2CZSA

Crystal structure analysis of the diheme c-type cytochrome dhc2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
VRTKKVPLDTNHKRFYDAFAQGAGKLDLDRQCVECHHEKPGGIPFPKNHPVKPADGPMRCLFCHKFKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords cytochrome c, putative
publication title Structural and Biochemical Characterization of DHC2, a Novel Diheme Cytochrome c from Geobacter sulfurreducens
pubmed doi rcsb
source organism Geobacter sulfurreducens
total genus 16
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.20 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A, domain 2 2czsA01
2CZSA
chains in the Genus database with same CATH superfamily
1M1PA 1FS8A 2CZSA 4WJYA 1KSSA 1M1RA 1FT5A 1D4CA 1Q9IA 3BNHA 1D4EA 3F29A 2J7AA 1LJ1A 3FO3A 3MMOA 4Q17A 2OT4A 4L3ZA 3D1IA 1BVBA 1FS9A 1GU6A 1KSUA 2RF7A 1D4DA 2K3VA 3TTBA 1QJDA 3RKHA 1JRXA 1QO8A 1E39A 3LG1A 2B7RA 1FS7A 4Q4UA 4Q5CA 1OAHA 3BNFA 3L1TA 2ZO5A 3S7WA 3TORA 1JRYA 3UBRA 3OWMA 1JRZA 3LGQA 4L38A 2VR0A 3BNJA 4Q0TA 1M64A 3SCEA 3SXQA 4Q1OA 3BNGA 4L3YA 2E81A 2E80A 1P2EA 1FT6A 1Y0PA 2RDZA 3GM6A 2B7SA 1SP3A 4L3XA 3UU9A 1QDBA 4Q5BA 1P2HA 1JNIA 1M1QA
chains in the Genus database with same CATH topology
2CZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZS A; 
#chains in the Genus database with same CATH topology
 1M1P A;  1FS8 A;  2CZS A;  4WJY A;  1KSS A;  1M1R A;  1FT5 A;  1D4C A;  1Q9I A;  3BNH A;  1D4E A;  3F29 A;  2J7A A;  1LJ1 A;  3FO3 A;  3MMO A;  4Q17 A;  2OT4 A;  4L3Z A;  3D1I A;  1BVB A;  1FS9 A;  1GU6 A;  1KSU A;  2RF7 A;  1D4D A;  2K3V A;  3TTB A;  1QJD A;  3RKH A;  1JRX A;  1QO8 A;  1E39 A;  3LG1 A;  2B7R A;  1FS7 A;  4Q4U A;  4Q5C A;  1OAH A;  3BNF A;  3L1T A;  2ZO5 A;  3S7W A;  3TOR A;  1JRY A;  3UBR A;  3OWM A;  1JRZ A;  3LGQ A;  4L38 A;  2VR0 A;  3BNJ A;  4Q0T A;  1M64 A;  3SCE A;  3SXQ A;  4Q1O A;  3BNG A;  4L3Y A;  2E81 A;  2E80 A;  1P2E A;  1FT6 A;  1Y0P A;  2RDZ A;  3GM6 A;  2B7S A;  1SP3 A;  4L3X A;  3UU9 A;  1QDB A;  4Q5B A;  1P2H A;  1JNI A;  1M1Q A; 
#chains in the Genus database with same CATH homology
 2CZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...