A;  4RG3 A;  4PAA A;  4P9S A;  1F8S A;  2YLS A;  3AD7 B;  3M13 A;  4ICY A;  1S2Y A;  2IID A;  3AD8 B;  4Q1O A;  4I59 A;  2R46 A;  2ZZ0 A;  4JN9 A;  2GF3 A;  2R9Z A;  4GDP A;  3GWD A;  4K8D A;  3KPK A;  4H7U A;  3VRB A;  1IUU A;  2QA1 A;  3MMO A;  3FBS A;  5J60 A;  1GTH A;  3CND A;  3D1C A;  3GM6 A;  1KNR A;  1ZP0 A;  1NEN A;  1QDB A;  2RAB A;  4H4X A;  4AT2 A;  2PYX A;  2Y6Q A;  4XXG A;  4YXD A;  2TPR A;  2X8G A;  4NTC A;  2WDV A;  5GRT A;  2HQM A;  3H8L A;  2A8X A;  2UZZ A;  4CNJ A;  4WJY A;  2FJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...