2CZSA

Crystal structure analysis of the diheme c-type cytochrome dhc2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
VRTKKVPLDTNHKRFYDAFAQGAGKLDLDRQCVECHHEKPGGIPFPKNHPVKPADGPMRCLFCHKFKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytochrome c, putative
publication title Structural and Biochemical Characterization of DHC2, a Novel Diheme Cytochrome c from Geobacter sulfurreducens
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Electron transport
total genus 16
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.20 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A, domain 2 2czsA01
2CZSA
chains in the Genus database with same CATH superfamily
1M1PA 1QJDA 3L1TA 1FT6A 4Q1OA 1LJ1A 1M1QA 1M1RA 1JRZA 2E81A 3FO3A 3GM6A 1Q9IA 3OWMA 4L3ZA 4WJYA 1FT5A 2RDZA 1QDBA 3LGQA 3TORA 1D4DA 2J7AA 2B7SA 4Q0TA 2E80A 1GU6A 1FS9A 2ZO5A 3UU9A 3TTBA 1FS7A 3BNFA 3SXQA 1D4CA 1M64A 1JNIA 2RF7A 3F29A 2B7RA 4L3XA 1BVBA 2VR0A 3SCEA 2OT4A 3S7WA 3UBRA 1JRXA 3D1IA 4Q17A 4Q4UA 3BNGA 1E39A 4L3YA 1QO8A 1FS8A 1KSSA 3BNHA 3LG1A 4L38A 4Q5CA 2CZSA 1Y0PA 1P2HA 2K3VA 1P2EA 3RKHA 1D4EA 3BNJA 4Q5BA 1SP3A 1KSUA 1JRYA 1OAHA 3MMOA
chains in the Genus database with same CATH topology
2CZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZS A; 
#chains in the Genus database with same CATH topology
 1M1P A;  1QJD A;  3L1T A;  1FT6 A;  4Q1O A;  1LJ1 A;  1M1Q A;  1M1R A;  1JRZ A;  2E81 A;  3FO3 A;  3GM6 A;  1Q9I A;  3OWM A;  4L3Z A;  4WJY A;  1FT5 A;  2RDZ A;  1QDB A;  3LGQ A;  3TOR A;  1D4D A;  2J7A A;  2B7S A;  4Q0T A;  2E80 A;  1GU6 A;  1FS9 A;  2ZO5 A;  3UU9 A;  3TTB A;  1FS7 A;  3BNF A;  3SXQ A;  1D4C A;  1M64 A;  1JNI A;  2RF7 A;  3F29 A;  2B7R A;  4L3X A;  1BVB A;  2VR0 A;  3SCE A;  2OT4 A;  3S7W A;  3UBR A;  1JRX A;  3D1I A;  4Q17 A;  4Q4U A;  3BNG A;  1E39 A;  4L3Y A;  1QO8 A;  1FS8 A;  1KSS A;  3BNH A;  3LG1 A;  4L38 A;  4Q5C A;  2CZS A;  1Y0P A;  1P2H A;  2K3V A;  1P2E A;  3RKH A;  1D4E A;  3BNJ A;  4Q5B A;  1SP3 A;  1KSU A;  1JRY A;  1OAH A;  3MMO A; 
#chains in the Genus database with same CATH homology
 2CZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...