1Q9IA

The a251c:s430c double mutant of flavocytochrome c3 from shewanella frigidimarina
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGCGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLCKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c3
publication title Probing Domain Mobility in a Flavocytochrome
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 193
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1q9iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1q9iA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1q9iA01
4H4PA 1W4XA 3V76A 5KVHA 4NZHA 4YTPA 1LJ1A 2QAEA 4DSHA 4A5LA 1FS8A 4YT0A 3NT6A 2R45A 1ZKQA 1HYUA 3ICTA 3COXA 1YQ4A 2B7RA 4Q5CA 2VVLG 2JKCA 4GUVA 4Z2TA 2ARDA 2WS3A 2JBVA 1F8RA 1FL2A 3CN8A 2C65A 4H2PA 2XVIA 4J34A 4X9MA 1FOHA 3DA1A 4YSXA 2C64A 2OLOA 1IUSA 4J36A 3RP6A 3BHFA 2H89A 2XFQA 3QSMA 5CKUA 2FBWA 2XCGA 1ZMCA 4U2LA 1X31B 1TDOA 3NNEA 4JNQA 4JDRA 3GWFA 1K0LA 2LFCA 2V61A 2Q0KA 4NEWA 4H4TA 4FK1C 4H4XA 1FEBA 3AE5A 2Z5YA 4OPLA 3ATRA 1JRZA 4LA1A 4B68A 2E80A 4GCMA 3AYLA 4A79A 1OAHA 1BWCA 1IUUA 2GVCA 2BK5A 1L0VA 1EL9A 1NDAA 4REKA 1DXLA 4AOXA 2XYOA 5J60A 4J56A 3UOXA 1DNCA 1N4WA 1REOA 2JB3A 2Q7VA 3AEDA 4NTEA 4Z2RA 3BI2A 4TM0A 2Z5XA 4E0VA 1PBBA 1ELIA 3BNUA 2XLRA 3JSKA 4J2WA 1PJ7A 4WX1A 4YKGA 3H4KA 1TYTA 3CPJG 3SGLA 4M52A 3FG2P 1CJCA 5JCKA 4YSHA 3GYXA 3UTFA 3AXBA 1EBDA 2FJBA 4Q1OA 4IA6A 1D4DA 1L9EA 5JCIA 2A89A 4YSZA 3P4RA 5DBJA 3ALLA 1GRFA 3R9UA 4H7UA 3UBRA 3E1TA 4H2RA 1GU6A 1Q1RA 1OJAA 4H2NA 4OPIA 5FS8A 3UP5A 2YVJA 5HY5A 3DJGX 5KWFA 2RDZA 1ZMDA 2C3CA 3GD3A 5C3JA 1CJ4A 2BS3A 3ICSA 1EL5A 4NTDA 2CULA 1LQTA 2BYBA 2K3VA 2J7AA 3AE7A 3LZXA 4OPTA 4TLZA 3GYIA 1KDGA 1NHRA 4B67A 2R0CA 3P4QA 3S5WA 3UKFA 5JCMA 1CJ2A 2WDQA 2XLTA 4NTCA 2W0HA 2C72A 4H4SA 1SP3A 3AD7B 1P2HA 2APGA 4BURA 2WOIA 1CF3A 2B9XA 3FO3A 1N4UA 3H8IA 4U8JA 2PYXA 4USQA 2FJEA 4OCGA 2VRMA 3NKSA 2IVDA 3UOVA 1LV0A 1F8SA 2VQ7A 1Q9IA 3BNGA 5EB5A 4WJYA 2JK6A 2VOUA 5CQFA 2IIDA 2YAUA 4U8NA 1GTEA 1K0IA 4CY6A 2GV8A 1KFYA 2GB0A 1H7XA 3GSIA 4EIPA 2V3AA 4ICYA 2WPEA 3PS9A 2GAHB 2FJDA 2V3BA 2CVJA 4TM4A 1CC6A 4PABA 3LG1A 1PHHA 1VG0A 4O5UA 1NG4A 1S2QA 2X8HA 3LJPA 3BHKA 1F3PA 2ZBWA 2YG3A 3EAOA 3AEEA 3TORA 2E4GA 4YKFA 4K22A 3VRBA 3CGDA 3BNMA 1KSSA 1XHCA 3GRTA 1BGNA 1GESA 2BACA 1CHUA 2HQMA 3K7TA 4H4RA 4TM1A 4EMWA 1ZDLA 4UP3A 1PBEA 1M1QA 4WCTA 3EPTA 1NEKA 4AT0A 4B63A 4C74A 5LV9A 2IVEA 3KVEA 4U8OA 1Y56A 5HHFA 4OPDA 4OPCA 3Q9TA 1B8SA 2B7SA 3P9UA 3FIMB 1GRBA 4H4UA 3SFDA 2E5VA 1CC2A 1K0JA 4A9WA 3CPHG 1PXBA 2XVFA 4U8LA 4H2QA 4RG4A 2PHHA 4CRTA 2VQBA 2GMHA 2YR4A 5GRTA 4KPRA 3P4SA 2X50A 1OJTA 2OLNA 3SM8A 1S2YA 3AE1A 3SQPA 4J31A 3M12A 2V5ZA 2YQUA 3DJEA 1UKVG 1MO9A 2B76A 4TLXA 1GNDA 2GAGB 3L8KA 2C67A 3QSEA 5BULA 5KOWA 3KU9A 2YLXA 2YM2A 1YY5A 2FJAA 3AYJA 4CNJA 3GRSA 2YG6A 3FBSA 1RYIA 1JOAA 3UP4A 3OWMA 1E1KA 1Y56B 2XVEA 4H50A 1GV4A 4C3XA 1LVLA 3IWAA 2GMJA 1IUXA 3UCLA 4AT2A 1M1PA 1S3BA 1OJCA 3KLJA 4JY2A 1H84A 5IQ1A 3DK8A 2DKHA 3SXQA 2WP6A 3GMCA 3KKJA 4OVIA 3F29A 5L46A 4J57A 2RGHA 1XPQA 2NVKX 4XXGA 2ZZBA 2YM1A 2CDUA 3V3OA 4C77A 3C4NA 4GRTA 4I59A 4AOSA 5KXJA 3LB8A 1MXTA 3ALJA 1KNRA 1B37A 1H86A 4TM3A 1TYPA 2YLZA 2XDOA 2XFOA 1QJDA 5FS6A 3C4AA 1ZY8A 1GREA 2WOVA 3AYIA 1VQWA 3CNTA 3G5RA 2BCGG 1ZP0A 1BVBA 1EL7A 2XLUA 1E1MA 3HZLA 3IF9A 2AAQA 2R9ZA 3O0HA 4Y4MA 1DJNA 1FS9A 1M1RA 1BF3A 2YWLA 1FECA 4J33A 4K7ZA 4A65A 4OPUA 3QVPA 4ADWA 2C76A 3LZWA 3NGCX 4GF7A 3BI5A 3NK0X 4CCQA 1TDEA 1H6VA 2GQWA 3RHAA 1RP0A 1FT6A 2WBAA 3ZDNA 2F5ZA 1PN0A 3FMWA 3LOVA 1K4QA 1GRGA 1NHSA 1TRBA 3AECA 3GDNA 3CGEA 2Y6RA 4IVOB 3GD4A 3VR8A 2EQ7A 1PBFA 2WP5A 2GQFA 1COYA 1PJ5A 2WPCA 1GETA 3NYCA 4U8KA 1PXCA 3CGBA 2I0ZA 2RGJA 2X99A 4U8MA 3H8LA 1JRXA 1O94A 4ZCDA 2ACZA 2WDVA 1GRHA 1VRQB 1Q1WA 2Q0LA 2A87A 1JNRA 1NENA 2GR2A 2YLTA 3P4PA 4GDEA 4K8DA 4EIQA 1JEHA 3K7MX 4OPGA 2RF7A 1NHPA 2E81A 4KX6A 5BUKA 1GTHA 4CNKA 3CNPA 4FK1A 2WHDA 5FS9A 3G5SA 4EQRA 1D5TA 1E7PA 5HYMA 3BNJA 4Q5BA 1BGJA 3IC9A 2V60A 2WESA 3NYEA 2WDRA 1CJ3A 2WOWA 1H81A 3NTDA 2BCPA 3CGCA 2VR0A 1JNIA 2GR1A 2XVHA 3NHOX 4RG3A 5FMHA 4H4YA 1JU2A 3GWDA 2R4JA 3Q6JA 3F8DA 1FS7A 1IUTA 2C7GA 4U8IA 1NPXA 1QDBA 2DKIA 2H88A 5GSNA 4BV6A 4EM4A 3NK2X 3UU9A 3II4A 3NK1X 5KOXA 3AE9A 3DK9A 2QCUA 1KNPA 3I6DA 4DNAA 1CBOA 4X9NA 4CBQA 3QJ4A 1M64A 1TDFA 2AR8A 4K2XA 1Z6LA 4L38A 3NN6X 3ABVA 4JN9A 5J7XA 4HA6A 4YTMA 2BA9A 1YQZA 1TDNA 2C75A 1QO8A 4JNAA 3GM6A 1OJ9A 2EQ9A 4U2TA 3UTHA 2RABA 1LQUA 4D03A 3DGHA 1D7LA 2ZZCA 4BK1A 1ZOVA 3AE6A 3GDPA 2UZZA 1PBCA 4CCRA 2BS4A 3NN0X 3MMOA 1NHQA 1BKWA 1GT8A 3CTYA 1B5QA 1GOSA 4X4JA 4Y4LA 3RNMA 1QLBA 4L3YA 1F8WA 1VG9A 3OC4A 3T37A 3P1WA 2YLRA 3RP8A 4ECHA 2BC0A 2CFYA 4D04A 1MOKA 2OA1A 5M10A 2XLPA 2ZO5A 1JNZA 2AQJA 4APNA 4HB9A 3V3NA 3RP7A 3CPIG 2VVMA 2NPXA 3AEGA 3NLCA 3UKPA 4BK3A 5BRTA 1RSGA 2BS2A 4LU6A 2XFUA 1IJHA 2YG5A 1YQ3A 3CNDA 3ICRA 1L9DA 2C66A 3VQRA 1SEZA 2BK4A 1VDCA 3F8PA 4EQSA 4H4VA 4H4ZA 3RKHA 4YXDA 2JB2A 4K5SA 4EQWA 4Z43A 4GDPA 3DGZA 2OAMA 2GR3A 4IA5A 3VRAA 4A7AA 2YG4A 3S7WA 3BI4A 1GRAA 3OZ2A 4DGKA 2B9WA 5BVAA 1H82A 4XWZA 1V59A 3VR9A 1GXFA 1FEAA 4MJWA 1PDHA 1S3EA 3UOZA 3I3LA 4Q0TA 2X3NA 1Y0PA 2BC1A 5EBKA 3NH3X 2XVJA 3UKKA 2R4EA 3S61A 3DH9A 2XFPA 2WU5A 1DJQA 2J3NA 2X8CA 4AP3A 4EQXA 2C70A 2GRTA 2WP9A 1ZX9A 4JQ9A 1NG3A 3ADAB 3UTEA 3LXDA 3D8XA 4FX9A 3KA7A 5TR3A 3VRDB 3AD8B 1XANA 3REDA 1PS9A 2X8GA 4UDRA 1BZLA 1PBDA 4IV9A 2GR0A 3FPZA 3B6DA 1EL8A 5EB4A 5JCLA 3K30A 4ZN0A 1KSUA 5C2TA 3D1IA 2EQ6A 3KD9A 1CC4A 2R0PA 3AEAA 3NIXA 1KF6A 1PXAA 5EOWA 3DK4A 3IHGA 1ZOYA 1N4VA 3GYJA 3SFEA 4EMIA 2VRLA 4Z2UA 2GF3A 1PJ6A 3QSSA 4N9XA 3TTBA 3SCEA 2TMDA 4I58A 2YR5A 3DMEA 2GEWA 4FDCB 4PAAA 3LGQA 4U8PA 2YVGA 2R0GA 3AEBA 3K7QX 3ITJA 1O5WA 2YLSA 3NYFA 4EM3A 3IHMA 2TPRA 3GMBA 3UKQA 1E6EA 5M0ZA 5HXIA 1YKJA 2BXSA 2OALA 1TDKA 4B66A 3PVCA 1GEUA 4A99A 2BABA 1F6MA 3B3RA 3UOYA 1LTXR 3CNJA 1N1PA 4YTNA 2RGOA 4YSYA 3C96A 2ZZ0A 2A8XA 4Y4NA 3CIRA 4AP1A 2WU2A 4Z24A 1D4EA 3F8RA 3DJDA 3AD9B 2VZ2A 5KRQA 4Q17A 5U63A 1ONFA 4GR1A 2R46A 3AWIA 3LADA 1DOCA 1JRYA 2EQ8A 3URHA 3QFAA 1IUVA 2OT4A 2BK3A 4B64A 3ALMA 3KPFA 3EF6A 3ISHA 4B65A 1O95A 3ZYXA 1E1NA 1NAAA 1GALA 4P9SA 4H4QA 4DSGA 4BJYA 3AB1A 4XWRA 1GRTA 4K5RA 4A6NA 2XLSA 1IUWA 3G5QA 4IVMB 4Q4UA 1XDIA 1E39A 2Y6QA 1DOEA 3M13A 4YWOA 3UKHA 1GSNA 3AE2A 1DOBA 2O9ZA 2JB1A 2VVLA 4B1BA 4UDQA 4RSLA 3QFBA 3M0OA 1LPFA 1E1LA 3ATQA 1ZK7A 3CNSA 4H4WA 4UDPA 1AOGA 4U2SA 2QA1A 3L1TA 3BNHA 1B4VA 3UKAA 3D1CA 3AE8A 1GERA 3DJJA 1D7YA 2Q6UA 3AE4A 4USRA 3UTGA 2WQYA 4Z25A 3L1RA 5IPYA 1DODA 2BXRA 5ER0A 4C3YA 2YLWA 4JY3A 4CY8A 1H7WA 3QVRA 3UKLA 1M6IA 3WE0A 4L3XA 1L9CA 2V6OA 2WPFA 4BJZA 4L3ZA 3NRNA 2QA2A 5KVIA 2XFNA 3AE3A 2WEUA 2GH5A 1CL0A 2YR6A 3PO7A 4O5QA 2C73A 4B69A 1D4CA 5JCNA 3NTAA 5IQ4A 4LIIA 1H83A 4ZCCA 4BK2A 3NG7X 5FS7A 4A6NB 2B9YA 2E1MA 4Z44A 2YG7A 1FCDA 1GPEA 4C5OA 4Z26A 3AEFA 5U25A 2JAEA 2YVFA 4EMJA 4NEVA 2WETA 3EANA 3BNFA 5U1OA 1FT5A 1P2EA 1OJDA 2C3DA
chains in the Genus database with same CATH superfamily
4H4PA 1W4XA 3V76A 5KVHA 4NZHA 4YTPA 1LJ1A 2QAEA 4DSHA 4A5LA 1FS8A 4YT0A 3NT6A 2R45A 1ZKQA 1HYUA 3ICTA 3COXA 1YQ4A 2B7RA 4Q5CA 2VVLG 2JKCA 4GUVA 4Z2TA 2ARDA 2WS3A 2JBVA 1F8RA 1FL2A 3CN8A 2C65A 4H2PA 2XVIA 4J34A 4X9MA 1FOHA 3DA1A 4YSXA 2C64A 2OLOA 1IUSA 4J36A 3RP6A 3BHFA 2H89A 2XFQA 3QSMA 2C4CA 2FBWA 5CKUA 2XCGA 1ZMCA 4U2LA 1X31B 1TDOA 3NNEA 4JNQA 4JDRA 3GWFA 1K0LA 2LFCA 2V61A 2Q0KA 4NEWA 4H4TA 4FK1C 3HYWA 4H4XA 1FEBA 3AE5A 2Z5YA 4OPLA 3ATRA 1JRZA 4LA1A 4B68A 2E80A 4GCMA 3AYLA 4A79A 1OAHA 1BWCA 1IUUA 2GVCA 2BK5A 1L0VA 1EL9A 1NDAA 4REKA 1DXLA 4AOXA 2XYOA 5J60A 4J56A 3UOXA 1DNCA 1N4WA 1REOA 2JB3A 2Q7VA 3AEDA 4NTEA 4Z2RA 3BI2A 4TM0A 2Z5XA 3SY4A 4E0VA 1PBBA 1ELIA 3BNUA 2XLRA 3JSKA 4J2WA 1PJ7A 4WX1A 4YKGA 3H4KA 2CZSA 1TYTA 3CPJG 3SGLA 4M52A 3FG2P 1CJCA 5JCKA 3GYXA 4YSHA 3UTFA 3AXBA 1EBDA 2FJBA 4Q1OA 4IA6A 1D4DA 1L9EA 5JCIA 2A89A 4YSZA 3P4RA 5DBJA 3ALLA 1GRFA 3R9UA 4H7UA 3T31A 3UBRA 3E1TA 4H2RA 1GU6A 1Q1RA 1OJAA 4H2NA 4OPIA 5FS8A 3UP5A 2YVJA 5HY5A 3DJGX 5KWFA 2RDZA 1ZMDA 2C3CA 3GD3A 5C3JA 1CJ4A 2BS3A 3ICSA 1EL5A 4NTDA 2CULA 1LQTA 2BYBA 2K3VA 2J7AA 3AE7A 3LZXA 4OPTA 4TLZA 3GYIA 1KDGA 1NHRA 4GAPA 2R0CA 4B67A 3P4QA 3S5WA 3UKFA 5JCMA 1CJ2A 2WDQA 2XLTA 4NTCA 2W0HA 2C72A 4H4SA 1SP3A 3AD7B 1P2HA 2APGA 4BURA 2WOIA 1CF3A 2B9XA 3FO3A 1N4UA 4NWZA 3H8IA 4U8JA 2PYXA 4USQA 2FJEA 4OCGA 2VRMA 3NKSA 2IVDA 3UOVA 1LV0A 1F8SA 2VQ7A 1Q9IA 3BNGA 5EB5A 4WJYA 2JK6A 2VOUA 5CQFA 2IIDA 2YAUA 4U8NA 1GTEA 1K0IA 4CY6A 2GV8A 1KFYA 2GB0A 1H7XA 3GSIA 4EIPA 2V3AA 4ICYA 2WPEA 3PS9A 2GAHB 2FJDA 2V3BA 2CVJA 4TM4A 1CC6A 4PABA 3LG1A 1PHHA 1VG0A 3NTDA 1NG4A 1S2QA 2X8HA 4O5UA 3SZWA 3LJPA 3BHKA 1F3PA 5KMQA 2ZBWA 2YG3A 3EAOA 3AEEA 3TORA 2E4GA 4YKFA 4K22A 3VRBA 3CGDA 3BNMA 1KSSA 1XHCA 3GRTA 1BGNA 1GESA 2BACA 1CHUA 2HQMA 3K7TA 4H4RA 4TM1A 3T2YA 4EMWA 1ZDLA 4UP3A 1PBEA 1M1QA 4WCTA 3EPTA 1NEKA 4AT0A 4B63A 4C74A 5LV9A 2IVEA 3KVEA 4U8OA 1Y56A 5HHFA 4OPDA 4OPCA 3Q9TA 1B8SA 2B7SA 3P9UA 3FIMB 1GRBA 4H4UA 3SFDA 3T0KA 2E5VA 1CC2A 1K0JA 4A9WA 3CPHG 1PXBA 2XVFA 5KMSA 4U8LA 4H2QA 4RG4A 2PHHA 4CRTA 2VQBA 2GMHA 2YR4A 5GRTA 4KPRA 3P4SA 2X50A 1OJTA 2OLNA 4GAVA 1S2YA 3AE1A 3SM8A 4J31A 3SQPA 3M12A 2V5ZA 2YQUA 3DJEA 1UKVG 1MO9A 2B76A 4TLXA 1GNDA 2GAGB 3L8KA 2C67A 3QSEA 5BULA 5KOWA 3KU9A 2YLXA 2YM2A 1YY5A 2FJAA 3AYJA 4CNJA 3GRSA 2BRAA 2YG6A 3FBSA 1RYIA 1JOAA 3UP4A 3OWMA 1E1KA 1Y56B 2XVEA 4H50A 1GV4A 4C3XA 1LVLA 3IWAA 2GMJA 1IUXA 3UCLA 4AT2A 1M1PA 1S3BA 4G9KA 1OJCA 3SZCA 3KLJA 4JY2A 1H84A 4G74A 5IQ1A 4NNJA 3DK8A 2DKHA 3SXQA 2WP6A 3GMCA 3KKJA 4OVIA 3F29A 5L46A 4J57A 2RGHA 1XPQA 2NVKX 4XXGA 2ZZBA 2YM1A 2CDUA 3V3OA 4C77A 3C4NA 4GRTA 4I59A 4AOSA 5KXJA 3LB8A 1MXTA 3ALJA 1KNRA 1B37A 1H86A 4TM3A 1TYPA 2YLZA 2XDOA 2XFOA 1QJDA 5FS6A 3C4AA 1ZY8A 1GREA 2WOVA 3AYIA 1VQWA 3CNTA 3G5RA 2BCGG 1ZP0A 1BVBA 1EL7A 2XLUA 1E1MA 3HZLA 3IF9A 2AAQA 2R9ZA 3O0HA 4Y4MA 1DJNA 1FS9A 1M1RA 1BF3A 2BRYA 1FECA 2YWLA 4G6HA 4J33A 4K7ZA 4A65A 5KMRA 4OPUA 3QVPA 4ADWA 2C76A 3LZWA 3NGCX 4GF7A 3BI5A 3NK0X 4II3A 4CCQA 1TDEA 3KPKA 1H6VA 2GQWA 3RHAA 1RP0A 1FT6A 2WBAA 3ZDNA 2F5ZA 1PN0A 3FMWA 3LOVA 1K4QA 1GRGA 1NHSA 1TRBA 3AECA 3GDNA 3CGEA 2Y6RA 4IVOB 3GD4A 3VR8A 2EQ7A 1PBFA 2WP5A 2GQFA 1COYA 1PJ5A 2WPCA 1GETA 3NYCA 4U8KA 1PXCA 3CGBA 2I0ZA 2RGJA 2X99A 4U8MA 3H8LA 1JRXA 1O94A 4ZCDA 2ACZA 2WDVA 1GRHA 1VRQB 1Q1WA 2Q0LA 2A87A 1JNRA 1NENA 2GR2A 2YLTA 3P4PA 4GDEA 4K8DA 4G6GA 4EIQA 1JEHA 3K7MX 4OPGA 2RF7A 1NHPA 2E81A 4KX6A 5BUKA 1GTHA 4CNKA 3CNPA 4FK1A 2WHDA 5FS9A 3G5SA 5KNLA 4EQRA 1D5TA 1E7PA 5HYMA 3BNJA 4Q5BA 1BGJA 3IC9A 2V60A 2WESA 3NYEA 2WDRA 1CJ3A 2WOWA 1H81A 3HYXA 2BCPA 3CGCA 2VR0A 1JNIA 2GR1A 2XVHA 3NHOX 4RG3A 5FMHA 4H4YA 1JU2A 3GWDA 2R4JA 3Q6JA 3F8DA 1FS7A 1IUTA 2C7GA 4U8IA 1NPXA 1QDBA 2DKIA 2H88A 5GSNA 4BV6A 4EM4A 3NK2X 5KMPA 3UU9A 3II4A 3NK1X 5KOXA 3AE9A 3DK9A 2QCUA 1KNPA 3I6DA 4DNAA 1CBOA 4X9NA 4CBQA 3QJ4A 1M64A 1TDFA 2AR8A 4K2XA 1Z6LA 4L38A 3NN6X 3ABVA 4JN9A 5J7XA 4HA6A 4YTMA 2BA9A 1YQZA 1TDNA 2C75A 3SXIA 1QO8A 4JNAA 3GM6A 1OJ9A 2EQ9A 4U2TA 3UTHA 2RABA 1LQUA 4D03A 3DGHA 1D7LA 2ZZCA 4BK1A 1ZOVA 3AE6A 3GDPA 2UZZA 1PBCA 4CCRA 2BS4A 3NN0X 3MMOA 1NHQA 1BKWA 1GT8A 3CTYA 1B5QA 1GOSA 4X4JA 4Y4LA 3RNMA 1QLBA 4L3YA 1F8WA 1VG9A 3OC4A 3T37A 3P1WA 2YLRA 3RP8A 4ECHA 2BC0A 2CFYA 4D04A 1MOKA 2OA1A 5M10A 2XLPA 2ZO5A 1JNZA 2AQJA 4APNA 4HB9A 3V3NA 3RP7A 3CPIG 2VVMA 2NPXA 3AEGA 3NLCA 3UKPA 4BK3A 5BRTA 1RSGA 2BS2A 4LU6A 2XFUA 1IJHA 2YG5A 1YQ3A 3CNDA 3ICRA 1L9DA 2C66A 3VQRA 1SEZA 2BK4A 1VDCA 3F8PA 4EQSA 4H4VA 4H4ZA 3RKHA 4YXDA 2JB2A 4K5SA 4EQWA 4Z43A 4GDPA 3DGZA 2OAMA 2GR3A 4IA5A 3VRAA 4A7AA 2YG4A 3S7WA 3BI4A 1GRAA 3OZ2A 4DGKA 2B9WA 5BVAA 1H82A 4XWZA 1V59A 3VR9A 1GXFA 3CMMA 3SYIA 1FEAA 4MJWA 1PDHA 3SZFA 1S3EA 3UOZA 3I3LA 4Q0TA 2X3NA 1Y0PA 2BC1A 5EBKA 3NH3X 2XVJA 3UKKA 2R4EA 3S61A 3DH9A 3T2ZA 2XFPA 2WU5A 1DJQA 2J3NA 2X8CA 4AP3A 4EQXA 2C70A 2GRTA 2WP9A 1ZX9A 4JQ9A 1NG3A 3ADAB 4G73A 3UTEA 3LXDA 3D8XA 4FX9A 3KA7A 5TR3A 3VRDB 3AD8B 1XANA 3REDA 1PS9A 2X8GA 4UDRA 1BZLA 1PBDA 4IV9A 2GR0A 3FPZA 3B6DA 1EL8A 5EB4A 5JCLA 3K30A 4ZN0A 1KSUA 5C2TA 3D1IA 2EQ6A 3KD9A 1CC4A 2R0PA 3AEAA 3NIXA 1KF6A 1PXAA 5EOWA 3DK4A 3IHGA 1ZOYA 1N4VA 3GYJA 3SFEA 4EMIA 2VRLA 4Z2UA 2GF3A 1PJ6A 3QSSA 4N9XA 3TTBA 3SCEA 2TMDA 4I58A 2YR5A 3DMEA 2GEWA 4FDCB 4PAAA 3LGQA 4U8PA 2YVGA 2R0GA 3AEBA 3K7QX 3ITJA 1O5WA 2YLSA 3NYFA 4EM3A 3IHMA 2TPRA 3GMBA 3UKQA 1E6EA 5M0ZA 5HXIA 1YKJA 2BXSA 2OALA 1TDKA 4B66A 3PVCA 1GEUA 4A99A 2BABA 1F6MA 3B3RA 3UOYA 1LTXR 3CNJA 1N1PA 4YTNA 2RGOA 4YSYA 3C96A 2ZZ0A 2A8XA 4Y4NA 3CIRA 3HYVA 3T2KA 4AP1A 2WU2A 4Z24A 1D4EA 3F8RA 3DJDA 3AD9B 2VZ2A 5KRQA 4Q17A 5U63A 1ONFA 4GR1A 2R46A 3AWIA 3LADA 1DOCA 1JRYA 2EQ8A 3URHA 3QFAA 1IUVA 2OT4A 2BK3A 4B64A 3ALMA 3KPFA 3EF6A 3ISHA 4B65A 1O95A 3ZYXA 1E1NA 1NAAA 1GALA 4P9SA 3SZ0A 4II2A 4H4QA 4DSGA 4BJYA 3AB1A 4XWRA 1GRTA 4K5RA 4A6NA 2XLSA 1IUWA 3G5QA 4IVMB 4Q4UA 1XDIA 1E39A 2Y6QA 1DOEA 3M13A 4YWOA 3UKHA 1GSNA 3AE2A 1DOBA 2O9ZA 2JB1A 2VVLA 4B1BA 4UDQA 4RSLA 3QFBA 3M0OA 1LPFA 1E1LA 3ATQA 1ZK7A 3CNSA 4H4WA 4UDPA 1AOGA 4U2SA 2QA1A 3L1TA 3BNHA 1B4VA 3UKAA 3D1CA 3AE8A 1GERA 3DJJA 1D7YA 2Q6UA 3AE4A 4USRA 3UTGA 2WQYA 4Z25A 3L1RA 5IPYA 1DODA 2BXRA 5ER0A 3T14A 4C3YA 2YLWA 4JY3A 4CY8A 1H7WA 3QVRA 3UKLA 1M6IA 3WE0A 4L3XA 1L9CA 2V6OA 2WPFA 4BJZA 4L3ZA 3NRNA 2QA2A 5KVIA 2XFNA 3AE3A 2WEUA 2GH5A 1CL0A 2YR6A 3PO7A 4O5QA 2C73A 4B69A 1D4CA 5JCNA 3NTAA 5IQ4A 4LIIA 1H83A 4ZCCA 4BK2A 3NG7X 5FS7A 4A6NB 2B9YA 2E1MA 3SX6A 4Z44A 2YG7A 1FCDA 1GPEA 4C5OA 4Z26A 3AEFA 5U25A 2JAEA 2YVFA 4EMJA 4NEVA 2WETA 3EANA 3BNFA 5U1OA 1FT5A 1P2EA 1OJDA 2C3DA
chains in the Genus database with same CATH topology
4H4PA 1W4XA 3V76A 5KVHA 4NZHA 4YTPA 1LJ1A 2QAEA 4DSHA 4A5LA 1FS8A 4YT0A 3NT6A 2R45A 1ZKQA 1HYUA 3ICTA 3COXA 1YQ4A 2B7RA 4Q5CA 2VVLG 2JKCA 4GUVA 4Z2TA 2ARDA 2WS3A 2JBVA 1F8RA 1FL2A 3CN8A 2C65A 4H2PA 2XVIA 4J34A 4X9MA 1FOHA 3DA1A 4YSXA 2C64A 2OLOA 1IUSA 4J36A 3RP6A 3BHFA 2H89A 2XFQA 3QSMA 2C4CA 2FBWA 5CKUA 2XCGA 1ZMCA 4U2LA 1X31B 1TDOA 3NNEA 4JNQA 4JDRA 3GWFA 1K0LA 2LFCA 2V61A 2Q0KA 4NEWA 4H4TA 4FK1C 3HYWA 4H4XA 1FEBA 3AE5A 2Z5YA 4OPLA 3ATRA 1JRZA 4LA1A 4B68A 2E80A 4GCMA 3AYLA 4A79A 1OAHA 1BWCA 1IUUA 2GVCA 2BK5A 1L0VA 1EL9A 1NDAA 4REKA 1DXLA 4AOXA 2XYOA 5J60A 4J56A 3UOXA 1DNCA 1N4WA 1REOA 2JB3A 2Q7VA 3AEDA 4NTEA 4Z2RA 3BI2A 4TM0A 2Z5XA 3SY4A 4E0VA 1PBBA 1ELIA 3BNUA 2XLRA 3JSKA 4J2WA 1PJ7A 4WX1A 4YKGA 3H4KA 1TYTA 3CPJG 3SGLA 4M52A 3FG2P 1CJCA 5JCKA 3GYXA 4YSHA 3UTFA 3AXBA 1EBDA 2FJBA 4Q1OA 4IA6A 1D4DA 1L9EA 5JCIA 2A89A 4YSZA 3P4RA 5DBJA 3ALLA 1GRFA 3R9UA 4H7UA 3T31A 3UBRA 3E1TA 4H2RA 1GU6A 1Q1RA 1OJAA 4H2NA 4OPIA 5FS8A 3UP5A 2YVJA 5HY5A 3DJGX 5KWFA 2RDZA 1ZMDA 2C3CA 3GD3A 5C3JA 1CJ4A 2BS3A 3ICSA 1EL5A 4NTDA 2CULA 1LQTA 2BYBA 2K3VA 2J7AA 3AE7A 3LZXA 4OPTA 4TLZA 3GYIA 1KDGA 1NHRA 4GAPA 2R0CA 4B67A 3P4QA 3S5WA 3UKFA 5JCMA 1CJ2A 2WDQA 2XLTA 4NTCA 2W0HA 2C72A 4H4SA 1SP3A 3AD7B 1P2HA 2APGA 4BURA 2WOIA 1CF3A 2B9XA 3FO3A 1N4UA 4NWZA 3H8IA 4U8JA 2PYXA 4USQA 2FJEA 4OCGA 2VRMA 3NKSA 2IVDA 3UOVA 1LV0A 1F8SA 2VQ7A 1Q9IA 3BNGA 5EB5A 4WJYA 2JK6A 2VOUA 5CQFA 2IIDA 2YAUA 4U8NA 1GTEA 1K0IA 4CY6A 2GV8A 1KFYA 2GB0A 1H7XA 3GSIA 4EIPA 2V3AA 4ICYA 2WPEA 3PS9A 2GAHB 2FJDA 2V3BA 2CVJA 4TM4A 1CC6A 4PABA 3LG1A 1PHHA 1VG0A 3NTDA 1NG4A 1S2QA 2X8HA 4O5UA 3SZWA 3LJPA 3BHKA 1F3PA 5KMQA 2ZBWA 2YG3A 3EAOA 3AEEA 3TORA 2E4GA 4YKFA 4K22A 3VRBA 3CGDA 3BNMA 1KSSA 1XHCA 3GRTA 1BGNA 1GESA 2BACA 1CHUA 2HQMA 3K7TA 4H4RA 4TM1A 3T2YA 4EMWA 1ZDLA 4UP3A 1PBEA 1M1QA 4WCTA 3EPTA 1NEKA 4AT0A 4B63A 4C74A 5LV9A 2IVEA 3KVEA 4U8OA 1Y56A 5HHFA 4OPDA 4OPCA 3Q9TA 1B8SA 2B7SA 3P9UA 3FIMB 1GRBA 4H4UA 3SFDA 3T0KA 2E5VA 1CC2A 1K0JA 4A9WA 3CPHG 1PXBA 2XVFA 5KMSA 4U8LA 4H2QA 4RG4A 2PHHA 4CRTA 2VQBA 2GMHA 2YR4A 5GRTA 4KPRA 3P4SA 2X50A 1OJTA 2OLNA 4GAVA 1S2YA 3AE1A 3SM8A 4J31A 3SQPA 3M12A 2V5ZA 2YQUA 3DJEA 1UKVG 1MO9A 2B76A 4TLXA 1GNDA 2GAGB 3L8KA 2C67A 3QSEA 5BULA 5KOWA 3KU9A 2YLXA 2YM2A 1YY5A 2FJAA 3AYJA 4CNJA 3GRSA 2BRAA 2YG6A 3FBSA 1RYIA 1JOAA 3UP4A 3OWMA 1E1KA 1Y56B 2XVEA 4H50A 1GV4A 4C3XA 1LVLA 3IWAA 2GMJA 1IUXA 3UCLA 4AT2A 1M1PA 1S3BA 4G9KA 1OJCA 3SZCA 3KLJA 4JY2A 1H84A 4G74A 5IQ1A 4NNJA 3DK8A 2DKHA 3SXQA 2WP6A 3GMCA 3KKJA 4OVIA 3F29A 5L46A 4J57A 2RGHA 1XPQA 2NVKX 4XXGA 2ZZBA 2YM1A 2CDUA 3V3OA 4C77A 3C4NA 4GRTA 4I59A 4AOSA 5KXJA 3LB8A 1MXTA 3ALJA 1KNRA 1B37A 1H86A 4TM3A 1TYPA 2YLZA 2XDOA 2XFOA 1QJDA 5FS6A 3C4AA 1ZY8A 1GREA 2WOVA 3AYIA 1VQWA 3CNTA 3G5RA 2BCGG 1ZP0A 1BVBA 1EL7A 2XLUA 1E1MA 3HZLA 3IF9A 2AAQA 2R9ZA 3O0HA 4Y4MA 1DJNA 1FS9A 1M1RA 1BF3A 2BRYA 1FECA 2YWLA 4G6HA 4J33A 4K7ZA 4A65A 5KMRA 4OPUA 3QVPA 4ADWA 2C76A 3LZWA 3NGCX 4GF7A 3BI5A 3NK0X 4II3A 4CCQA 1TDEA 3KPKA 1H6VA 2GQWA 3RHAA 1RP0A 1FT6A 2WBAA 3ZDNA 2F5ZA 1PN0A 3FMWA 3LOVA 1K4QA 1GRGA 1NHSA 1TRBA 3AECA 3GDNA 3CGEA 2Y6RA 4IVOB 3GD4A 3VR8A 2EQ7A 1PBFA 2WP5A 2GQFA 1COYA 1PJ5A 2WPCA 1GETA 3NYCA 4U8KA 1PXCA 3CGBA 2I0ZA 2RGJA 2X99A 4U8MA 3H8LA 1JRXA 1O94A 4ZCDA 2ACZA 2WDVA 1GRHA 1VRQB 1Q1WA 2Q0LA 2A87A 1JNRA 1NENA 2GR2A 2YLTA 3P4PA 4GDEA 4K8DA 4G6GA 4EIQA 1JEHA 3K7MX 4OPGA 2RF7A 1NHPA 2E81A 4KX6A 5BUKA 1GTHA 4CNKA 3CNPA 4FK1A 2WHDA 5FS9A 3G5SA 5KNLA 4EQRA 1D5TA 1E7PA 5HYMA 3BNJA 4Q5BA 1BGJA 3IC9A 2V60A 2WESA 3NYEA 2WDRA 1CJ3A 2WOWA 1H81A 3HYXA 2BCPA 3CGCA 2VR0A 1JNIA 2GR1A 2XVHA 3NHOX 4RG3A 5FMHA 4H4YA 1JU2A 3GWDA 2R4JA 3Q6JA 3F8DA 1FS7A 1IUTA 2C7GA 4U8IA 1NPXA 1QDBA 2DKIA 2H88A 5GSNA 4BV6A 4EM4A 3NK2X 5KMPA 3UU9A 3II4A 3NK1X 5KOXA 3AE9A 3DK9A 2QCUA 1KNPA 3I6DA 4DNAA 1CBOA 4X9NA 4CBQA 3QJ4A 1M64A 1TDFA 2AR8A 4K2XA 1Z6LA 4L38A 3NN6X 3ABVA 4JN9A 5J7XA 4HA6A 4YTMA 2BA9A 1YQZA 1TDNA 2C75A 3SXIA 1QO8A 4JNAA 3GM6A 1OJ9A 2EQ9A 4U2TA 3UTHA 2RABA 1LQUA 4D03A 3DGHA 1D7LA 2ZZCA 4BK1A 1ZOVA 3AE6A 3GDPA 2UZZA 1PBCA 4CCRA 2BS4A 3NN0X 3MMOA 1NHQA 1BKWA 1GT8A 3CTYA 1B5QA 1GOSA 4X4JA 4Y4LA 3RNMA 1QLBA 4L3YA 1F8WA 1VG9A 3OC4A 3T37A 3P1WA 2YLRA 3RP8A 4ECHA 2BC0A 2CFYA 4D04A 1MOKA 2OA1A 5M10A 2XLPA 2ZO5A 1JNZA 2AQJA 4APNA 4HB9A 3V3NA 3RP7A 3CPIG 2VVMA 2NPXA 3AEGA 3NLCA 3UKPA 4BK3A 5BRTA 1RSGA 2BS2A 4LU6A 2XFUA 1IJHA 2YG5A 1YQ3A 3CNDA 3ICRA 1L9DA 2C66A 3VQRA 1SEZA 2BK4A 1VDCA 3F8PA 4EQSA 4H4VA 4H4ZA 3RKHA 4YXDA 2JB2A 4K5SA 4EQWA 4Z43A 4GDPA 3DGZA 2OAMA 2GR3A 4IA5A 3VRAA 4A7AA 2YG4A 3S7WA 3BI4A 1GRAA 3OZ2A 4DGKA 2B9WA 5BVAA 1H82A 4XWZA 1V59A 3VR9A 1GXFA 3CMMA 3SYIA 1FEAA 4MJWA 1PDHA 3SZFA 1S3EA 3UOZA 3I3LA 4Q0TA 2X3NA 1Y0PA 2BC1A 5EBKA 3NH3X 2XVJA 3UKKA 2R4EA 3S61A 3DH9A 3T2ZA 2XFPA 2WU5A 1DJQA 2J3NA 2X8CA 4AP3A 4EQXA 2C70A 2GRTA 2WP9A 1ZX9A 4JQ9A 1NG3A 3ADAB 4G73A 3UTEA 3LXDA 3D8XA 4FX9A 3KA7A 5TR3A 3VRDB 3AD8B 1XANA 3REDA 1PS9A 2X8GA 4UDRA 1BZLA 1PBDA 4IV9A 2GR0A 3FPZA 3B6DA 1EL8A 5EB4A 5JCLA 3K30A 4ZN0A 1KSUA 5C2TA 3D1IA 2EQ6A 3KD9A 1CC4A 2R0PA 3AEAA 3NIXA 1KF6A 1PXAA 5EOWA 3DK4A 3IHGA 1ZOYA 1N4VA 3GYJA 3SFEA 4EMIA 2VRLA 4Z2UA 2GF3A 1PJ6A 3QSSA 4N9XA 3TTBA 3SCEA 2TMDA 4I58A 2YR5A 3DMEA 2GEWA 4FDCB 4PAAA 3LGQA 4U8PA 2YVGA 2R0GA 3AEBA 3K7QX 3ITJA 1O5WA 2YLSA 3NYFA 4EM3A 3IHMA 2TPRA 3GMBA 3UKQA 1E6EA 5M0ZA 5HXIA 1YKJA 2BXSA 2OALA 1TDKA 4B66A 3PVCA 1GEUA 4A99A 2BABA 1F6MA 3B3RA 3UOYA 1LTXR 3CNJA 1N1PA 4YTNA 2RGOA 4YSYA 3C96A 2ZZ0A 2A8XA 4Y4NA 3CIRA 3HYVA 3T2KA 4AP1A 2WU2A 4Z24A 1D4EA 3F8RA 3DJDA 3AD9B 2VZ2A 5KRQA 4Q17A 5U63A 1ONFA 4GR1A 2R46A 3AWIA 3LADA 1DOCA 1JRYA 2EQ8A 3URHA 3QFAA 1IUVA 2OT4A 2BK3A 4B64A 3ALMA 3KPFA 3EF6A 3ISHA 4B65A 1O95A 3ZYXA 1E1NA 1NAAA 1GALA 4P9SA 3SZ0A 4II2A 4H4QA 4DSGA 4BJYA 3AB1A 4XWRA 1GRTA 4K5RA 4A6NA 2XLSA 1IUWA 3G5QA 4IVMB 4Q4UA 1XDIA 1E39A 2Y6QA 1DOEA 3M13A 4YWOA 3UKHA 1GSNA 3AE2A 1DOBA 2O9ZA 2JB1A 2VVLA 4B1BA 4UDQA 4RSLA 3QFBA 3M0OA 1LPFA 1E1LA 3ATQA 1ZK7A 3CNSA 4H4WA 4UDPA 1AOGA 4U2SA 2QA1A 3L1TA 3BNHA 1B4VA 3UKAA 3D1CA 3AE8A 1GERA 3DJJA 1D7YA 2Q6UA 3AE4A 4USRA 3UTGA 2WQYA 4Z25A 3L1RA 5IPYA 1DODA 2BXRA 5ER0A 3T14A 4C3YA 2YLWA 4JY3A 4CY8A 1H7WA 3QVRA 3UKLA 1M6IA 3WE0A 4L3XA 1L9CA 2V6OA 2WPFA 4BJZA 4L3ZA 3NRNA 2QA2A 5KVIA 2XFNA 3AE3A 2WEUA 2GH5A 1CL0A 2YR6A 3PO7A 4O5QA 2C73A 4B69A 1D4CA 5JCNA 3NTAA 5IQ4A 4LIIA 1H83A 4ZCCA 4BK2A 3NG7X 5FS7A 4A6NB 2B9YA 2E1MA 3SX6A 4Z44A 2YG7A 1FCDA 1GPEA 4C5OA 4Z26A 3AEFA 5U25A 2JAEA 2YVFA 4EMJA 4NEVA 2WETA 3EANA 3BNFA 5U1OA 1FT5A 1P2EA 1OJDA 2C3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H4P A;  1W4X A;  3V76 A;  5KVH A;  4NZH A;  4YTP A;  1LJ1 A;  2QAE A;  4DSH A;  4A5L A;  1FS8 A;  4YT0 A;  3NT6 A;  2R45 A;  1ZKQ A;  1HYU A;  3ICT A;  3COX A;  1YQ4 A;  2B7R A;  4Q5C A;  2VVL G;  2JKC A;  4GUV A;  4Z2T A;  2ARD A;  2WS3 A;  2JBV A;  1F8R A;  1FL2 A;  3CN8 A;  2C65 A;  4H2P A;  2XVI A;  4J34 A;  4X9M A;  1FOH A;  3DA1 A;  4YSX A;  2C64 A;  2OLO A;  1IUS A;  4J36 A;  3RP6 A;  3BHF A;  2H89 A;  2XFQ A;  3QSM A;  5CKU A;  2FBW A;  2XCG A;  1ZMC A;  4U2L A;  1X31 B;  1TDO A;  3NNE A;  4JNQ A;  4JDR A;  3GWF A;  1K0L A;  2LFC A;  2V61 A;  2Q0K A;  4NEW A;  4H4T A;  4FK1 C;  4H4X A;  1FEB A;  3AE5 A;  2Z5Y A;  4OPL A;  3ATR A;  1JRZ A;  4LA1 A;  4B68 A;  2E80 A;  4GCM A;  3AYL A;  4A79 A;  1OAH A;  1BWC A;  1IUU A;  2GVC A;  2BK5 A;  1L0V A;  1EL9 A;  1NDA A;  4REK A;  1DXL A;  4AOX A;  2XYO A;  5J60 A;  4J56 A;  3UOX A;  1DNC A;  1N4W A;  1REO A;  2JB3 A;  2Q7V A;  3AED A;  4NTE A;  4Z2R A;  3BI2 A;  4TM0 A;  2Z5X A;  4E0V A;  1PBB A;  1ELI A;  3BNU A;  2XLR A;  3JSK A;  4J2W A;  1PJ7 A;  4WX1 A;  4YKG A;  3H4K A;  1TYT A;  3CPJ G;  3SGL A;  4M52 A;  3FG2 P;  1CJC A;  5JCK A;  4YSH A;  3GYX A;  3UTF A;  3AXB A;  1EBD A;  2FJB A;  4Q1O A;  4IA6 A;  1D4D A;  1L9E A;  5JCI A;  2A89 A;  4YSZ A;  3P4R A;  5DBJ A;  3ALL A;  1GRF A;  3R9U A;  4H7U A;  3UBR A;  3E1T A;  4H2R A;  1GU6 A;  1Q1R A;  1OJA A;  4H2N A;  4OPI A;  5FS8 A;  3UP5 A;  2YVJ A;  5HY5 A;  3DJG X;  5KWF A;  2RDZ A;  1ZMD A;  2C3C A;  3GD3 A;  5C3J A;  1CJ4 A;  2BS3 A;  3ICS A;  1EL5 A;  4NTD A;  2CUL A;  1LQT A;  2BYB A;  2K3V A;  2J7A A;  3AE7 A;  3LZX A;  4OPT A;  4TLZ A;  3GYI A;  1KDG A;  1NHR A;  4B67 A;  2R0C A;  3P4Q A;  3S5W A;  3UKF A;  5JCM A;  1CJ2 A;  2WDQ A;  2XLT A;  4NTC A;  2W0H A;  2C72 A;  4H4S A;  1SP3 A;  3AD7 B;  1P2H A;  2APG A;  4BUR A;  2WOI A;  1CF3 A;  2B9X A;  3FO3 A;  1N4U A;  3H8I A;  4U8J A;  2PYX A;  4USQ A;  2FJE A;  4OCG A;  2VRM A;  3NKS A;  2IVD A;  3UOV A;  1LV0 A;  1F8S A;  2VQ7 A;  1Q9I A;  3BNG A;  5EB5 A;  4WJY A;  2JK6 A;  2VOU A;  5CQF A;  2IID A;  2YAU A;  4U8N A;  1GTE A;  1K0I A;  4CY6 A;  2GV8 A;  1KFY A;  2GB0 A;  1H7X A;  3GSI A;  4EIP A;  2V3A A;  4ICY A;  2WPE A;  3PS9 A;  2GAH B;  2FJD A;  2V3B A;  2CVJ A;  4TM4 A;  1CC6 A;  4PAB A;  3LG1 A;  1PHH A;  1VG0 A;  4O5U A;  1NG4 A;  1S2Q A;  2X8H A;  3LJP A;  3BHK A;  1F3P A;  2ZBW A;  2YG3 A;  3EAO A;  3AEE A;  3TOR A;  2E4G A;  4YKF A;  4K22 A;  3VRB A;  3CGD A;  3BNM A;  1KSS A;  1XHC A;  3GRT A;  1BGN A;  1GES A;  2BAC A;  1CHU A;  2HQM A;  3K7T A;  4H4R A;  4TM1 A;  4EMW A;  1ZDL A;  4UP3 A;  1PBE A;  1M1Q A;  4WCT A;  3EPT A;  1NEK A;  4AT0 A;  4B63 A;  4C74 A;  5LV9 A;  2IVE A;  3KVE A;  4U8O A;  1Y56 A;  5HHF A;  4OPD A;  4OPC A;  3Q9T A;  1B8S A;  2B7S A;  3P9U A;  3FIM B;  1GRB A;  4H4U A;  3SFD A;  2E5V A;  1CC2 A;  1K0J A;  4A9W A;  3CPH G;  1PXB A;  2XVF A;  4U8L A;  4H2Q A;  4RG4 A;  2PHH A;  4CRT A;  2VQB A;  2GMH A;  2YR4 A;  5GRT A;  4KPR A;  3P4S A;  2X50 A;  1OJT A;  2OLN A;  3SM8 A;  1S2Y A;  3AE1 A;  3SQP A;  4J31 A;  3M12 A;  2V5Z A;  2YQU A;  3DJE A;  1UKV G;  1MO9 A;  2B76 A;  4TLX A;  1GND A;  2GAG B;  3L8K A;  2C67 A;  3QSE A;  5BUL A;  5KOW A;  3KU9 A;  2YLX A;  2YM2 A;  1YY5 A;  2FJA A;  3AYJ A;  4CNJ A;  3GRS A;  2YG6 A;  3FBS A;  1RYI A;  1JOA A;  3UP4 A;  3OWM A;  1E1K A;  1Y56 B;  2XVE A;  4H50 A;  1GV4 A;  4C3X A;  1LVL A;  3IWA A;  2GMJ A;  1IUX A;  3UCL A;  4AT2 A;  1M1P A;  1S3B A;  1OJC A;  3KLJ A;  4JY2 A;  1H84 A;  5IQ1 A;  3DK8 A;  2DKH A;  3SXQ A;  2WP6 A;  3GMC A;  3KKJ A;  4OVI A;  3F29 A;  5L46 A;  4J57 A;  2RGH A;  1XPQ A;  2NVK X;  4XXG A;  2ZZB A;  2YM1 A;  2CDU A;  3V3O A;  4C77 A;  3C4N A;  4GRT A;  4I59 A;  4AOS A;  5KXJ A;  3LB8 A;  1MXT A;  3ALJ A;  1KNR A;  1B37 A;  1H86 A;  4TM3 A;  1TYP A;  2YLZ A;  2XDO A;  2XFO A;  1QJD A;  5FS6 A;  3C4A A;  1ZY8 A;  1GRE A;  2WOV A;  3AYI A;  1VQW A;  3CNT A;  3G5R A;  2BCG G;  1ZP0 A;  1BVB A;  1EL7 A;  2XLU A;  1E1M A;  3HZL A;  3IF9 A;  2AAQ A;  2R9Z A;  3O0H A;  4Y4M A;  1DJN A;  1FS9 A;  1M1R A;  1BF3 A;  2YWL A;  1FEC A;  4J33 A;  4K7Z A;  4A65 A;  4OPU A;  3QVP A;  4ADW A;  2C76 A;  3LZW A;  3NGC X;  4GF7 A;  3BI5 A;  3NK0 X;  4CCQ A;  1TDE A;  1H6V A;  2GQW A;  3RHA A;  1RP0 A;  1FT6 A;  2WBA A;  3ZDN A;  2F5Z A;  1PN0 A;  3FMW A;  3LOV A;  1K4Q A;  1GRG A;  1NHS A;  1TRB A;  3AEC A;  3GDN A;  3CGE A;  2Y6R A;  4IVO B;  3GD4 A;  3VR8 A;  2EQ7 A;  1PBF A;  2WP5 A;  2GQF A;  1COY A;  1PJ5 A;  2WPC A;  1GET A;  3NYC A;  4U8K A;  1PXC A;  3CGB A;  2I0Z A;  2RGJ A;  2X99 A;  4U8M A;  3H8L A;  1JRX A;  1O94 A;  4ZCD A;  2ACZ A;  2WDV A;  1GRH A;  1VRQ B;  1Q1W A;  2Q0L A;  2A87 A;  1JNR A;  1NEN A;  2GR2 A;  2YLT A;  3P4P A;  4GDE A;  4K8D A;  4EIQ A;  1JEH A;  3K7M X;  4OPG A;  2RF7 A;  1NHP A;  2E81 A;  4KX6 A;  5BUK A;  1GTH A;  4CNK A;  3CNP A;  4FK1 A;  2WHD A;  5FS9 A;  3G5S A;  4EQR A;  1D5T A;  1E7P A;  5HYM A;  3BNJ A;  4Q5B A;  1BGJ A;  3IC9 A;  2V60 A;  2WES A;  3NYE A;  2WDR A;  1CJ3 A;  2WOW A;  1H81 A;  3NTD A;  2BCP A;  3CGC A;  2VR0 A;  1JNI A;  2GR1 A;  2XVH A;  3NHO X;  4RG3 A;  5FMH A;  4H4Y A;  1JU2 A;  3GWD A;  2R4J A;  3Q6J A;  3F8D A;  1FS7 A;  1IUT A;  2C7G A;  4U8I A;  1NPX A;  1QDB A;  2DKI A;  2H88 A;  5GSN A;  4BV6 A;  4EM4 A;  3NK2 X;  3UU9 A;  3II4 A;  3NK1 X;  5KOX A;  3AE9 A;  3DK9 A;  2QCU A;  1KNP A;  3I6D A;  4DNA A;  1CBO A;  4X9N A;  4CBQ A;  3QJ4 A;  1M64 A;  1TDF A;  2AR8 A;  4K2X A;  1Z6L A;  4L38 A;  3NN6 X;  3ABV A;  4JN9 A;  5J7X A;  4HA6 A;  4YTM A;  2BA9 A;  1YQZ A;  1TDN A;  2C75 A;  1QO8 A;  4JNA A;  3GM6 A;  1OJ9 A;  2EQ9 A;  4U2T A;  3UTH A;  2RAB A;  1LQU A;  4D03 A;  3DGH A;  1D7L A;  2ZZC A;  4BK1 A;  1ZOV A;  3AE6 A;  3GDP A;  2UZZ A;  1PBC A;  4CCR A;  2BS4 A;  3NN0 X;  3MMO A;  1NHQ A;  1BKW A;  1GT8 A;  3CTY A;  1B5Q A;  1GOS A;  4X4J A;  4Y4L A;  3RNM A;  1QLB A;  4L3Y A;  1F8W A;  1VG9 A;  3OC4 A;  3T37 A;  3P1W A;  2YLR A;  3RP8 A;  4ECH A;  2BC0 A;  2CFY A;  4D04 A;  1MOK A;  2OA1 A;  5M10 A;  2XLP A;  2ZO5 A;  1JNZ A;  2AQJ A;  4APN A;  4HB9 A;  3V3N A;  3RP7 A;  3CPI G;  2VVM A;  2NPX A;  3AEG A;  3NLC A;  3UKP A;  4BK3 A;  5BRT A;  1RSG A;  2BS2 A;  4LU6 A;  2XFU A;  1IJH A;  2YG5 A;  1YQ3 A;  3CND A;  3ICR A;  1L9D A;  2C66 A;  3VQR A;  1SEZ A;  2BK4 A;  1VDC A;  3F8P A;  4EQS A;  4H4V A;  4H4Z A;  3RKH A;  4YXD A;  2JB2 A;  4K5S A;  4EQW A;  4Z43 A;  4GDP A;  3DGZ A;  2OAM A;  2GR3 A;  4IA5 A;  3VRA A;  4A7A A;  2YG4 A;  3S7W A;  3BI4 A;  1GRA A;  3OZ2 A;  4DGK A;  2B9W A;  5BVA A;  1H82 A;  4XWZ A;  1V59 A;  3VR9 A;  1GXF A;  1FEA A;  4MJW A;  1PDH A;  1S3E A;  3UOZ A;  3I3L A;  4Q0T A;  2X3N A;  1Y0P A;  2BC1 A;  5EBK A;  3NH3 X;  2XVJ A;  3UKK A;  2R4E A;  3S61 A;  3DH9 A;  2XFP A;  2WU5 A;  1DJQ A;  2J3N A;  2X8C A;  4AP3 A;  4EQX A;  2C70 A;  2GRT A;  2WP9 A;  1ZX9 A;  4JQ9 A;  1NG3 A;  3ADA B;  3UTE A;  3LXD A;  3D8X A;  4FX9 A;  3KA7 A;  5TR3 A;  3VRD B;  3AD8 B;  1XAN A;  3RED A;  1PS9 A;  2X8G A;  4UDR A;  1BZL A;  1PBD A;  4IV9 A;  2GR0 A;  3FPZ A;  3B6D A;  1EL8 A;  5EB4 A;  5JCL A;  3K30 A;  4ZN0 A;  1KSU A;  5C2T A;  3D1I A;  2EQ6 A;  3KD9 A;  1CC4 A;  2R0P A;  3AEA A;  3NIX A;  1KF6 A;  1PXA A;  5EOW A;  3DK4 A;  3IHG A;  1ZOY A;  1N4V A;  3GYJ A;  3SFE A;  4EMI A;  2VRL A;  4Z2U A;  2GF3 A;  1PJ6 A;  3QSS A;  4N9X A;  3TTB A;  3SCE A;  2TMD A;  4I58 A;  2YR5 A;  3DME A;  2GEW A;  4FDC B;  4PAA A;  3LGQ A;  4U8P A;  2YVG A;  2R0G A;  3AEB A;  3K7Q X;  3ITJ A;  1O5W A;  2YLS A;  3NYF A;  4EM3 A;  3IHM A;  2TPR A;  3GMB A;  3UKQ A;  1E6E A;  5M0Z A;  5HXI A;  1YKJ A;  2BXS A;  2OAL A;  1TDK A;  4B66 A;  3PVC A;  1GEU A;  4A99 A;  2BAB A;  1F6M A;  3B3R A;  3UOY A;  1LTX R;  3CNJ A;  1N1P A;  4YTN A;  2RGO A;  4YSY A;  3C96 A;  2ZZ0 A;  2A8X A;  4Y4N A;  3CIR A;  4AP1 A;  2WU2 A;  4Z24 A;  1D4E A;  3F8R A;  3DJD A;  3AD9 B;  2VZ2 A;  5KRQ A;  4Q17 A;  5U63 A;  1ONF A;  4GR1 A;  2R46 A;  3AWI A;  3LAD A;  1DOC A;  1JRY A;  2EQ8 A;  3URH A;  3QFA A;  1IUV A;  2OT4 A;  2BK3 A;  4B64 A;  3ALM A;  3KPF A;  3EF6 A;  3ISH A;  4B65 A;  1O95 A;  3ZYX A;  1E1N A;  1NAA A;  1GAL A;  4P9S A;  4H4Q A;  4DSG A;  4BJY A;  3AB1 A;  4XWR A;  1GRT A;  4K5R A;  4A6N A;  2XLS A;  1IUW A;  3G5Q A;  4IVM B;  4Q4U A;  1XDI A;  1E39 A;  2Y6Q A;  1DOE A;  3M13 A;  4YWO A;  3UKH A;  1GSN A;  3AE2 A;  1DOB A;  2O9Z A;  2JB1 A;  2VVL A;  4B1B A;  4UDQ A;  4RSL A;  3QFB A;  3M0O A;  1LPF A;  1E1L A;  3ATQ A;  1ZK7 A;  3CNS A;  4H4W A;  4UDP A;  1AOG A;  4U2S A;  2QA1 A;  3L1T A;  3BNH A;  1B4V A;  3UKA A;  3D1C A;  3AE8 A;  1GER A;  3DJJ A;  1D7Y A;  2Q6U A;  3AE4 A;  4USR A;  3UTG A;  2WQY A;  4Z25 A;  3L1R A;  5IPY A;  1DOD A;  2BXR A;  5ER0 A;  4C3Y A;  2YLW A;  4JY3 A;  4CY8 A;  1H7W A;  3QVR A;  3UKL A;  1M6I A;  3WE0 A;  4L3X A;  1L9C A;  2V6O A;  2WPF A;  4BJZ A;  4L3Z A;  3NRN A;  2QA2 A;  5KVI A;  2XFN A;  3AE3 A;  2WEU A;  2GH5 A;  1CL0 A;  2YR6 A;  3PO7 A;  4O5Q A;  2C73 A;  4B69 A;  1D4C A;  5JCN A;  3NTA A;  5IQ4 A;  4LII A;  1H83 A;  4ZCC A;  4BK2 A;  3NG7 X;  5FS7 A;  4A6N B;  2B9Y A;  2E1M A;  4Z44 A;  2YG7 A;  1FCD A;  1GPE A;  4C5O A;  4Z26 A;  3AEF A;  5U25 A;  2JAE A;  2YVF A;  4EMJ A;  4NEV A;  2WET A;  3EAN A;  3BNF A;  5U1O A;  1FT5 A;  1P2E A;  1OJD A;  2C3D A; 
#chains in the Genus database with same CATH topology
 4H4P A;  1W4X A;  3V76 A;  5KVH A;  4NZH A;  4YTP A;  1LJ1 A;  2QAE A;  4DSH A;  4A5L A;  1FS8 A;  4YT0 A;  3NT6 A;  2R45 A;  1ZKQ A;  1HYU A;  3ICT A;  3COX A;  1YQ4 A;  2B7R A;  4Q5C A;  2VVL G;  2JKC A;  4GUV A;  4Z2T A;  2ARD A;  2WS3 A;  2JBV A;  1F8R A;  1FL2 A;  3CN8 A;  2C65 A;  4H2P A;  2XVI A;  4J34 A;  4X9M A;  1FOH A;  3DA1 A;  4YSX A;  2C64 A;  2OLO A;  1IUS A;  4J36 A;  3RP6 A;  3BHF A;  2H89 A;  2XFQ A;  3QSM A;  2C4C A;  2FBW A;  5CKU A;  2XCG A;  1ZMC A;  4U2L A;  1X31 B;  1TDO A;  3NNE A;  4JNQ A;  4JDR A;  3GWF A;  1K0L A;  2LFC A;  2V61 A;  2Q0K A;  4NEW A;  4H4T A;  4FK1 C;  3HYW A;  4H4X A;  1FEB A;  3AE5 A;  2Z5Y A;  4OPL A;  3ATR A;  1JRZ A;  4LA1 A;  4B68 A;  2E80 A;  4GCM A;  3AYL A;  4A79 A;  1OAH A;  1BWC A;  1IUU A;  2GVC A;  2BK5 A;  1L0V A;  1EL9 A;  1NDA A;  4REK A;  1DXL A;  4AOX A;  2XYO A;  5J60 A;  4J56 A;  3UOX A;  1DNC A;  1N4W A;  1REO A;  2JB3 A;  2Q7V A;  3AED A;  4NTE A;  4Z2R A;  3BI2 A;  4TM0 A;  2Z5X A;  3SY4 A;  4E0V A;  1PBB A;  1ELI A;  3BNU A;  2XLR A;  3JSK A;  4J2W A;  1PJ7 A;  4WX1 A;  4YKG A;  3H4K A;  2CZS A;  1TYT A;  3CPJ G;  3SGL A;  4M52 A;  3FG2 P;  1CJC A;  5JCK A;  3GYX A;  4YSH A;  3UTF A;  3AXB A;  1EBD A;  2FJB A;  4Q1O A;  4IA6 A;  1D4D A;  1L9E A;  5JCI A;  2A89 A;  4YSZ A;  3P4R A;  5DBJ A;  3ALL A;  1GRF A;  3R9U A;  4H7U A;  3T31 A;  3UBR A;  3E1T A;  4H2R A;  1GU6 A;  1Q1R A;  1OJA A;  4H2N A;  4OPI A;  5FS8 A;  3UP5 A;  2YVJ A;  5HY5 A;  3DJG X;  5KWF A;  2RDZ A;  1ZMD A;  2C3C A;  3GD3 A;  5C3J A;  1CJ4 A;  2BS3 A;  3ICS A;  1EL5 A;  4NTD A;  2CUL A;  1LQT A;  2BYB A;  2K3V A;  2J7A A;  3AE7 A;  3LZX A;  4OPT A;  4TLZ A;  3GYI A;  1KDG A;  1NHR A;  4GAP A;  2R0C A;  4B67 A;  3P4Q A;  3S5W A;  3UKF A;  5JCM A;  1CJ2 A;  2WDQ A;  2XLT A;  4NTC A;  2W0H A;  2C72 A;  4H4S A;  1SP3 A;  3AD7 B;  1P2H A;  2APG A;  4BUR A;  2WOI A;  1CF3 A;  2B9X A;  3FO3 A;  1N4U A;  4NWZ A;  3H8I A;  4U8J A;  2PYX A;  4USQ A;  2FJE A;  4OCG A;  2VRM A;  3NKS A;  2IVD A;  3UOV A;  1LV0 A;  1F8S A;  2VQ7 A;  1Q9I A;  3BNG A;  5EB5 A;  4WJY A;  2JK6 A;  2VOU A;  5CQF A;  2IID A;  2YAU A;  4U8N A;  1GTE A;  1K0I A;  4CY6 A;  2GV8 A;  1KFY A;  2GB0 A;  1H7X A;  3GSI A;  4EIP A;  2V3A A;  4ICY A;  2WPE A;  3PS9 A;  2GAH B;  2FJD A;  2V3B A;  2CVJ A;  4TM4 A;  1CC6 A;  4PAB A;  3LG1 A;  1PHH A;  1VG0 A;  3NTD A;  1NG4 A;  1S2Q A;  2X8H A;  4O5U A;  3SZW A;  3LJP A;  3BHK A;  1F3P A;  5KMQ A;  2ZBW A;  2YG3 A;  3EAO A;  3AEE A;  3TOR A;  2E4G A;  4YKF A;  4K22 A;  3VRB A;  3CGD A;  3BNM A;  1KSS A;  1XHC A;  3GRT A;  1BGN A;  1GES A;  2BAC A;  1CHU A;  2HQM A;  3K7T A;  4H4R A;  4TM1 A;  3T2Y A;  4EMW A;  1ZDL A;  4UP3 A;  1PBE A;  1M1Q A;  4WCT A;  3EPT A;  1NEK A;  4AT0 A;  4B63 A;  4C74 A;  5LV9 A;  2IVE A;  3KVE A;  4U8O A;  1Y56 A;  5HHF A;  4OPD A;  4OPC A;  3Q9T A;  1B8S A;  2B7S A;  3P9U A;  3FIM B;  1GRB A;  4H4U A;  3SFD A;  3T0K A;  2E5V A;  1CC2 A;  1K0J A;  4A9W A;  3CPH G;  1PXB A;  2XVF A;  5KMS A;  4U8L A;  4H2Q A;  4RG4 A;  2PHH A;  4CRT A;  2VQB A;  2GMH A;  2YR4 A;  5GRT A;  4KPR A;  3P4S A;  2X50 A;  1OJT A;  2OLN A;  4GAV A;  1S2Y A;  3AE1 A;  3SM8 A;  4J31 A;  3SQP A;  3M12 A;  2V5Z A;  2YQU A;  3DJE A;  1UKV G;  1MO9 A;  2B76 A;  4TLX A;  1GND A;  2GAG B;  3L8K A;  2C67 A;  3QSE A;  5BUL A;  5KOW A;  3KU9 A;  2YLX A;  2YM2 A;  1YY5 A;  2FJA A;  3AYJ A;  4CNJ A;  3GRS A;  2BRA A;  2YG6 A;  3FBS A;  1RYI A;  1JOA A;  3UP4 A;  3OWM A;  1E1K A;  1Y56 B;  2XVE A;  4H50 A;  1GV4 A;  4C3X A;  1LVL A;  3IWA A;  2GMJ A;  1IUX A;  3UCL A;  4AT2 A;  1M1P A;  1S3B A;  4G9K A;  1OJC A;  3SZC A;  3KLJ A;  4JY2 A;  1H84 A;  4G74 A;  5IQ1 A;  4NNJ A;  3DK8 A;  2DKH A;  3SXQ A;  2WP6 A;  3GMC A;  3KKJ A;  4OVI A;  3F29 A;  5L46 A;  4J57 A;  2RGH A;  1XPQ A;  2NVK X;  4XXG A;  2ZZB A;  2YM1 A;  2CDU A;  3V3O A;  4C77 A;  3C4N A;  4GRT A;  4I59 A;  4AOS A;  5KXJ A;  3LB8 A;  1MXT A;  3ALJ A;  1KNR A;  1B37 A;  1H86 A;  4TM3 A;  1TYP A;  2YLZ A;  2XDO A;  2XFO A;  1QJD A;  5FS6 A;  3C4A A;  1ZY8 A;  1GRE A;  2WOV A;  3AYI A;  1VQW A;  3CNT A;  3G5R A;  2BCG G;  1ZP0 A;  1BVB A;  1EL7 A;  2XLU A;  1E1M A;  3HZL A;  3IF9 A;  2AAQ A;  2R9Z A;  3O0H A;  4Y4M A;  1DJN A;  1FS9 A;  1M1R A;  1BF3 A;  2BRY A;  1FEC A;  2YWL A;  4G6H A;  4J33 A;  4K7Z A;  4A65 A;  5KMR A;  4OPU A;  3QVP A;  4ADW A;  2C76 A;  3LZW A;  3NGC X;  4GF7 A;  3BI5 A;  3NK0 X;  4II3 A;  4CCQ A;  1TDE A;  3KPK A;  1H6V A;  2GQW A;  3RHA A;  1RP0 A;  1FT6 A;  2WBA A;  3ZDN A;  2F5Z A;  1PN0 A;  3FMW A;  3LOV A;  1K4Q A;  1GRG A;  1NHS A;  1TRB A;  3AEC A;  3GDN A;  3CGE A;  2Y6R A;  4IVO B;  3GD4 A;  3VR8 A;  2EQ7 A;  1PBF A;  2WP5 A;  2GQF A;  1COY A;  1PJ5 A;  2WPC A;  1GET A;  3NYC A;  4U8K A;  1PXC A;  3CGB A;  2I0Z A;  2RGJ A;  2X99 A;  4U8M A;  3H8L A;  1JRX A;  1O94 A;  4ZCD A;  2ACZ A;  2WDV A;  1GRH A;  1VRQ B;  1Q1W A;  2Q0L A;  2A87 A;  1JNR A;  1NEN A;  2GR2 A;  2YLT A;  3P4P A;  4GDE A;  4K8D A;  4G6G A;  4EIQ A;  1JEH A;  3K7M X;  4OPG A;  2RF7 A;  1NHP A;  2E81 A;  4KX6 A;  5BUK A;  1GTH A;  4CNK A;  3CNP A;  4FK1 A;  2WHD A;  5FS9 A;  3G5S A;  5KNL A;  4EQR A;  1D5T A;  1E7P A;  5HYM A;  3BNJ A;  4Q5B A;  1BGJ A;  3IC9 A;  2V60 A;  2WES A;  3NYE A;  2WDR A;  1CJ3 A;  2WOW A;  1H81 A;  3HYX A;  2BCP A;  3CGC A;  2VR0 A;  1JNI A;  2GR1 A;  2XVH A;  3NHO X;  4RG3 A;  5FMH A;  4H4Y A;  1JU2 A;  3GWD A;  2R4J A;  3Q6J A;  3F8D A;  1FS7 A;  1IUT A;  2C7G A;  4U8I A;  1NPX A;  1QDB A;  2DKI A;  2H88 A;  5GSN A;  4BV6 A;  4EM4 A;  3NK2 X;  5KMP A;  3UU9 A;  3II4 A;  3NK1 X;  5KOX A;  3AE9 A;  3DK9 A;  2QCU A;  1KNP A;  3I6D A;  4DNA A;  1CBO A;  4X9N A;  4CBQ A;  3QJ4 A;  1M64 A;  1TDF A;  2AR8 A;  4K2X A;  1Z6L A;  4L38 A;  3NN6 X;  3ABV A;  4JN9 A;  5J7X A;  4HA6 A;  4YTM A;  2BA9 A;  1YQZ A;  1TDN A;  2C75 A;  3SXI A;  1QO8 A;  4JNA A;  3GM6 A;  1OJ9 A;  2EQ9 A;  4U2T A;  3UTH A;  2RAB A;  1LQU A;  4D03 A;  3DGH A;  1D7L A;  2ZZC A;  4BK1 A;  1ZOV A;  3AE6 A;  3GDP A;  2UZZ A;  1PBC A;  4CCR A;  2BS4 A;  3NN0 X;  3MMO A;  1NHQ A;  1BKW A;  1GT8 A;  3CTY A;  1B5Q A;  1GOS A;  4X4J A;  4Y4L A;  3RNM A;  1QLB A;  4L3Y A;  1F8W A;  1VG9 A;  3OC4 A;  3T37 A;  3P1W A;  2YLR A;  3RP8 A;  4ECH A;  2BC0 A;  2CFY A;  4D04 A;  1MOK A;  2OA1 A;  5M10 A;  2XLP A;  2ZO5 A;  1JNZ A;  2AQJ A;  4APN A;  4HB9 A;  3V3N A;  3RP7 A;  3CPI G;  2VVM A;  2NPX A;  3AEG A;  3NLC A;  3UKP A;  4BK3 A;  5BRT A;  1RSG A;  2BS2 A;  4LU6 A;  2XFU A;  1IJH A;  2YG5 A;  1YQ3 A;  3CND A;  3ICR A;  1L9D A;  2C66 A;  3VQR A;  1SEZ A;  2BK4 A;  1VDC A;  3F8P A;  4EQS A;  4H4V A;  4H4Z A;  3RKH A;  4YXD A;  2JB2 A;  4K5S A;  4EQW A;  4Z43 A;  4GDP A;  3DGZ A;  2OAM A;  2GR3 A;  4IA5 A;  3VRA A;  4A7A A;  2YG4 A;  3S7W A;  3BI4 A;  1GRA A;  3OZ2 A;  4DGK A;  2B9W A;  5BVA A;  1H82 A;  4XWZ A;  1V59 A;  3VR9 A;  1GXF A;  3CMM A;  3SYI A;  1FEA A;  4MJW A;  1PDH A;  3SZF A;  1S3E A;  3UOZ A;  3I3L A;  4Q0T A;  2X3N A;  1Y0P A;  2BC1 A;  5EBK A;  3NH3 X;  2XVJ A;  3UKK A;  2R4E A;  3S61 A;  3DH9 A;  3T2Z A;  2XFP A;  2WU5 A;  1DJQ A;  2J3N A;  2X8C A;  4AP3 A;  4EQX A;  2C70 A;  2GRT A;  2WP9 A;  1ZX9 A;  4JQ9 A;  1NG3 A;  3ADA B;  4G73 A;  3UTE A;  3LXD A;  3D8X A;  4FX9 A;  3KA7 A;  5TR3 A;  3VRD B;  3AD8 B;  1XAN A;  3RED A;  1PS9 A;  2X8G A;  4UDR A;  1BZL A;  1PBD A;  4IV9 A;  2GR0 A;  3FPZ A;  3B6D A;  1EL8 A;  5EB4 A;  5JCL A;  3K30 A;  4ZN0 A;  1KSU A;  5C2T A;  3D1I A;  2EQ6 A;  3KD9 A;  1CC4 A;  2R0P A;  3AEA A;  3NIX A;  1KF6 A;  1PXA A;  5EOW A;  3DK4 A;  3IHG A;  1ZOY A;  1N4V A;  3GYJ A;  3SFE A;  4EMI A;  2VRL A;  4Z2U A;  2GF3 A;  1PJ6 A;  3QSS A;  4N9X A;  3TTB A;  3SCE A;  2TMD A;  4I58 A;  2YR5 A;  3DME A;  2GEW A;  4FDC B;  4PAA A;  3LGQ A;  4U8P A;  2YVG A;  2R0G A;  3AEB A;  3K7Q X;  3ITJ A;  1O5W A;  2YLS A;  3NYF A;  4EM3 A;  3IHM A;  2TPR A;  3GMB A;  3UKQ A;  1E6E A;  5M0Z A;  5HXI A;  1YKJ A;  2BXS A;  2OAL A;  1TDK A;  4B66 A;  3PVC A;  1GEU A;  4A99 A;  2BAB A;  1F6M A;  3B3R A;  3UOY A;  1LTX R;  3CNJ A;  1N1P A;  4YTN A;  2RGO A;  4YSY A;  3C96 A;  2ZZ0 A;  2A8X A;  4Y4N A;  3CIR A;  3HYV A;  3T2K A;  4AP1 A;  2WU2 A;  4Z24 A;  1D4E A;  3F8R A;  3DJD A;  3AD9 B;  2VZ2 A;  5KRQ A;  4Q17 A;  5U63 A;  1ONF A;  4GR1 A;  2R46 A;  3AWI A;  3LAD A;  1DOC A;  1JRY A;  2EQ8 A;  3URH A;  3QFA A;  1IUV A;  2OT4 A;  2BK3 A;  4B64 A;  3ALM A;  3KPF A;  3EF6 A;  3ISH A;  4B65 A;  1O95 A;  3ZYX A;  1E1N A;  1NAA A;  1GAL A;  4P9S A;  3SZ0 A;  4II2 A;  4H4Q A;  4DSG A;  4BJY A;  3AB1 A;  4XWR A;  1GRT A;  4K5R A;  4A6N A;  2XLS A;  1IUW A;  3G5Q A;  4IVM B;  4Q4U A;  1XDI A;  1E39 A;  2Y6Q A;  1DOE A;  3M13 A;  4YWO A;  3UKH A;  1GSN A;  3AE2 A;  1DOB A;  2O9Z A;  2JB1 A;  2VVL A;  4B1B A;  4UDQ A;  4RSL A;  3QFB A;  3M0O A;  1LPF A;  1E1L A;  3ATQ A;  1ZK7 A;  3CNS A;  4H4W A;  4UDP A;  1AOG A;  4U2S A;  2QA1 A;  3L1T A;  3BNH A;  1B4V A;  3UKA A;  3D1C A;  3AE8 A;  1GER A;  3DJJ A;  1D7Y A;  2Q6U A;  3AE4 A;  4USR A;  3UTG A;  2WQY A;  4Z25 A;  3L1R A;  5IPY A;  1DOD A;  2BXR A;  5ER0 A;  3T14 A;  4C3Y A;  2YLW A;  4JY3 A;  4CY8 A;  1H7W A;  3QVR A;  3UKL A;  1M6I A;  3WE0 A;  4L3X A;  1L9C A;  2V6O A;  2WPF A;  4BJZ A;  4L3Z A;  3NRN A;  2QA2 A;  5KVI A;  2XFN A;  3AE3 A;  2WEU A;  2GH5 A;  1CL0 A;  2YR6 A;  3PO7 A;  4O5Q A;  2C73 A;  4B69 A;  1D4C A;  5JCN A;  3NTA A;  5IQ4 A;  4LII A;  1H83 A;  4ZCC A;  4BK2 A;  3NG7 X;  5FS7 A;  4A6N B;  2B9Y A;  2E1M A;  3SX6 A;  4Z44 A;  2YG7 A;  1FCD A;  1GPE A;  4C5O A;  4Z26 A;  3AEF A;  5U25 A;  2JAE A;  2YVF A;  4EMJ A;  4NEV A;  2WET A;  3EAN A;  3BNF A;  5U1O A;  1FT5 A;  1P2E A;  1OJD A;  2C3D A; 
#chains in the Genus database with same CATH homology
 4H4P A;  1W4X A;  3V76 A;  5KVH A;  4NZH A;  4YTP A;  1LJ1 A;  2QAE A;  4DSH A;  4A5L A;  1FS8 A;  4YT0 A;  3NT6 A;  2R45 A;  1ZKQ A;  1HYU A;  3ICT A;  3COX A;  1YQ4 A;  2B7R A;  4Q5C A;  2VVL G;  2JKC A;  4GUV A;  4Z2T A;  2ARD A;  2WS3 A;  2JBV A;  1F8R A;  1FL2 A;  3CN8 A;  2C65 A;  4H2P A;  2XVI A;  4J34 A;  4X9M A;  1FOH A;  3DA1 A;  4YSX A;  2C64 A;  2OLO A;  1IUS A;  4J36 A;  3RP6 A;  3BHF A;  2H89 A;  2XFQ A;  3QSM A;  2C4C A;  2FBW A;  5CKU A;  2XCG A;  1ZMC A;  4U2L A;  1X31 B;  1TDO A;  3NNE A;  4JNQ A;  4JDR A;  3GWF A;  1K0L A;  2LFC A;  2V61 A;  2Q0K A;  4NEW A;  4H4T A;  4FK1 C;  3HYW A;  4H4X A;  1FEB A;  3AE5 A;  2Z5Y A;  4OPL A;  3ATR A;  1JRZ A;  4LA1 A;  4B68 A;  2E80 A;  4GCM A;  3AYL A;  4A79 A;  1OAH A;  1BWC A;  1IUU A;  2GVC A;  2BK5 A;  1L0V A;  1EL9 A;  1NDA A;  4REK A;  1DXL A;  4AOX A;  2XYO A;  5J60 A;  4J56 A;  3UOX A;  1DNC A;  1N4W A;  1REO A;  2JB3 A;  2Q7V A;  3AED A;  4NTE A;  4Z2R A;  3BI2 A;  4TM0 A;  2Z5X A;  3SY4 A;  4E0V A;  1PBB A;  1ELI A;  3BNU A;  2XLR A;  3JSK A;  4J2W A;  1PJ7 A;  4WX1 A;  4YKG A;  3H4K A;  1TYT A;  3CPJ G;  3SGL A;  4M52 A;  3FG2 P;  1CJC A;  5JCK A;  3GYX A;  4YSH A;  3UTF A;  3AXB A;  1EBD A;  2FJB A;  4Q1O A;  4IA6 A;  1D4D A;  1L9E A;  5JCI A;  2A89 A;  4YSZ A;  3P4R A;  5DBJ A;  3ALL A;  1GRF A;  3R9U A;  4H7U A;  3T31 A;  3UBR A;  3E1T A;  4H2R A;  1GU6 A;  1Q1R A;  1OJA A;  4H2N A;  4OPI A;  5FS8 A;  3UP5 A;  2YVJ A;  5HY5 A;  3DJG X;  5KWF A;  2RDZ A;  1ZMD A;  2C3C A;  3GD3 A;  5C3J A;  1CJ4 A;  2BS3 A;  3ICS A;  1EL5 A;  4NTD A;  2CUL A;  1LQT A;  2BYB A;  2K3V A;  2J7A A;  3AE7 A;  3LZX A;  4OPT A;  4TLZ A;  3GYI A;  1KDG A;  1NHR A;  4GAP A;  2R0C A;  4B67 A;  3P4Q A;  3S5W A;  3UKF A;  5JCM A;  1CJ2 A;  2WDQ A;  2XLT A;  4NTC A;  2W0H A;  2C72 A;  4H4S A;  1SP3 A;  3AD7 B;  1P2H A;  2APG A;  4BUR A;  2WOI A;  1CF3 A;  2B9X A;  3FO3 A;  1N4U A;  4NWZ A;  3H8I A;  4U8J A;  2PYX A;  4USQ A;  2FJE A;  4OCG A;  2VRM A;  3NKS A;  2IVD A;  3UOV A;  1LV0 A;  1F8S A;  2VQ7 A;  1Q9I A;  3BNG A;  5EB5 A;  4WJY A;  2JK6 A;  2VOU A;  5CQF A;  2IID A;  2YAU A;  4U8N A;  1GTE A;  1K0I A;  4CY6 A;  2GV8 A;  1KFY A;  2GB0 A;  1H7X A;  3GSI A;  4EIP A;  2V3A A;  4ICY A;  2WPE A;  3PS9 A;  2GAH B;  2FJD A;  2V3B A;  2CVJ A;  4TM4 A;  1CC6 A;  4PAB A;  3LG1 A;  1PHH A;  1VG0 A;  3NTD A;  1NG4 A;  1S2Q A;  2X8H A;  4O5U A;  3SZW A;  3LJP A;  3BHK A;  1F3P A;  5KMQ A;  2ZBW A;  2YG3 A;  3EAO A;  3AEE A;  3TOR A;  2E4G A;  4YKF A;  4K22 A;  3VRB A;  3CGD A;  3BNM A;  1KSS A;  1XHC A;  3GRT A;  1BGN A;  1GES A;  2BAC A;  1CHU A;  2HQM A;  3K7T A;  4H4R A;  4TM1 A;  3T2Y A;  4EMW A;  1ZDL A;  4UP3 A;  1PBE A;  1M1Q A;  4WCT A;  3EPT A;  1NEK A;  4AT0 A;  4B63 A;  4C74 A;  5LV9 A;  2IVE A;  3KVE A;  4U8O A;  1Y56 A;  5HHF A;  4OPD A;  4OPC A;  3Q9T A;  1B8S A;  2B7S A;  3P9U A;  3FIM B;  1GRB A;  4H4U A;  3SFD A;  3T0K A;  2E5V A;  1CC2 A;  1K0J A;  4A9W A;  3CPH G;  1PXB A;  2XVF A;  5KMS A;  4U8L A;  4H2Q A;  4RG4 A;  2PHH A;  4CRT A;  2VQB A;  2GMH A;  2YR4 A;  5GRT A;  4KPR A;  3P4S A;  2X50 A;  1OJT A;  2OLN A;  4GAV A;  1S2Y A;  3AE1 A;  3SM8 A;  4J31 A;  3SQP A;  3M12 A;  2V5Z A;  2YQU A;  3DJE A;  1UKV G;  1MO9 A;  2B76 A;  4TLX A;  1GND A;  2GAG B;  3L8K A;  2C67 A;  3QSE A;  5BUL A;  5KOW A;  3KU9 A;  2YLX A;  2YM2 A;  1YY5 A;  2FJA A;  3AYJ A;  4CNJ A;  3GRS A;  2BRA A;  2YG6 A;  3FBS A;  1RYI A;  1JOA A;  3UP4 A;  3OWM A;  1E1K A;  1Y56 B;  2XVE A;  4H50 A;  1GV4 A;  4C3X A;  1LVL A;  3IWA A;  2GMJ A;  1IUX A;  3UCL A;  4AT2 A;  1M1P A;  1S3B A;  4G9K A;  1OJC A;  3SZC A;  3KLJ A;  4JY2 A;  1H84 A;  4G74 A;  5IQ1 A;  4NNJ A;  3DK8 A;  2DKH A;  3SXQ A;  2WP6 A;  3GMC A;  3KKJ A;  4OVI A;  3F29 A;  5L46 A;  4J57 A;  2RGH A;  1XPQ A;  2NVK X;  4XXG A;  2ZZB A;  2YM1 A;  2CDU A;  3V3O A;  4C77 A;  3C4N A;  4GRT A;  4I59 A;  4AOS A;  5KXJ A;  3LB8 A;  1MXT A;  3ALJ A;  1KNR A;  1B37 A;  1H86 A;  4TM3 A;  1TYP A;  2YLZ A;  2XDO A;  2XFO A;  1QJD A;  5FS6 A;  3C4A A;  1ZY8 A;  1GRE A;  2WOV A;  3AYI A;  1VQW A;  3CNT A;  3G5R A;  2BCG G;  1ZP0 A;  1BVB A;  1EL7 A;  2XLU A;  1E1M A;  3HZL A;  3IF9 A;  2AAQ A;  2R9Z A;  3O0H A;  4Y4M A;  1DJN A;  1FS9 A;  1M1R A;  1BF3 A;  2BRY A;  1FEC A;  2YWL A;  4G6H A;  4J33 A;  4K7Z A;  4A65 A;  5KMR A;  4OPU A;  3QVP A;  4ADW A;  2C76 A;  3LZW A;  3NGC X;  4GF7 A;  3BI5 A;  3NK0 X;  4II3 A;  4CCQ A;  1TDE A;  3KPK A;  1H6V A;  2GQW A;  3RHA A;  1RP0 A;  1FT6 A;  2WBA A;  3ZDN A;  2F5Z A;  1PN0 A;  3FMW A;  3LOV A;  1K4Q A;  1GRG A;  1NHS A;  1TRB A;  3AEC A;  3GDN A;  3CGE A;  2Y6R A;  4IVO B;  3GD4 A;  3VR8 A;  2EQ7 A;  1PBF A;  2WP5 A;  2GQF A;  1COY A;  1PJ5 A;  2WPC A;  1GET A;  3NYC A;  4U8K A;  1PXC A;  3CGB A;  2I0Z A;  2RGJ A;  2X99 A;  4U8M A;  3H8L A;  1JRX A;  1O94 A;  4ZCD A;  2ACZ A;  2WDV A;  1GRH A;  1VRQ B;  1Q1W A;  2Q0L A;  2A87 A;  1JNR A;  1NEN A;  2GR2 A;  2YLT A;  3P4P A;  4GDE A;  4K8D A;  4G6G A;  4EIQ A;  1JEH A;  3K7M X;  4OPG A;  2RF7 A;  1NHP A;  2E81 A;  4KX6 A;  5BUK A;  1GTH A;  4CNK A;  3CNP A;  4FK1 A;  2WHD A;  5FS9 A;  3G5S A;  5KNL A;  4EQR A;  1D5T A;  1E7P A;  5HYM A;  3BNJ A;  4Q5B A;  1BGJ A;  3IC9 A;  2V60 A;  2WES A;  3NYE A;  2WDR A;  1CJ3 A;  2WOW A;  1H81 A;  3HYX A;  2BCP A;  3CGC A;  2VR0 A;  1JNI A;  2GR1 A;  2XVH A;  3NHO X;  4RG3 A;  5FMH A;  4H4Y A;  1JU2 A;  3GWD A;  2R4J A;  3Q6J A;  3F8D A;  1FS7 A;  1IUT A;  2C7G A;  4U8I A;  1NPX A;  1QDB A;  2DKI A;  2H88 A;  5GSN A;  4BV6 A;  4EM4 A;  3NK2 X;  5KMP A;  3UU9 A;  3II4 A;  3NK1 X;  5KOX A;  3AE9 A;  3DK9 A;  2QCU A;  1KNP A;  3I6D A;  4DNA A;  1CBO A;  4X9N A;  4CBQ A;  3QJ4 A;  1M64 A;  1TDF A;  2AR8 A;  4K2X A;  1Z6L A;  4L38 A;  3NN6 X;  3ABV A;  4JN9 A;  5J7X A;  4HA6 A;  4YTM A;  2BA9 A;  1YQZ A;  1TDN A;  2C75 A;  3SXI A;  1QO8 A;  4JNA A;  3GM6 A;  1OJ9 A;  2EQ9 A;  4U2T A;  3UTH A;  2RAB A;  1LQU A;  4D03 A;  3DGH A;  1D7L A;  2ZZC A;  4BK1 A;  1ZOV A;  3AE6 A;  3GDP A;  2UZZ A;  1PBC A;  4CCR A;  2BS4 A;  3NN0 X;  3MMO A;  1NHQ A;  1BKW A;  1GT8 A;  3CTY A;  1B5Q A;  1GOS A;  4X4J A;  4Y4L A;  3RNM A;  1QLB A;  4L3Y A;  1F8W A;  1VG9 A;  3OC4 A;  3T37 A;  3P1W A;  2YLR A;  3RP8 A;  4ECH A;  2BC0 A;  2CFY A;  4D04 A;  1MOK A;  2OA1 A;  5M10 A;  2XLP A;  2ZO5 A;  1JNZ A;  2AQJ A;  4APN A;  4HB9 A;  3V3N A;  3RP7 A;  3CPI G;  2VVM A;  2NPX A;  3AEG A;  3NLC A;  3UKP A;  4BK3 A;  5BRT A;  1RSG A;  2BS2 A;  4LU6 A;  2XFU A;  1IJH A;  2YG5 A;  1YQ3 A;  3CND A;  3ICR A;  1L9D A;  2C66 A;  3VQR A;  1SEZ A;  2BK4 A;  1VDC A;  3F8P A;  4EQS A;  4H4V A;  4H4Z A;  3RKH A;  4YXD A;  2JB2 A;  4K5S A;  4EQW A;  4Z43 A;  4GDP A;  3DGZ A;  2OAM A;  2GR3 A;  4IA5 A;  3VRA A;  4A7A A;  2YG4 A;  3S7W A;  3BI4 A;  1GRA A;  3OZ2 A;  4DGK A;  2B9W A;  5BVA A;  1H82 A;  4XWZ A;  1V59 A;  3VR9 A;  1GXF A;  3CMM A;  3SYI A;  1FEA A;  4MJW A;  1PDH A;  3SZF A;  1S3E A;  3UOZ A;  3I3L A;  4Q0T A;  2X3N A;  1Y0P A;  2BC1 A;  5EBK A;  3NH3 X;  2XVJ A;  3UKK A;  2R4E A;  3S61 A;  3DH9 A;  3T2Z A;  2XFP A;  2WU5 A;  1DJQ A;  2J3N A;  2X8C A;  4AP3 A;  4EQX A;  2C70 A;  2GRT A;  2WP9 A;  1ZX9 A;  4JQ9 A;  1NG3 A;  3ADA B;  4G73 A;  3UTE A;  3LXD A;  3D8X A;  4FX9 A;  3KA7 A;  5TR3 A;  3VRD B;  3AD8 B;  1XAN A;  3RED A;  1PS9 A;  2X8G A;  4UDR A;  1BZL A;  1PBD A;  4IV9 A;  2GR0 A;  3FPZ A;  3B6D A;  1EL8 A;  5EB4 A;  5JCL A;  3K30 A;  4ZN0 A;  1KSU A;  5C2T A;  3D1I A;  2EQ6 A;  3KD9 A;  1CC4 A;  2R0P A;  3AEA A;  3NIX A;  1KF6 A;  1PXA A;  5EOW A;  3DK4 A;  3IHG A;  1ZOY A;  1N4V A;  3GYJ A;  3SFE A;  4EMI A;  2VRL A;  4Z2U A;  2GF3 A;  1PJ6 A;  3QSS A;  4N9X A;  3TTB A;  3SCE A;  2TMD A;  4I58 A;  2YR5 A;  3DME A;  2GEW A;  4FDC B;  4PAA A;  3LGQ A;  4U8P A;  2YVG A;  2R0G A;  3AEB A;  3K7Q X;  3ITJ A;  1O5W A;  2YLS A;  3NYF A;  4EM3 A;  3IHM A;  2TPR A;  3GMB A;  3UKQ A;  1E6E A;  5M0Z A;  5HXI A;  1YKJ A;  2BXS A;  2OAL A;  1TDK A;  4B66 A;  3PVC A;  1GEU A;  4A99 A;  2BAB A;  1F6M A;  3B3R A;  3UOY A;  1LTX R;  3CNJ A;  1N1P A;  4YTN A;  2RGO A;  4YSY A;  3C96 A;  2ZZ0 A;  2A8X A;  4Y4N A;  3CIR A;  3HYV A;  3T2K A;  4AP1 A;  2WU2 A;  4Z24 A;  1D4E A;  3F8R A;  3DJD A;  3AD9 B;  2VZ2 A;  5KRQ A;  4Q17 A;  5U63 A;  1ONF A;  4GR1 A;  2R46 A;  3AWI A;  3LAD A;  1DOC A;  1JRY A;  2EQ8 A;  3URH A;  3QFA A;  1IUV A;  2OT4 A;  2BK3 A;  4B64 A;  3ALM A;  3KPF A;  3EF6 A;  3ISH A;  4B65 A;  1O95 A;  3ZYX A;  1E1N A;  1NAA A;  1GAL A;  4P9S A;  3SZ0 A;  4II2 A;  4H4Q A;  4DSG A;  4BJY A;  3AB1 A;  4XWR A;  1GRT A;  4K5R A;  4A6N A;  2XLS A;  1IUW A;  3G5Q A;  4IVM B;  4Q4U A;  1XDI A;  1E39 A;  2Y6Q A;  1DOE A;  3M13 A;  4YWO A;  3UKH A;  1GSN A;  3AE2 A;  1DOB A;  2O9Z A;  2JB1 A;  2VVL A;  4B1B A;  4UDQ A;  4RSL A;  3QFB A;  3M0O A;  1LPF A;  1E1L A;  3ATQ A;  1ZK7 A;  3CNS A;  4H4W A;  4UDP A;  1AOG A;  4U2S A;  2QA1 A;  3L1T A;  3BNH A;  1B4V A;  3UKA A;  3D1C A;  3AE8 A;  1GER A;  3DJJ A;  1D7Y A;  2Q6U A;  3AE4 A;  4USR A;  3UTG A;  2WQY A;  4Z25 A;  3L1R A;  5IPY A;  1DOD A;  2BXR A;  5ER0 A;  3T14 A;  4C3Y A;  2YLW A;  4JY3 A;  4CY8 A;  1H7W A;  3QVR A;  3UKL A;  1M6I A;  3WE0 A;  4L3X A;  1L9C A;  2V6O A;  2WPF A;  4BJZ A;  4L3Z A;  3NRN A;  2QA2 A;  5KVI A;  2XFN A;  3AE3 A;  2WEU A;  2GH5 A;  1CL0 A;  2YR6 A;  3PO7 A;  4O5Q A;  2C73 A;  4B69 A;  1D4C A;  5JCN A;  3NTA A;  5IQ4 A;  4LII A;  1H83 A;  4ZCC A;  4BK2 A;  3NG7 X;  5FS7 A;  4A6N B;  2B9Y A;  2E1M A;  3SX6 A;  4Z44 A;  2YG7 A;  1FCD A;  1GPE A;  4C5O A;  4Z26 A;  3AEF A;  5U25 A;  2JAE A;  2YVF A;  4EMJ A;  4NEV A;  2WET A;  3EAN A;  3BNF A;  5U1O A;  1FT5 A;  1P2E A;  1OJD A;  2C3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...