1Q9IA

The a251c:s430c double mutant of flavocytochrome c3 from shewanella frigidimarina
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGCGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLCKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c3
publication title Probing Domain Mobility in a Flavocytochrome
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 193
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1q9iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1q9iA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1q9iA01
3QSSA 1M6IA 4Y4MA 4B64A 4IVMB 5KWFA 3AE9A 1S2QA 3ICTA 4LU6A 2VQ7A 4ICYA 4U2SA 4DSGA 1PBBA 1FS9A 1FS8A 5CKUA 1PJ5A 1VQWA 2R0GA 3GDNA 2YLWA 1Z6LA 1IUTA 3BI2A 4CRTA 5LV9A 3FIMB 3UP5A 2E4GA 1K4QA 3DK4A 3BHFA 1VDCA 1BVBA 3K7QX 4ZCDA 4O5QA 1AOGA 1B8SA 2GR2A 3CNPA 3GRTA 4RG4A 4EMIA 1KSSA 4GDPA 1NHRA 2V3AA 3AXBA 3DMEA 4P9SA 5KVIA 1IJHA 1F8WA 4X9NA 2ARDA 4J57A 3DGHA 1N4VA 2K3VA 2GEWA 3GRSA 1MOKA 5KOWA 2FJAA 2Y6RA 2WQYA 1M1PA 2JAEA 3DK8A 1CBOA 2J7AA 1O95A 4K5SA 4NTEA 1GV4A 3FO3A 1PBFA 3CGCA 1GERA 4OVIA 5EBKA 1LTXR 4Q0TA 2GMHA 4JQ9A 3UOVA 4YT0A 4WCTA 3L1RA 3BNGA 4A65A 4UDRA 1CJ2A 4D04A 3M12A 4AP3A 3VR8A 5JCNA 5FS8A 3I6DA 3AYJA 1LVLA 2VQBA 5C3JA 1NPXA 1FECA 1L0VA 4Q4UA 4J2WA 2WDVA 2PYXA 1E39A 3UKKA 4YKGA 2EQ9A 2VRLA 4GRTA 1PJ6A 3RNMA 1RP0A 3NRNA 3M0OA 2XLUA 3AEGA 3G5SA 5J7XA 5J60A 4LA1A 2V6OA 4BV6A 4O5UA 1NHPA 1CJCA 1K0LA 1NG4A 1F8RA 5EB4A 4Z24A 4JDRA 2B7RA 1D7LA 2IVDA 3V3NA 3AE8A 4EQXA 4EQRA 4U8LA 4EIPA 1Y56A 1PJ7A 2OA1A 1E1KA 4C77A 2BABA 1OAHA 1DJNA 2R0PA 1D4DA 1X31B 4Q5BA 4L38A 4Q17A 1GXFA 5HHFA 2GR3A 3G5RA 3SXQA 5FMHA 4TM0A 4FK1A 2BYBA 2F5ZA 2YVJA 5TR3A 3OWMA 2XFQA 2I0ZA 3AEFA 4OPLA 4Z43A 1CC6A 3P9UA 1XDIA 4C74A 1N1PA 1PN0A 2QCUA 4C3YA 3SQPA 3CN8A 2C73A 4GF7A 3UTFA 1H7XA 2A8XA 3BNJA 2Q0LA 4TM4A 2WHDA 2Y6QA 2X8GA 1TYPA 2R4JA 1OJ9A 1H83A 5KRQA 4TM1A 3UP4A 4OPDA 3UTGA 2JBVA 3P4QA 4REKA 1E1MA 2YG6A 1XHCA 3MMOA 1DNCA 3BI5A 4A79A 2JK6A 3UKQA 3AD9B 1RYIA 4OPIA 3P1WA 3OC4A 1B37A 1PBEA 1H84A 4USRA 3ZDNA 5KVHA 2BACA 1TDEA 4YTMA 3LZXA 2GB0A 4TLZA 4K7ZA 3KU9A 3UTEA 4NEVA 4GCMA 4H2QA 1ZY8A 1DOCA 2WP5A 2C67A 4U8OA 3AE2A 3RP8A 2TMDA 3C4NA 2GR0A 2VVLG 2YVFA 3D8XA 2YLRA 3NHOX 5IPYA 1DOBA 5L46A 2GVCA 1ZMDA 2WOIA 3KKJA 4YWOA 2XFUA 4OPUA 4B65A 3QSMA 2WDRA 4IA5A 4C3XA 3S5WA 2V5ZA 2YG3A 4H4TA 2BCGG 1O94A 2C7GA 1D5TA 2R4EA 4H7UA 1PS9A 2GAHB 2XVJA 3BNUA 1EL8A 3NKSA 3OZ2A 4B1BA 4U8NA 5IQ4A 1GEUA 3GYIA 4Z2UA 1CJ3A 1HYUA 3AYIA 2C64A 4FK1C 1NAAA 1PBCA 5ER0A 2YG7A 3ALJA 3VRBA 1GNDA 1GRBA 3I3LA 2W0HA 1JRZA 3S61A 3QSEA 2BS2A 2YAUA 1DXLA 2JB2A 1EL9A 4U8KA 1L9DA 1JOAA 4XXGA 4ADWA 2GF3A 2E80A 1JNZA 4PABA 3KLJA 4AT0A 3SM8A 2BXSA 1GT8A 1FL2A 1FS7A 3AE3A 5FS6A 4TLXA 4RG3A 2EQ8A 2A87A 3DA1A 4ZCCA 1BGJA 2FJBA 2IIDA 3NK1X 2DKIA 3CIRA 1LQUA 2A89A 1NG3A 3BHKA 1VG9A 3CGBA 3RP6A 3EPTA 3UKHA 4DGKA 1H7WA 3NIXA 3GWDA 2Q0KA 3KD9A 4CY8A 3AE5A 3ITJA 2E81A 1ZP0A 2XVFA 1TDKA 4LIIA 2XLPA 4UP3A 3AWIA 4NZHA 3COXA 3NYCA 5FS9A 2WPCA 1GESA 2GRTA 4GDEA 5GRTA 1Y56B 4ECHA 1JEHA 2EQ6A 1QO8A 2BCPA 4H50A 4J36A 2V3BA 3UCLA 1VRQB 5JCKA 2OALA 2XFNA 2OLOA 4JY2A 3GMBA 2JB3A 4OCGA 2WETA 4B67A 3D1CA 4I59A 2C3DA 2B9YA 1QJDA 4CBQA 2C66A 3QVPA 1PXCA 4BK3A 3EANA 2ZZCA 1ZOVA 4H4RA 3V76A 1ZMCA 4A9WA 4Z26A 3B3RA 2WOWA 4MJWA 3AE1A 4EM4A 2CULA 4B69A 2LFCA 2H89A 4A5LA 4IVOB 1NHQA 3DK9A 4EM3A 1E1NA 5JCMA 2BK3A 3QVRA 4H4ZA 3DGZA 3BNMA 2GMJA 4IV9A 4CNKA 2XYOA 2RABA 3LB8A 3ABVA 1FT6A 1H86A 2BK5A 3CPJG 2FJDA 3LGQA 2QA1A 2X8HA 2IVEA 1TDFA 1TRBA 3AE4A 1CHUA 4CCRA 3NK0X 3K7MX 4Z44A 1TDNA 4BJYA 1YQ4A 4YSXA 1KNPA 1Q9IA 3AE6A 3L1TA 2O9ZA 2YQUA 2B9WA 3SCEA 2GAGB 1XANA 2FBWA 3DJEA 2YR4A 3D1IA 3AEBA 2R0CA 3NTDA 2C70A 1YQZA 2ACZA 4XWZA 2XFOA 2B76A 3RKHA 4EQWA 3CNSA 1KSUA 4A6NB 3RP7A 2XVEA 1TDOA 1ZDLA 1PBDA 1GETA 2TPRA 5IQ1A 4L3XA 4K5RA 2R45A 2BK4A 1H82A 3UOYA 3DJGX 1CC4A 1VG0A 4L3ZA 4L3YA 2WS3A 3PVCA 4BJZA 3EAOA 1XPQA 3DH9A 4EQSA 4H4VA 1N4UA 1B4VA 1K0JA 2OLNA 3P4PA 2YLTA 4RSLA 1ZX9A 2YLSA 3EF6A 4H4YA 3UOZA 3UTHA 4KX6A 4YSYA 4DSHA 4BURA 2BC1A 2H88A 2YWLA 2GR1A 1F8SA 3CNJA 3CPHG 3AEAA 4UDPA 1W4XA 2WESA 3FG2P 2NPXA 1LPFA 5HYMA 5BULA 3LJPA 3NTAA 4AP1A 5JCLA 1KF6A 3V3OA 1EL5A 2V61A 4U8MA 4B68A 1JU2A 3ATRA 4OPCA 1E7PA 4A6NA 1GOSA 2EQ7A 1IUVA 4YSHA 1OJTA 1L9EA 3NGCX 1MO9A 2RGJA 2WOVA 3F8DA 3IC9A 1BKWA 4TM3A 4USQA 1S3EA 4YSZA 3O0HA 1M1RA 5BVAA 4J31A 2E1MA 3NN6X 1GU6A 5BUKA 2ZZ0A 3LXDA 3IWAA 3ALLA 3BNHA 1D7YA 3FMWA 4OPGA 4YKFA 1P2EA 3VQRA 4A99A 3F29A 1YY5A 1QDBA 2HQMA 4I58A 1DOEA 2GQWA 4A7AA 1P2HA 2C72A 1OJCA 2NVKX 3NYEA 4BK2A 3SFDA 3UKPA 2BC0A 1OJDA 3NN0X 3IHMA 5M10A 4CCQA 4B63A 2V60A 4EMWA 2R46A 3R9UA 3GD3A 4K8DA 3UBRA 3GD4A 5U63A 4GR1A 1KNRA 1REOA 1JRYA 3TTBA 2X50A 5M0ZA 4JN9A 4IA6A 3SGLA 3VR9A 1S3BA 3H8LA 4Z25A 3B6DA 2ZO5A 2CDUA 3KVEA 1O5WA 2YG5A 4WJYA 2J3NA 1CF3A 2VVMA 2C65A 4K2XA 3IHGA 2RF7A 2WBAA 3AEEA 1B5QA 1FCDA 1GTEA 2WEUA 1H81A 2Q7VA 2QA2A 1GREA 1JRXA 2ZZBA 4X9MA 5FS7A 1GALA 4FX9A 1GRHA 3DJJA 1BGNA 2BXRA 3PO7A 4N9XA 1S2YA 4JNAA 1F3PA 1D4CA 2WPFA 3CGDA 1IUWA 2VZ2A 5HY5A 2B9XA 4U2TA 5EOWA 2XLSA 1SEZA 3AB1A 1IUUA 3AEDA 4KPRA 1SP3A 3NLCA 3DJDA 1D4EA 2YG4A 1UKVG 5EB5A 3H8IA 2AAQA 1ZK7A 4YTNA 2PHHA 3AD7B 3ALMA 3L8KA 3QJ4A 2XVHA 4ZN0A 2VOUA 2FJEA 1GRFA 2WP6A 3UKFA 3H4KA 2JB1A 1NHSA 3K30A 1GRAA 1GTHA 4OPTA 3VRAA 3AYLA 4H2NA 3URHA 4B66A 3BNFA 4CNJA 2XLTA 2C75A 4M52A 1ZOYA 4DNAA 3ATQA 4U8PA 4Q1OA 3C4AA 4HB9A 1JNRA 4H4QA 4PAAA 3SFEA 4Y4LA 4JY3A 2BS3A 3CNDA 4H2PA 2AR8A 4H4PA 5C2TA 2GH5A 2YLZA 3NH3X 3WE0A 5KOXA 3S7WA 2XVIA 3GSIA 2DKHA 1Q1RA 1CC2A 1ELIA 1MXTA 2C3CA 3LZWA 1BZLA 3JSKA 2VVLA 4FDCB 2X3NA 4BK1A 3P4RA 1FT5A 4WX1A 1BF3A 3K7TA 3GWFA 1M64A 1JNIA 1NEKA 1PHHA 4H2RA 4XWRA 2GV8A 1KDGA 4J33A 1L9CA 3NNEA 3P4SA 3F8PA 1CL0A 2JKCA 1GRTA 4HA6A 3LG1A 2C76A 4UDQA 2XFPA 1YQ3A 1N4WA 4H4XA 4CY6A 1PDHA 1F6MA 4YTPA 5GSNA 2BA9A 4EIQA 2RGOA 3ICRA 4X4JA 2Q6UA 4AT2A 3VRDB 2CVJA 2RGHA 2YM1A 3GDPA 4H4WA 3QFAA 1GSNA 4C5OA 4K22A 3TORA 1Q1WA 3Q6JA 3AECA 5CQFA 3QFBA 2WU5A 3FBSA 1KFYA 4J34A 4E0VA 2WU2A 1EL7A 2WDQA 4NTCA 3F8RA 2VR0A 2ZBWA 4Z2RA 3M13A 1QLBA 2X8CA 3GM6A 1GRGA 1H6VA 1YKJA 4U8JA 3G5QA 1BWCA 1DODA 2YM2A 3NYFA 3LOVA 2OT4A 5U25A 3NK2X 2R9ZA 3FPZA 1ONFA 2XDOA 3ZYXA 3UKAA 2Z5XA 2RDZA 3KA7A 5JCIA 1GPEA 2BS4A 3AE7A 3UU9A 4EMJA 3CGEA 3UOXA 2E5VA 3GMCA 3LADA 2B7SA 3GYJA 4AOSA 5BRTA 1DJQA 2XLRA 2YVGA 3PS9A 1EBDA 2GQFA 2YR5A 1IUXA 3NG7X 4Z2TA 1PXBA 1FEAA 1E1LA 3IF9A 1FEBA 1ZKQA 2AQJA 2VRMA 2Z5YA 3Q9TA 3CPIG 4AOXA 2UZZA 4NTDA 1OJAA 5KXJA 3CTYA 1LV0A 4GUVA 1PXAA 2YR6A 4APNA 1Y0PA 1CJ4A 1M1QA 1RSGA 4JNQA 3T37A 1V59A 3HZLA 3II4A 4U8IA 3GYXA 1TYTA 3REDA 1COYA 3E1TA 3KPFA 3CNTA 4J56A 2XCGA 4Q5CA 3C96A 2X99A 3ADAB 2APGA 2QAEA 3ISHA 1LJ1A 1E6EA 1NDAA 1IUSA 3RHAA 5HXIA 4YXDA 4D03A 4H4SA 3ICSA 5DBJA 1K0IA 4Y4NA 2WP9A 2WPEA 4H4UA 1FOHA 3AD8B 1NENA 3UKLA 2OAMA 4NEWA 4U2LA 2YLXA 1LQTA 3BI4A 5U1OA 3NT6A 2CFYA
chains in the Genus database with same CATH superfamily
3QSSA 3KPKA 1M6IA 4Y4MA 4B64A 4IVMB 5KWFA 3AE9A 1S2QA 3ICTA 4LU6A 2VQ7A 4ICYA 4U2SA 4DSGA 1PBBA 1FS9A 1FS8A 5CKUA 1PJ5A 1VQWA 2R0GA 3GDNA 2YLWA 3T2YA 1Z6LA 5FS7A 1IUTA 3BI2A 4CRTA 5LV9A 3FIMB 3UP5A 2E4GA 1K4QA 3DK4A 3BHFA 1VDCA 1BVBA 3K7QX 4ZCDA 4O5QA 1AOGA 1B8SA 2GR2A 3CNPA 3GRTA 4RG4A 4EMIA 1KSSA 4GDPA 1NHRA 2V3AA 3AXBA 3DMEA 4P9SA 5KVIA 1IJHA 1F8WA 4X9NA 2ARDA 3HYXA 4J57A 3DGHA 1N4VA 2K3VA 2GEWA 3GRSA 1MOKA 5KOWA 2FJAA 2Y6RA 2WQYA 1M1PA 2JAEA 3DK8A 1CBOA 2J7AA 1O95A 4K5SA 4NTEA 1GV4A 3FO3A 1PBFA 3CGCA 1GERA 4OVIA 5EBKA 1LTXR 4Q0TA 2GMHA 4JQ9A 5KMPA 3UOVA 4YT0A 4WCTA 3L1RA 3BNGA 4A65A 4UDRA 1CJ2A 4D04A 3M12A 4AP3A 3VR8A 5JCNA 5FS8A 3I6DA 3AYJA 1LVLA 2VQBA 5C3JA 1NPXA 1FECA 1L0VA 4Q4UA 4J2WA 2WDVA 2PYXA 1E39A 3UKKA 4YKGA 2EQ9A 2VRLA 4GRTA 1PJ6A 3RNMA 1RP0A 3NRNA 3M0OA 2XLUA 3AEGA 3G5SA 5J7XA 5J60A 4LA1A 2V6OA 4BV6A 4O5UA 1NHPA 1CJCA 1K0LA 1NG4A 1F8RA 5EB4A 4Z24A 4JDRA 2B7RA 1D7LA 2IVDA 3V3NA 3AE8A 4EQXA 4EQRA 4U8LA 4EIPA 1Y56A 1PJ7A 2OA1A 3SX6A 1E1KA 4C77A 2BABA 1OAHA 1DJNA 2R0PA 1D4DA 1X31B 4Q5BA 4L38A 4Q17A 1GXFA 5HHFA 2GR3A 3G5RA 3SXQA 5FMHA 4TM0A 4FK1A 2BYBA 2F5ZA 2YVJA 5TR3A 3OWMA 2XFQA 2I0ZA 3AEFA 4OPLA 4Z43A 1CC6A 3P9UA 1XDIA 4C74A 1N1PA 1PN0A 2QCUA 4C3YA 3SQPA 3CN8A 2C73A 4GF7A 3UTFA 1H7XA 2A8XA 3BNJA 2Q0LA 4TM4A 2WHDA 2Y6QA 2X8GA 1TYPA 2R4JA 1OJ9A 1H83A 5KRQA 4TM1A 3UP4A 4OPDA 3UTGA 2JBVA 4II3A 3P4QA 4REKA 1E1MA 2YG6A 1XHCA 3MMOA 1DNCA 3BI5A 4A79A 5KNLA 2JK6A 3UKQA 3AD9B 1RYIA 4OPIA 3P1WA 3OC4A 1B37A 1PBEA 1H84A 4USRA 3ZDNA 5KVHA 2BACA 1TDEA 4YTMA 3LZXA 2GB0A 4TLZA 3SZ0A 4K7ZA 3KU9A 3UTEA 4NEVA 4GCMA 4H2QA 1ZY8A 1DOCA 2WP5A 3T14A 2C67A 4U8OA 3AE2A 3RP8A 2TMDA 3C4NA 2GR0A 2VVLG 2YVFA 3D8XA 2YLRA 3NHOX 5IPYA 1DOBA 4G73A 5L46A 2GVCA 1ZMDA 2WOIA 3KKJA 4YWOA 2XFUA 4OPUA 4B65A 3QSMA 2WDRA 4IA5A 4C3XA 3S5WA 2V5ZA 2YG3A 4H4TA 2BCGG 2CZSA 1O94A 2C7GA 1D5TA 2R4EA 4H7UA 1PS9A 2GAHB 2XVJA 3BNUA 1EL8A 3NKSA 3OZ2A 4B1BA 4U8NA 5IQ4A 1GEUA 3GYIA 4Z2UA 1CJ3A 1HYUA 3AYIA 2C64A 4FK1C 1NAAA 1PBCA 5ER0A 2YG7A 3ALJA 3VRBA 1GNDA 1GRBA 3I3LA 2W0HA 1JRZA 3S61A 3QSEA 2BS2A 2YAUA 1DXLA 2JB2A 1EL9A 4U8KA 1L9DA 1JOAA 4XXGA 4ADWA 2GF3A 2E80A 1JNZA 4PABA 3KLJA 4AT0A 3SM8A 2BXSA 1GT8A 1FL2A 1FS7A 3AE3A 5FS6A 4TLXA 4RG3A 2EQ8A 2A87A 3DA1A 4ZCCA 3SZCA 1BGJA 2FJBA 2IIDA 3NK1X 2DKIA 3CIRA 1LQUA 2A89A 1NG3A 3BHKA 1VG9A 3CGBA 3RP6A 3EPTA 3UKHA 4DGKA 1H7WA 3NIXA 3GWDA 2Q0KA 3KD9A 4CY8A 3AE5A 3ITJA 2E81A 1ZP0A 2XVFA 1TDKA 4LIIA 2XLPA 4UP3A 3AWIA 4NZHA 3COXA 3NYCA 5FS9A 2WPCA 1GESA 2GRTA 4GDEA 5GRTA 1Y56B 4ECHA 3SZWA 1JEHA 2EQ6A 1QO8A 2BCPA 4H50A 4J36A 2V3BA 3UCLA 1VRQB 5JCKA 2OALA 2XFNA 2OLOA 4JY2A 3GMBA 2JB3A 4OCGA 2WETA 4B67A 3D1CA 4I59A 2C3DA 2B9YA 1QJDA 4CBQA 2C66A 3QVPA 1PXCA 4BK3A 3EANA 2ZZCA 1ZOVA 4H4RA 3V76A 1ZMCA 4A9WA 4Z26A 3B3RA 2WOWA 4MJWA 3AE1A 4EM4A 2CULA 4B69A 2LFCA 2H89A 4A5LA 4IVOB 1NHQA 3DK9A 4EM3A 1E1NA 5JCMA 2BK3A 3QVRA 4H4ZA 3DGZA 3BNMA 2GMJA 4IV9A 4CNKA 2XYOA 2RABA 3LB8A 3ABVA 1FT6A 1H86A 2BK5A 3CPJG 2FJDA 3LGQA 2QA1A 2X8HA 3T2ZA 2IVEA 1TDFA 1TRBA 3AE4A 1CHUA 4CCRA 3NK0X 3K7MX 4Z44A 1TDNA 4BJYA 1YQ4A 4YSXA 1KNPA 1Q9IA 3AE6A 3L1TA 2O9ZA 2YQUA 2B9WA 3SCEA 2GAGB 1XANA 2FBWA 3DJEA 2YR4A 3D1IA 4G6GA 3AEBA 2R0CA 3NTDA 2C70A 1YQZA 2ACZA 4XWZA 2XFOA 2B76A 3RKHA 4EQWA 3CNSA 1KSUA 4A6NB 3RP7A 2XVEA 1TDOA 1ZDLA 1PBDA 1GETA 2TPRA 5IQ1A 4L3XA 4K5RA 2R45A 2BK4A 1H82A 3UOYA 3DJGX 1CC4A 1VG0A 4L3ZA 4L3YA 2WS3A 3PVCA 4BJZA 3EAOA 1XPQA 3DH9A 4EQSA 4H4VA 1N4UA 1B4VA 1K0JA 2OLNA 3P4PA 2YLTA 4RSLA 1ZX9A 2YLSA 3EF6A 4H4YA 3UOZA 3UTHA 4KX6A 4YSYA 4NWZA 4DSHA 5KMSA 4BURA 2BC1A 2H88A 2YWLA 2GR1A 1F8SA 3CNJA 3CPHG 3AEAA 4UDPA 1W4XA 2WESA 3FG2P 2NPXA 1LPFA 5HYMA 5BULA 3LJPA 3NTAA 4AP1A 5JCLA 1KF6A 3V3OA 1EL5A 2V61A 4U8MA 4B68A 1JU2A 3ATRA 4OPCA 1E7PA 4A6NA 1GOSA 2EQ7A 1IUVA 4YSHA 1OJTA 1L9EA 3NGCX 1MO9A 2RGJA 2WOVA 3F8DA 3IC9A 1BKWA 4TM3A 4USQA 1S3EA 4YSZA 3O0HA 1M1RA 5BVAA 4J31A 2E1MA 3NN6X 1GU6A 5BUKA 2ZZ0A 3SY4A 3LXDA 3IWAA 3ALLA 3BNHA 3HYWA 1D7YA 3FMWA 4OPGA 4YKFA 1P2EA 3VQRA 4A99A 3F29A 1YY5A 1QDBA 2HQMA 4I58A 1DOEA 2GQWA 4A7AA 1P2HA 2C72A 1OJCA 2NVKX 3NYEA 4BK2A 3SFDA 3UKPA 2BC0A 1OJDA 3NN0X 3IHMA 5M10A 4CCQA 4B63A 2V60A 4EMWA 2R46A 3R9UA 3GD3A 4K8DA 3UBRA 3GD4A 5U63A 4GR1A 1KNRA 1REOA 1JRYA 3TTBA 2X50A 5M0ZA 4JN9A 4IA6A 3SGLA 3VR9A 1S3BA 3H8LA 4Z25A 3B6DA 2ZO5A 2CDUA 3KVEA 1O5WA 2YG5A 4WJYA 2J3NA 1CF3A 2VVMA 2C65A 4K2XA 3IHGA 2RF7A 2WBAA 3AEEA 1B5QA 1FCDA 1GTEA 2WEUA 1H81A 2Q7VA 2QA2A 1GREA 1JRXA 2ZZBA 4GAPA 4X9MA 1GALA 4FX9A 1GRHA 3DJJA 1BGNA 2BXRA 3PO7A 4N9XA 1S2YA 4II2A 4JNAA 1F3PA 1D4CA 2WPFA 3CGDA 4G74A 1IUWA 2VZ2A 5HY5A 2B9XA 4U2TA 5EOWA 2XLSA 3T2KA 1SEZA 3AB1A 1IUUA 3AEDA 4KPRA 1SP3A 3NLCA 3DJDA 1D4EA 2BRAA 1UKVG 2YG4A 5EB5A 3H8IA 2AAQA 1ZK7A 4YTNA 2PHHA 3AD7B 3ALMA 3L8KA 3QJ4A 2XVHA 3T0KA 4ZN0A 2VOUA 2FJEA 1GRFA 2WP6A 3UKFA 3H4KA 2JB1A 1NHSA 3K30A 1GRAA 1GTHA 4OPTA 3VRAA 3AYLA 4H2NA 3URHA 4B66A 3BNFA 4CNJA 2XLTA 4G9KA 2C75A 4M52A 1ZOYA 4DNAA 3CMMA 3ATQA 4U8PA 4Q1OA 3C4AA 4HB9A 1JNRA 4H4QA 4PAAA 3SFEA 4Y4LA 4JY3A 2BS3A 3CNDA 4H2PA 2AR8A 4H4PA 5C2TA 2GH5A 2YLZA 3NH3X 3WE0A 5KOXA 3S7WA 2XVIA 3GSIA 2DKHA 1Q1RA 1CC2A 1ELIA 1MXTA 2C3CA 3LZWA 1BZLA 3JSKA 2VVLA 4FDCB 2X3NA 4G6HA 4BK1A 3P4RA 1FT5A 4WX1A 1BF3A 3K7TA 3GWFA 1M64A 1JNIA 1NEKA 1PHHA 4H2RA 4XWRA 2GV8A 1KDGA 4J33A 1L9CA 3NNEA 3P4SA 3F8PA 1CL0A 2JKCA 1GRTA 4HA6A 3LG1A 2C76A 4UDQA 2XFPA 1YQ3A 1N4WA 4H4XA 4CY6A 1PDHA 1F6MA 3T31A 4YTPA 5GSNA 2BA9A 4EIQA 2RGOA 3ICRA 4X4JA 2Q6UA 4AT2A 3VRDB 2CVJA 2BRYA 2RGHA 2YM1A 3GDPA 3QFAA 4H4WA 1GSNA 4C5OA 4K22A 3TORA 1Q1WA 3Q6JA 2C4CA 3AECA 5CQFA 3QFBA 2WU5A 3FBSA 1KFYA 4J34A 4E0VA 2WU2A 1EL7A 2WDQA 4NTCA 3F8RA 2VR0A 2ZBWA 3HYVA 3M13A 1QLBA 2X8CA 3GM6A 1GRGA 1H6VA 4Z2RA 1YKJA 4U8JA 3G5QA 1BWCA 1DODA 2YM2A 3NYFA 3LOVA 3SZFA 2OT4A 5U25A 3NK2X 2R9ZA 3FPZA 3SYIA 1ONFA 2XDOA 3ZYXA 3UKAA 2Z5XA 2RDZA 3KA7A 5JCIA 1GPEA 2BS4A 3AE7A 3UU9A 4EMJA 3CGEA 3UOXA 2E5VA 3GMCA 3LADA 2B7SA 3GYJA 4AOSA 5BRTA 1DJQA 2XLRA 2YVGA 3PS9A 1EBDA 2GQFA 2YR5A 1IUXA 3NG7X 4Z2TA 1PXBA 1FEAA 1E1LA 3IF9A 1FEBA 1ZKQA 2AQJA 2VRMA 2Z5YA 3Q9TA 3CPIG 4AOXA 2UZZA 4NTDA 1OJAA 5KXJA 3CTYA 1LV0A 4GUVA 1PXAA 2YR6A 4APNA 1Y0PA 1CJ4A 1M1QA 1RSGA 4JNQA 3T37A 4NNJA 1V59A 3HZLA 3II4A 4U8IA 3GYXA 1TYTA 3REDA 1COYA 3E1TA 3KPFA 3CNTA 4GAVA 4J56A 2XCGA 4Q5CA 3C96A 2X99A 3ADAB 2APGA 2QAEA 3ISHA 1LJ1A 1E6EA 1NDAA 1IUSA 3RHAA 5HXIA 4YXDA 4D03A 4H4SA 3ICSA 5DBJA 1K0IA 5KMRA 4Y4NA 2WP9A 2WPEA 4H4UA 1FOHA 3AD8B 1NENA 3SXIA 2OAMA 4NEWA 4U2LA 3UKLA 2YLXA 1LQTA 3BI4A 5U1OA 3NT6A 5KMQA 2CFYA
chains in the Genus database with same CATH topology
3QSSA 3KPKA 1M6IA 4Y4MA 4B64A 4IVMB 5KWFA 3AE9A 1S2QA 3ICTA 4LU6A 2VQ7A 4ICYA 4U2SA 4DSGA 1PBBA 1FS9A 1FS8A 5CKUA 1PJ5A 1VQWA 2R0GA 3GDNA 2YLWA 3T2YA 1Z6LA 5FS7A 1IUTA 3BI2A 4CRTA 5LV9A 3FIMB 3UP5A 2E4GA 1K4QA 3DK4A 3BHFA 1VDCA 1BVBA 3K7QX 4ZCDA 4O5QA 1AOGA 1B8SA 2GR2A 3CNPA 3GRTA 4RG4A 4EMIA 1KSSA 4GDPA 1NHRA 2V3AA 3AXBA 3DMEA 4P9SA 5KVIA 1IJHA 1F8WA 4X9NA 2ARDA 3HYXA 4J57A 3DGHA 1N4VA 2K3VA 2GEWA 3GRSA 1MOKA 5KOWA 2FJAA 2Y6RA 2WQYA 1M1PA 2JAEA 3DK8A 1CBOA 2J7AA 1O95A 4K5SA 4NTEA 1GV4A 3FO3A 1PBFA 3CGCA 1GERA 4OVIA 5EBKA 1LTXR 4Q0TA 2GMHA 4JQ9A 5KMPA 3UOVA 4YT0A 4WCTA 3L1RA 3BNGA 4A65A 4UDRA 1CJ2A 4D04A 3M12A 4AP3A 3VR8A 5JCNA 5FS8A 3I6DA 3AYJA 1LVLA 2VQBA 5C3JA 1NPXA 1FECA 1L0VA 4Q4UA 4J2WA 2WDVA 2PYXA 1E39A 3UKKA 4YKGA 2EQ9A 2VRLA 4GRTA 1PJ6A 3RNMA 1RP0A 3NRNA 3M0OA 2XLUA 3AEGA 3G5SA 5J7XA 5J60A 4LA1A 2V6OA 4BV6A 4O5UA 1NHPA 1CJCA 1K0LA 1NG4A 1F8RA 5EB4A 4Z24A 4JDRA 2B7RA 1D7LA 2IVDA 3V3NA 3AE8A 4EQXA 4EQRA 4U8LA 4EIPA 1Y56A 1PJ7A 2OA1A 3SX6A 1E1KA 4C77A 2BABA 1OAHA 1DJNA 2R0PA 1D4DA 1X31B 4Q5BA 4L38A 4Q17A 1GXFA 5HHFA 2GR3A 3G5RA 3SXQA 5FMHA 4TM0A 4FK1A 2BYBA 2F5ZA 2YVJA 5TR3A 3OWMA 2XFQA 2I0ZA 3AEFA 4OPLA 4Z43A 1CC6A 3P9UA 1XDIA 4C74A 1N1PA 1PN0A 2QCUA 4C3YA 3SQPA 3CN8A 2C73A 4GF7A 3UTFA 1H7XA 2A8XA 3BNJA 2Q0LA 4TM4A 2WHDA 2Y6QA 2X8GA 1TYPA 2R4JA 1OJ9A 1H83A 5KRQA 4TM1A 3UP4A 4OPDA 3UTGA 2JBVA 4II3A 3P4QA 4REKA 1E1MA 2YG6A 1XHCA 3MMOA 1DNCA 3BI5A 4A79A 5KNLA 2JK6A 3UKQA 3AD9B 1RYIA 4OPIA 3P1WA 3OC4A 1B37A 1PBEA 1H84A 4USRA 3ZDNA 5KVHA 2BACA 1TDEA 4YTMA 3LZXA 2GB0A 4TLZA 3SZ0A 4K7ZA 3KU9A 3UTEA 4NEVA 4GCMA 4H2QA 1ZY8A 1DOCA 2WP5A 3T14A 2C67A 4U8OA 3AE2A 3RP8A 2TMDA 3C4NA 2GR0A 2VVLG 2YVFA 3D8XA 2YLRA 3NHOX 5IPYA 1DOBA 4G73A 5L46A 2GVCA 1ZMDA 2WOIA 3KKJA 4YWOA 2XFUA 4OPUA 4B65A 3QSMA 2WDRA 4IA5A 4C3XA 3S5WA 2V5ZA 2YG3A 4H4TA 2BCGG 1O94A 2C7GA 1D5TA 2R4EA 4H7UA 1PS9A 2GAHB 2XVJA 3BNUA 1EL8A 3NKSA 3OZ2A 4B1BA 4U8NA 5IQ4A 1GEUA 3GYIA 4Z2UA 1CJ3A 1HYUA 3AYIA 2C64A 4FK1C 1NAAA 1PBCA 5ER0A 2YG7A 3ALJA 3VRBA 1GNDA 1GRBA 3I3LA 2W0HA 1JRZA 3S61A 3QSEA 2BS2A 2YAUA 1DXLA 2JB2A 1EL9A 4U8KA 1L9DA 1JOAA 4XXGA 4ADWA 2GF3A 2E80A 1JNZA 4PABA 3KLJA 4AT0A 3SM8A 2BXSA 1GT8A 1FL2A 1FS7A 3AE3A 5FS6A 4TLXA 4RG3A 2EQ8A 2A87A 3DA1A 4ZCCA 3SZCA 1BGJA 2FJBA 2IIDA 3NK1X 2DKIA 3CIRA 1LQUA 2A89A 1NG3A 3BHKA 1VG9A 3CGBA 3RP6A 3EPTA 3UKHA 4DGKA 1H7WA 3NIXA 3GWDA 2Q0KA 3KD9A 4CY8A 3AE5A 3ITJA 2E81A 1ZP0A 2XVFA 1TDKA 4LIIA 2XLPA 4UP3A 3AWIA 4NZHA 3COXA 3NYCA 5FS9A 2WPCA 1GESA 2GRTA 4GDEA 5GRTA 1Y56B 4ECHA 3SZWA 1JEHA 2EQ6A 1QO8A 2BCPA 4H50A 4J36A 2V3BA 3UCLA 1VRQB 5JCKA 2OALA 2XFNA 2OLOA 4JY2A 3GMBA 2JB3A 4OCGA 2WETA 4B67A 3D1CA 4I59A 2C3DA 2B9YA 1QJDA 4CBQA 2C66A 3QVPA 1PXCA 4BK3A 3EANA 2ZZCA 1ZOVA 4H4RA 3V76A 1ZMCA 4A9WA 4Z26A 3B3RA 2WOWA 4MJWA 3AE1A 4EM4A 2CULA 4B69A 2LFCA 2H89A 4A5LA 4IVOB 1NHQA 3DK9A 4EM3A 1E1NA 5JCMA 2BK3A 3QVRA 4H4ZA 3DGZA 3BNMA 2GMJA 4IV9A 4CNKA 2XYOA 2RABA 3LB8A 3ABVA 1FT6A 1H86A 2BK5A 3CPJG 2FJDA 3LGQA 2QA1A 2X8HA 3T2ZA 2IVEA 1TDFA 1TRBA 3AE4A 1CHUA 4CCRA 3NK0X 3K7MX 4Z44A 1TDNA 4BJYA 1YQ4A 4YSXA 1KNPA 1Q9IA 3AE6A 3L1TA 2O9ZA 2YQUA 2B9WA 3SCEA 2GAGB 1XANA 2FBWA 3DJEA 2YR4A 3D1IA 4G6GA 3AEBA 2R0CA 3NTDA 2C70A 1YQZA 2ACZA 4XWZA 2XFOA 2B76A 3RKHA 4EQWA 3CNSA 1KSUA 4A6NB 3RP7A 2XVEA 1TDOA 1ZDLA 1PBDA 1GETA 2TPRA 5IQ1A 4L3XA 4K5RA 2R45A 2BK4A 1H82A 3UOYA 3DJGX 1CC4A 1VG0A 4L3ZA 4L3YA 2WS3A 3PVCA 4BJZA 3EAOA 1XPQA 3DH9A 4EQSA 4H4VA 1N4UA 1B4VA 1K0JA 2OLNA 3P4PA 2YLTA 4RSLA 1ZX9A 2YLSA 3EF6A 4H4YA 3UOZA 3UTHA 4KX6A 4YSYA 4NWZA 4DSHA 5KMSA 4BURA 2BC1A 2H88A 2YWLA 2GR1A 1F8SA 3CNJA 3CPHG 3AEAA 4UDPA 1W4XA 2WESA 3FG2P 2NPXA 1LPFA 5HYMA 5BULA 3LJPA 3NTAA 4AP1A 5JCLA 1KF6A 3V3OA 1EL5A 2V61A 4U8MA 4B68A 1JU2A 3ATRA 4OPCA 1E7PA 4A6NA 1GOSA 2EQ7A 1IUVA 4YSHA 1OJTA 1L9EA 3NGCX 1MO9A 2RGJA 2WOVA 3F8DA 3IC9A 1BKWA 4TM3A 4USQA 1S3EA 4YSZA 3O0HA 1M1RA 5BVAA 4J31A 2E1MA 3NN6X 1GU6A 5BUKA 2ZZ0A 3SY4A 3LXDA 3IWAA 3ALLA 3BNHA 3HYWA 1D7YA 3FMWA 4OPGA 4YKFA 1P2EA 3VQRA 4A99A 3F29A 1YY5A 1QDBA 2HQMA 4I58A 1DOEA 2GQWA 4A7AA 1P2HA 2C72A 1OJCA 2NVKX 3NYEA 4BK2A 3SFDA 3UKPA 2BC0A 1OJDA 3NN0X 3IHMA 5M10A 4CCQA 4B63A 2V60A 4EMWA 2R46A 3R9UA 3GD3A 4K8DA 3UBRA 3GD4A 5U63A 4GR1A 1KNRA 1REOA 1JRYA 3TTBA 2X50A 5M0ZA 4JN9A 4IA6A 3SGLA 3VR9A 1S3BA 3H8LA 4Z25A 3B6DA 2ZO5A 2CDUA 3KVEA 1O5WA 2YG5A 4WJYA 2J3NA 1CF3A 2VVMA 2C65A 4K2XA 3IHGA 2RF7A 2WBAA 3AEEA 1B5QA 1FCDA 1GTEA 2WEUA 1H81A 2Q7VA 2QA2A 1GREA 1JRXA 2ZZBA 4GAPA 4X9MA 1GALA 4FX9A 1GRHA 3DJJA 1BGNA 2BXRA 3PO7A 4N9XA 1S2YA 4II2A 4JNAA 1F3PA 1D4CA 2WPFA 3CGDA 4G74A 1IUWA 2VZ2A 5HY5A 2B9XA 4U2TA 5EOWA 2XLSA 3T2KA 1SEZA 3AB1A 1IUUA 3AEDA 4KPRA 1SP3A 3NLCA 3DJDA 1D4EA 2BRAA 1UKVG 2YG4A 5EB5A 3H8IA 2AAQA 1ZK7A 4YTNA 2PHHA 3AD7B 3ALMA 3L8KA 3QJ4A 2XVHA 3T0KA 4ZN0A 2VOUA 2FJEA 1GRFA 2WP6A 3UKFA 3H4KA 2JB1A 1NHSA 3K30A 1GRAA 1GTHA 4OPTA 3VRAA 3AYLA 4H2NA 3URHA 4B66A 3BNFA 4CNJA 2XLTA 4G9KA 2C75A 4M52A 1ZOYA 4DNAA 3CMMA 3ATQA 4U8PA 4Q1OA 3C4AA 4HB9A 1JNRA 4H4QA 4PAAA 3SFEA 4Y4LA 4JY3A 2BS3A 3CNDA 4H2PA 2AR8A 4H4PA 5C2TA 2GH5A 2YLZA 3NH3X 3WE0A 5KOXA 3S7WA 2XVIA 3GSIA 2DKHA 1Q1RA 1CC2A 1ELIA 1MXTA 2C3CA 3LZWA 1BZLA 3JSKA 2VVLA 4FDCB 2X3NA 4G6HA 4BK1A 3P4RA 1FT5A 4WX1A 1BF3A 3K7TA 3GWFA 1M64A 1JNIA 1NEKA 1PHHA 4H2RA 4XWRA 2GV8A 1KDGA 4J33A 1L9CA 3NNEA 3P4SA 3F8PA 1CL0A 2JKCA 1GRTA 4HA6A 3LG1A 2C76A 4UDQA 2XFPA 1YQ3A 1N4WA 4H4XA 4CY6A 1PDHA 1F6MA 3T31A 4YTPA 5GSNA 2BA9A 4EIQA 2RGOA 3ICRA 4X4JA 2Q6UA 4AT2A 3VRDB 2CVJA 2BRYA 2RGHA 2YM1A 3GDPA 3QFAA 4H4WA 1GSNA 4C5OA 4K22A 3TORA 1Q1WA 3Q6JA 2C4CA 3AECA 5CQFA 3QFBA 2WU5A 3FBSA 1KFYA 4J34A 4E0VA 2WU2A 1EL7A 2WDQA 4NTCA 3F8RA 2VR0A 2ZBWA 3HYVA 3M13A 1QLBA 2X8CA 3GM6A 1GRGA 1H6VA 4Z2RA 1YKJA 4U8JA 3G5QA 1BWCA 1DODA 2YM2A 3NYFA 3LOVA 3SZFA 2OT4A 5U25A 3NK2X 2R9ZA 3FPZA 3SYIA 1ONFA 2XDOA 3ZYXA 3UKAA 2Z5XA 2RDZA 3KA7A 5JCIA 1GPEA 2BS4A 3AE7A 3UU9A 4EMJA 3CGEA 3UOXA 2E5VA 3GMCA 3LADA 2B7SA 3GYJA 4AOSA 5BRTA 1DJQA 2XLRA 2YVGA 3PS9A 1EBDA 2GQFA 2YR5A 1IUXA 3NG7X 4Z2TA 1PXBA 1FEAA 1E1LA 3IF9A 1FEBA 1ZKQA 2AQJA 2VRMA 2Z5YA 3Q9TA 3CPIG 4AOXA 2UZZA 4NTDA 1OJAA 5KXJA 3CTYA 1LV0A 4GUVA 1PXAA 2YR6A 4APNA 1Y0PA 1CJ4A 1M1QA 1RSGA 4JNQA 3T37A 4NNJA 1V59A 3HZLA 3II4A 4U8IA 3GYXA 1TYTA 3REDA 1COYA 3E1TA 3KPFA 3CNTA 4GAVA 4J56A 2XCGA 4Q5CA 3C96A 2X99A 3ADAB 2APGA 2QAEA 3ISHA 1LJ1A 1E6EA 1NDAA 1IUSA 3RHAA 5HXIA 4YXDA 4D03A 4H4SA 3ICSA 5DBJA 1K0IA 5KMRA 4Y4NA 2WP9A 2WPEA 4H4UA 1FOHA 3AD8B 1NENA 3SXIA 2OAMA 4NEWA 4U2LA 3UKLA 2YLXA 1LQTA 3BI4A 5U1OA 3NT6A 5KMQA 2CFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSS A;  1M6I A;  4Y4M A;  4B64 A;  4IVM B;  5KWF A;  3AE9 A;  1S2Q A;  3ICT A;  4LU6 A;  2VQ7 A;  4ICY A;  4U2S A;  4DSG A;  1PBB A;  1FS9 A;  1FS8 A;  5CKU A;  1PJ5 A;  1VQW A;  2R0G A;  3GDN A;  2YLW A;  1Z6L A;  1IUT A;  3BI2 A;  4CRT A;  5LV9 A;  3FIM B;  3UP5 A;  2E4G A;  1K4Q A;  3DK4 A;  3BHF A;  1VDC A;  1BVB A;  3K7Q X;  4ZCD A;  4O5Q A;  1AOG A;  1B8S A;  2GR2 A;  3CNP A;  3GRT A;  4RG4 A;  4EMI A;  1KSS A;  4GDP A;  1NHR A;  2V3A A;  3AXB A;  3DME A;  4P9S A;  5KVI A;  1IJH A;  1F8W A;  4X9N A;  2ARD A;  4J57 A;  3DGH A;  1N4V A;  2K3V A;  2GEW A;  3GRS A;  1MOK A;  5KOW A;  2FJA A;  2Y6R A;  2WQY A;  1M1P A;  2JAE A;  3DK8 A;  1CBO A;  2J7A A;  1O95 A;  4K5S A;  4NTE A;  1GV4 A;  3FO3 A;  1PBF A;  3CGC A;  1GER A;  4OVI A;  5EBK A;  1LTX R;  4Q0T A;  2GMH A;  4JQ9 A;  3UOV A;  4YT0 A;  4WCT A;  3L1R A;  3BNG A;  4A65 A;  4UDR A;  1CJ2 A;  4D04 A;  3M12 A;  4AP3 A;  3VR8 A;  5JCN A;  5FS8 A;  3I6D A;  3AYJ A;  1LVL A;  2VQB A;  5C3J A;  1NPX A;  1FEC A;  1L0V A;  4Q4U A;  4J2W A;  2WDV A;  2PYX A;  1E39 A;  3UKK A;  4YKG A;  2EQ9 A;  2VRL A;  4GRT A;  1PJ6 A;  3RNM A;  1RP0 A;  3NRN A;  3M0O A;  2XLU A;  3AEG A;  3G5S A;  5J7X A;  5J60 A;  4LA1 A;  2V6O A;  4BV6 A;  4O5U A;  1NHP A;  1CJC A;  1K0L A;  1NG4 A;  1F8R A;  5EB4 A;  4Z24 A;  4JDR A;  2B7R A;  1D7L A;  2IVD A;  3V3N A;  3AE8 A;  4EQX A;  4EQR A;  4U8L A;  4EIP A;  1Y56 A;  1PJ7 A;  2OA1 A;  1E1K A;  4C77 A;  2BAB A;  1OAH A;  1DJN A;  2R0P A;  1D4D A;  1X31 B;  4Q5B A;  4L38 A;  4Q17 A;  1GXF A;  5HHF A;  2GR3 A;  3G5R A;  3SXQ A;  5FMH A;  4TM0 A;  4FK1 A;  2BYB A;  2F5Z A;  2YVJ A;  5TR3 A;  3OWM A;  2XFQ A;  2I0Z A;  3AEF A;  4OPL A;  4Z43 A;  1CC6 A;  3P9U A;  1XDI A;  4C74 A;  1N1P A;  1PN0 A;  2QCU A;  4C3Y A;  3SQP A;  3CN8 A;  2C73 A;  4GF7 A;  3UTF A;  1H7X A;  2A8X A;  3BNJ A;  2Q0L A;  4TM4 A;  2WHD A;  2Y6Q A;  2X8G A;  1TYP A;  2R4J A;  1OJ9 A;  1H83 A;  5KRQ A;  4TM1 A;  3UP4 A;  4OPD A;  3UTG A;  2JBV A;  3P4Q A;  4REK A;  1E1M A;  2YG6 A;  1XHC A;  3MMO A;  1DNC A;  3BI5 A;  4A79 A;  2JK6 A;  3UKQ A;  3AD9 B;  1RYI A;  4OPI A;  3P1W A;  3OC4 A;  1B37 A;  1PBE A;  1H84 A;  4USR A;  3ZDN A;  5KVH A;  2BAC A;  1TDE A;  4YTM A;  3LZX A;  2GB0 A;  4TLZ A;  4K7Z A;  3KU9 A;  3UTE A;  4NEV A;  4GCM A;  4H2Q A;  1ZY8 A;  1DOC A;  2WP5 A;  2C67 A;  4U8O A;  3AE2 A;  3RP8 A;  2TMD A;  3C4N A;  2GR0 A;  2VVL G;  2YVF A;  3D8X A;  2YLR A;  3NHO X;  5IPY A;  1DOB A;  5L46 A;  2GVC A;  1ZMD A;  2WOI A;  3KKJ A;  4YWO A;  2XFU A;  4OPU A;  4B65 A;  3QSM A;  2WDR A;  4IA5 A;  4C3X A;  3S5W A;  2V5Z A;  2YG3 A;  4H4T A;  2BCG G;  1O94 A;  2C7G A;  1D5T A;  2R4E A;  4H7U A;  1PS9 A;  2GAH B;  2XVJ A;  3BNU A;  1EL8 A;  3NKS A;  3OZ2 A;  4B1B A;  4U8N A;  5IQ4 A;  1GEU A;  3GYI A;  4Z2U A;  1CJ3 A;  1HYU A;  3AYI A;  2C64 A;  4FK1 C;  1NAA A;  1PBC A;  5ER0 A;  2YG7 A;  3ALJ A;  3VRB A;  1GND A;  1GRB A;  3I3L A;  2W0H A;  1JRZ A;  3S61 A;  3QSE A;  2BS2 A;  2YAU A;  1DXL A;  2JB2 A;  1EL9 A;  4U8K A;  1L9D A;  1JOA A;  4XXG A;  4ADW A;  2GF3 A;  2E80 A;  1JNZ A;  4PAB A;  3KLJ A;  4AT0 A;  3SM8 A;  2BXS A;  1GT8 A;  1FL2 A;  1FS7 A;  3AE3 A;  5FS6 A;  4TLX A;  4RG3 A;  2EQ8 A;  2A87 A;  3DA1 A;  4ZCC A;  1BGJ A;  2FJB A;  2IID A;  3NK1 X;  2DKI A;  3CIR A;  1LQU A;  2A89 A;  1NG3 A;  3BHK A;  1VG9 A;  3CGB A;  3RP6 A;  3EPT A;  3UKH A;  4DGK A;  1H7W A;  3NIX A;  3GWD A;  2Q0K A;  3KD9 A;  4CY8 A;  3AE5 A;  3ITJ A;  2E81 A;  1ZP0 A;  2XVF A;  1TDK A;  4LII A;  2XLP A;  4UP3 A;  3AWI A;  4NZH A;  3COX A;  3NYC A;  5FS9 A;  2WPC A;  1GES A;  2GRT A;  4GDE A;  5GRT A;  1Y56 B;  4ECH A;  1JEH A;  2EQ6 A;  1QO8 A;  2BCP A;  4H50 A;  4J36 A;  2V3B A;  3UCL A;  1VRQ B;  5JCK A;  2OAL A;  2XFN A;  2OLO A;  4JY2 A;  3GMB A;  2JB3 A;  4OCG A;  2WET A;  4B67 A;  3D1C A;  4I59 A;  2C3D A;  2B9Y A;  1QJD A;  4CBQ A;  2C66 A;  3QVP A;  1PXC A;  4BK3 A;  3EAN A;  2ZZC A;  1ZOV A;  4H4R A;  3V76 A;  1ZMC A;  4A9W A;  4Z26 A;  3B3R A;  2WOW A;  4MJW A;  3AE1 A;  4EM4 A;  2CUL A;  4B69 A;  2LFC A;  2H89 A;  4A5L A;  4IVO B;  1NHQ A;  3DK9 A;  4EM3 A;  1E1N A;  5JCM A;  2BK3 A;  3QVR A;  4H4Z A;  3DGZ A;  3BNM A;  2GMJ A;  4IV9 A;  4CNK A;  2XYO A;  2RAB A;  3LB8 A;  3ABV A;  1FT6 A;  1H86 A;  2BK5 A;  3CPJ G;  2FJD A;  3LGQ A;  2QA1 A;  2X8H A;  2IVE A;  1TDF A;  1TRB A;  3AE4 A;  1CHU A;  4CCR A;  3NK0 X;  3K7M X;  4Z44 A;  1TDN A;  4BJY A;  1YQ4 A;  4YSX A;  1KNP A;  1Q9I A;  3AE6 A;  3L1T A;  2O9Z A;  2YQU A;  2B9W A;  3SCE A;  2GAG B;  1XAN A;  2FBW A;  3DJE A;  2YR4 A;  3D1I A;  3AEB A;  2R0C A;  3NTD A;  2C70 A;  1YQZ A;  2ACZ A;  4XWZ A;  2XFO A;  2B76 A;  3RKH A;  4EQW A;  3CNS A;  1KSU A;  4A6N B;  3RP7 A;  2XVE A;  1TDO A;  1ZDL A;  1PBD A;  1GET A;  2TPR A;  5IQ1 A;  4L3X A;  4K5R A;  2R45 A;  2BK4 A;  1H82 A;  3UOY A;  3DJG X;  1CC4 A;  1VG0 A;  4L3Z A;  4L3Y A;  2WS3 A;  3PVC A;  4BJZ A;  3EAO A;  1XPQ A;  3DH9 A;  4EQS A;  4H4V A;  1N4U A;  1B4V A;  1K0J A;  2OLN A;  3P4P A;  2YLT A;  4RSL A;  1ZX9 A;  2YLS A;  3EF6 A;  4H4Y A;  3UOZ A;  3UTH A;  4KX6 A;  4YSY A;  4DSH A;  4BUR A;  2BC1 A;  2H88 A;  2YWL A;  2GR1 A;  1F8S A;  3CNJ A;  3CPH G;  3AEA A;  4UDP A;  1W4X A;  2WES A;  3FG2 P;  2NPX A;  1LPF A;  5HYM A;  5BUL A;  3LJP A;  3NTA A;  4AP1 A;  5JCL A;  1KF6 A;  3V3O A;  1EL5 A;  2V61 A;  4U8M A;  4B68 A;  1JU2 A;  3ATR A;  4OPC A;  1E7P A;  4A6N A;  1GOS A;  2EQ7 A;  1IUV A;  4YSH A;  1OJT A;  1L9E A;  3NGC X;  1MO9 A;  2RGJ A;  2WOV A;  3F8D A;  3IC9 A;  1BKW A;  4TM3 A;  4USQ A;  1S3E A;  4YSZ A;  3O0H A;  1M1R A;  5BVA A;  4J31 A;  2E1M A;  3NN6 X;  1GU6 A;  5BUK A;  2ZZ0 A;  3LXD A;  3IWA A;  3ALL A;  3BNH A;  1D7Y A;  3FMW A;  4OPG A;  4YKF A;  1P2E A;  3VQR A;  4A99 A;  3F29 A;  1YY5 A;  1QDB A;  2HQM A;  4I58 A;  1DOE A;  2GQW A;  4A7A A;  1P2H A;  2C72 A;  1OJC A;  2NVK X;  3NYE A;  4BK2 A;  3SFD A;  3UKP A;  2BC0 A;  1OJD A;  3NN0 X;  3IHM A;  5M10 A;  4CCQ A;  4B63 A;  2V60 A;  4EMW A;  2R46 A;  3R9U A;  3GD3 A;  4K8D A;  3UBR A;  3GD4 A;  5U63 A;  4GR1 A;  1KNR A;  1REO A;  1JRY A;  3TTB A;  2X50 A;  5M0Z A;  4JN9 A;  4IA6 A;  3SGL A;  3VR9 A;  1S3B A;  3H8L A;  4Z25 A;  3B6D A;  2ZO5 A;  2CDU A;  3KVE A;  1O5W A;  2YG5 A;  4WJY A;  2J3N A;  1CF3 A;  2VVM A;  2C65 A;  4K2X A;  3IHG A;  2RF7 A;  2WBA A;  3AEE A;  1B5Q A;  1FCD A;  1GTE A;  2WEU A;  1H81 A;  2Q7V A;  2QA2 A;  1GRE A;  1JRX A;  2ZZB A;  4X9M A;  5FS7 A;  1GAL A;  4FX9 A;  1GRH A;  3DJJ A;  1BGN A;  2BXR A;  3PO7 A;  4N9X A;  1S2Y A;  4JNA A;  1F3P A;  1D4C A;  2WPF A;  3CGD A;  1IUW A;  2VZ2 A;  5HY5 A;  2B9X A;  4U2T A;  5EOW A;  2XLS A;  1SEZ A;  3AB1 A;  1IUU A;  3AED A;  4KPR A;  1SP3 A;  3NLC A;  3DJD A;  1D4E A;  2YG4 A;  1UKV G;  5EB5 A;  3H8I A;  2AAQ A;  1ZK7 A;  4YTN A;  2PHH A;  3AD7 B;  3ALM A;  3L8K A;  3QJ4 A;  2XVH A;  4ZN0 A;  2VOU A;  2FJE A;  1GRF A;  2WP6 A;  3UKF A;  3H4K A;  2JB1 A;  1NHS A;  3K30 A;  1GRA A;  1GTH A;  4OPT A;  3VRA A;  3AYL A;  4H2N A;  3URH A;  4B66 A;  3BNF A;  4CNJ A;  2XLT A;  2C75 A;  4M52 A;  1ZOY A;  4DNA A;  3ATQ A;  4U8P A;  4Q1O A;  3C4A A;  4HB9 A;  1JNR A;  4H4Q A;  4PAA A;  3SFE A;  4Y4L A;  4JY3 A;  2BS3 A;  3CND A;  4H2P A;  2AR8 A;  4H4P A;  5C2T A;  2GH5 A;  2YLZ A;  3NH3 X;  3WE0 A;  5KOX A;  3S7W A;  2XVI A;  3GSI A;  2DKH A;  1Q1R A;  1CC2 A;  1ELI A;  1MXT A;  2C3C A;  3LZW A;  1BZL A;  3JSK A;  2VVL A;  4FDC B;  2X3N A;  4BK1 A;  3P4R A;  1FT5 A;  4WX1 A;  1BF3 A;  3K7T A;  3GWF A;  1M64 A;  1JNI A;  1NEK A;  1PHH A;  4H2R A;  4XWR A;  2GV8 A;  1KDG A;  4J33 A;  1L9C A;  3NNE A;  3P4S A;  3F8P A;  1CL0 A;  2JKC A;  1GRT A;  4HA6 A;  3LG1 A;  2C76 A;  4UDQ A;  2XFP A;  1YQ3 A;  1N4W A;  4H4X A;  4CY6 A;  1PDH A;  1F6M A;  4YTP A;  5GSN A;  2BA9 A;  4EIQ A;  2RGO A;  3ICR A;  4X4J A;  2Q6U A;  4AT2 A;  3VRD B;  2CVJ A;  2RGH A;  2YM1 A;  3GDP A;  4H4W A;  3QFA A;  1GSN A;  4C5O A;  4K22 A;  3TOR A;  1Q1W A;  3Q6J A;  3AEC A;  5CQF A;  3QFB A;  2WU5 A;  3FBS A;  1KFY A;  4J34 A;  4E0V A;  2WU2 A;  1EL7 A;  2WDQ A;  4NTC A;  3F8R A;  2VR0 A;  2ZBW A;  4Z2R A;  3M13 A;  1QLB A;  2X8C A;  3GM6 A;  1GRG A;  1H6V A;  1YKJ A;  4U8J A;  3G5Q A;  1BWC A;  1DOD A;  2YM2 A;  3NYF A;  3LOV A;  2OT4 A;  5U25 A;  3NK2 X;  2R9Z A;  3FPZ A;  1ONF A;  2XDO A;  3ZYX A;  3UKA A;  2Z5X A;  2RDZ A;  3KA7 A;  5JCI A;  1GPE A;  2BS4 A;  3AE7 A;  3UU9 A;  4EMJ A;  3CGE A;  3UOX A;  2E5V A;  3GMC A;  3LAD A;  2B7S A;  3GYJ A;  4AOS A;  5BRT A;  1DJQ A;  2XLR A;  2YVG A;  3PS9 A;  1EBD A;  2GQF A;  2YR5 A;  1IUX A;  3NG7 X;  4Z2T A;  1PXB A;  1FEA A;  1E1L A;  3IF9 A;  1FEB A;  1ZKQ A;  2AQJ A;  2VRM A;  2Z5Y A;  3Q9T A;  3CPI G;  4AOX A;  2UZZ A;  4NTD A;  1OJA A;  5KXJ A;  3CTY A;  1LV0 A;  4GUV A;  1PXA A;  2YR6 A;  4APN A;  1Y0P A;  1CJ4 A;  1M1Q A;  1RSG A;  4JNQ A;  3T37 A;  1V59 A;  3HZL A;  3II4 A;  4U8I A;  3GYX A;  1TYT A;  3RED A;  1COY A;  3E1T A;  3KPF A;  3CNT A;  4J56 A;  2XCG A;  4Q5C A;  3C96 A;  2X99 A;  3ADA B;  2APG A;  2QAE A;  3ISH A;  1LJ1 A;  1E6E A;  1NDA A;  1IUS A;  3RHA A;  5HXI A;  4YXD A;  4D03 A;  4H4S A;  3ICS A;  5DBJ A;  1K0I A;  4Y4N A;  2WP9 A;  2WPE A;  4H4U A;  1FOH A;  3AD8 B;  1NEN A;  3UKL A;  2OAM A;  4NEW A;  4U2L A;  2YLX A;  1LQT A;  3BI4 A;  5U1O A;  3NT6 A;  2CFY A; 
#chains in the Genus database with same CATH topology
 3QSS A;  3KPK A;  1M6I A;  4Y4M A;  4B64 A;  4IVM B;  5KWF A;  3AE9 A;  1S2Q A;  3ICT A;  4LU6 A;  2VQ7 A;  4ICY A;  4U2S A;  4DSG A;  1PBB A;  1FS9 A;  1FS8 A;  5CKU A;  1PJ5 A;  1VQW A;  2R0G A;  3GDN A;  2YLW A;  3T2Y A;  1Z6L A;  5FS7 A;  1IUT A;  3BI2 A;  4CRT A;  5LV9 A;  3FIM B;  3UP5 A;  2E4G A;  1K4Q A;  3DK4 A;  3BHF A;  1VDC A;  1BVB A;  3K7Q X;  4ZCD A;  4O5Q A;  1AOG A;  1B8S A;  2GR2 A;  3CNP A;  3GRT A;  4RG4 A;  4EMI A;  1KSS A;  4GDP A;  1NHR A;  2V3A A;  3AXB A;  3DME A;  4P9S A;  5KVI A;  1IJH A;  1F8W A;  4X9N A;  2ARD A;  3HYX A;  4J57 A;  3DGH A;  1N4V A;  2K3V A;  2GEW A;  3GRS A;  1MOK A;  5KOW A;  2FJA A;  2Y6R A;  2WQY A;  1M1P A;  2JAE A;  3DK8 A;  1CBO A;  2J7A A;  1O95 A;  4K5S A;  4NTE A;  1GV4 A;  3FO3 A;  1PBF A;  3CGC A;  1GER A;  4OVI A;  5EBK A;  1LTX R;  4Q0T A;  2GMH A;  4JQ9 A;  5KMP A;  3UOV A;  4YT0 A;  4WCT A;  3L1R A;  3BNG A;  4A65 A;  4UDR A;  1CJ2 A;  4D04 A;  3M12 A;  4AP3 A;  3VR8 A;  5JCN A;  5FS8 A;  3I6D A;  3AYJ A;  1LVL A;  2VQB A;  5C3J A;  1NPX A;  1FEC A;  1L0V A;  4Q4U A;  4J2W A;  2WDV A;  2PYX A;  1E39 A;  3UKK A;  4YKG A;  2EQ9 A;  2VRL A;  4GRT A;  1PJ6 A;  3RNM A;  1RP0 A;  3NRN A;  3M0O A;  2XLU A;  3AEG A;  3G5S A;  5J7X A;  5J60 A;  4LA1 A;  2V6O A;  4BV6 A;  4O5U A;  1NHP A;  1CJC A;  1K0L A;  1NG4 A;  1F8R A;  5EB4 A;  4Z24 A;  4JDR A;  2B7R A;  1D7L A;  2IVD A;  3V3N A;  3AE8 A;  4EQX A;  4EQR A;  4U8L A;  4EIP A;  1Y56 A;  1PJ7 A;  2OA1 A;  3SX6 A;  1E1K A;  4C77 A;  2BAB A;  1OAH A;  1DJN A;  2R0P A;  1D4D A;  1X31 B;  4Q5B A;  4L38 A;  4Q17 A;  1GXF A;  5HHF A;  2GR3 A;  3G5R A;  3SXQ A;  5FMH A;  4TM0 A;  4FK1 A;  2BYB A;  2F5Z A;  2YVJ A;  5TR3 A;  3OWM A;  2XFQ A;  2I0Z A;  3AEF A;  4OPL A;  4Z43 A;  1CC6 A;  3P9U A;  1XDI A;  4C74 A;  1N1P A;  1PN0 A;  2QCU A;  4C3Y A;  3SQP A;  3CN8 A;  2C73 A;  4GF7 A;  3UTF A;  1H7X A;  2A8X A;  3BNJ A;  2Q0L A;  4TM4 A;  2WHD A;  2Y6Q A;  2X8G A;  1TYP A;  2R4J A;  1OJ9 A;  1H83 A;  5KRQ A;  4TM1 A;  3UP4 A;  4OPD A;  3UTG A;  2JBV A;  4II3 A;  3P4Q A;  4REK A;  1E1M A;  2YG6 A;  1XHC A;  3MMO A;  1DNC A;  3BI5 A;  4A79 A;  5KNL A;  2JK6 A;  3UKQ A;  3AD9 B;  1RYI A;  4OPI A;  3P1W A;  3OC4 A;  1B37 A;  1PBE A;  1H84 A;  4USR A;  3ZDN A;  5KVH A;  2BAC A;  1TDE A;  4YTM A;  3LZX A;  2GB0 A;  4TLZ A;  3SZ0 A;  4K7Z A;  3KU9 A;  3UTE A;  4NEV A;  4GCM A;  4H2Q A;  1ZY8 A;  1DOC A;  2WP5 A;  3T14 A;  2C67 A;  4U8O A;  3AE2 A;  3RP8 A;  2TMD A;  3C4N A;  2GR0 A;  2VVL G;  2YVF A;  3D8X A;  2YLR A;  3NHO X;  5IPY A;  1DOB A;  4G73 A;  5L46 A;  2GVC A;  1ZMD A;  2WOI A;  3KKJ A;  4YWO A;  2XFU A;  4OPU A;  4B65 A;  3QSM A;  2WDR A;  4IA5 A;  4C3X A;  3S5W A;  2V5Z A;  2YG3 A;  4H4T A;  2BCG G;  2CZS A;  1O94 A;  2C7G A;  1D5T A;  2R4E A;  4H7U A;  1PS9 A;  2GAH B;  2XVJ A;  3BNU A;  1EL8 A;  3NKS A;  3OZ2 A;  4B1B A;  4U8N A;  5IQ4 A;  1GEU A;  3GYI A;  4Z2U A;  1CJ3 A;  1HYU A;  3AYI A;  2C64 A;  4FK1 C;  1NAA A;  1PBC A;  5ER0 A;  2YG7 A;  3ALJ A;  3VRB A;  1GND A;  1GRB A;  3I3L A;  2W0H A;  1JRZ A;  3S61 A;  3QSE A;  2BS2 A;  2YAU A;  1DXL A;  2JB2 A;  1EL9 A;  4U8K A;  1L9D A;  1JOA A;  4XXG A;  4ADW A;  2GF3 A;  2E80 A;  1JNZ A;  4PAB A;  3KLJ A;  4AT0 A;  3SM8 A;  2BXS A;  1GT8 A;  1FL2 A;  1FS7 A;  3AE3 A;  5FS6 A;  4TLX A;  4RG3 A;  2EQ8 A;  2A87 A;  3DA1 A;  4ZCC A;  3SZC A;  1BGJ A;  2FJB A;  2IID A;  3NK1 X;  2DKI A;  3CIR A;  1LQU A;  2A89 A;  1NG3 A;  3BHK A;  1VG9 A;  3CGB A;  3RP6 A;  3EPT A;  3UKH A;  4DGK A;  1H7W A;  3NIX A;  3GWD A;  2Q0K A;  3KD9 A;  4CY8 A;  3AE5 A;  3ITJ A;  2E81 A;  1ZP0 A;  2XVF A;  1TDK A;  4LII A;  2XLP A;  4UP3 A;  3AWI A;  4NZH A;  3COX A;  3NYC A;  5FS9 A;  2WPC A;  1GES A;  2GRT A;  4GDE A;  5GRT A;  1Y56 B;  4ECH A;  3SZW A;  1JEH A;  2EQ6 A;  1QO8 A;  2BCP A;  4H50 A;  4J36 A;  2V3B A;  3UCL A;  1VRQ B;  5JCK A;  2OAL A;  2XFN A;  2OLO A;  4JY2 A;  3GMB A;  2JB3 A;  4OCG A;  2WET A;  4B67 A;  3D1C A;  4I59 A;  2C3D A;  2B9Y A;  1QJD A;  4CBQ A;  2C66 A;  3QVP A;  1PXC A;  4BK3 A;  3EAN A;  2ZZC A;  1ZOV A;  4H4R A;  3V76 A;  1ZMC A;  4A9W A;  4Z26 A;  3B3R A;  2WOW A;  4MJW A;  3AE1 A;  4EM4 A;  2CUL A;  4B69 A;  2LFC A;  2H89 A;  4A5L A;  4IVO B;  1NHQ A;  3DK9 A;  4EM3 A;  1E1N A;  5JCM A;  2BK3 A;  3QVR A;  4H4Z A;  3DGZ A;  3BNM A;  2GMJ A;  4IV9 A;  4CNK A;  2XYO A;  2RAB A;  3LB8 A;  3ABV A;  1FT6 A;  1H86 A;  2BK5 A;  3CPJ G;  2FJD A;  3LGQ A;  2QA1 A;  2X8H A;  3T2Z A;  2IVE A;  1TDF A;  1TRB A;  3AE4 A;  1CHU A;  4CCR A;  3NK0 X;  3K7M X;  4Z44 A;  1TDN A;  4BJY A;  1YQ4 A;  4YSX A;  1KNP A;  1Q9I A;  3AE6 A;  3L1T A;  2O9Z A;  2YQU A;  2B9W A;  3SCE A;  2GAG B;  1XAN A;  2FBW A;  3DJE A;  2YR4 A;  3D1I A;  4G6G A;  3AEB A;  2R0C A;  3NTD A;  2C70 A;  1YQZ A;  2ACZ A;  4XWZ A;  2XFO A;  2B76 A;  3RKH A;  4EQW A;  3CNS A;  1KSU A;  4A6N B;  3RP7 A;  2XVE A;  1TDO A;  1ZDL A;  1PBD A;  1GET A;  2TPR A;  5IQ1 A;  4L3X A;  4K5R A;  2R45 A;  2BK4 A;  1H82 A;  3UOY A;  3DJG X;  1CC4 A;  1VG0 A;  4L3Z A;  4L3Y A;  2WS3 A;  3PVC A;  4BJZ A;  3EAO A;  1XPQ A;  3DH9 A;  4EQS A;  4H4V A;  1N4U A;  1B4V A;  1K0J A;  2OLN A;  3P4P A;  2YLT A;  4RSL A;  1ZX9 A;  2YLS A;  3EF6 A;  4H4Y A;  3UOZ A;  3UTH A;  4KX6 A;  4YSY A;  4NWZ A;  4DSH A;  5KMS A;  4BUR A;  2BC1 A;  2H88 A;  2YWL A;  2GR1 A;  1F8S A;  3CNJ A;  3CPH G;  3AEA A;  4UDP A;  1W4X A;  2WES A;  3FG2 P;  2NPX A;  1LPF A;  5HYM A;  5BUL A;  3LJP A;  3NTA A;  4AP1 A;  5JCL A;  1KF6 A;  3V3O A;  1EL5 A;  2V61 A;  4U8M A;  4B68 A;  1JU2 A;  3ATR A;  4OPC A;  1E7P A;  4A6N A;  1GOS A;  2EQ7 A;  1IUV A;  4YSH A;  1OJT A;  1L9E A;  3NGC X;  1MO9 A;  2RGJ A;  2WOV A;  3F8D A;  3IC9 A;  1BKW A;  4TM3 A;  4USQ A;  1S3E A;  4YSZ A;  3O0H A;  1M1R A;  5BVA A;  4J31 A;  2E1M A;  3NN6 X;  1GU6 A;  5BUK A;  2ZZ0 A;  3SY4 A;  3LXD A;  3IWA A;  3ALL A;  3BNH A;  3HYW A;  1D7Y A;  3FMW A;  4OPG A;  4YKF A;  1P2E A;  3VQR A;  4A99 A;  3F29 A;  1YY5 A;  1QDB A;  2HQM A;  4I58 A;  1DOE A;  2GQW A;  4A7A A;  1P2H A;  2C72 A;  1OJC A;  2NVK X;  3NYE A;  4BK2 A;  3SFD A;  3UKP A;  2BC0 A;  1OJD A;  3NN0 X;  3IHM A;  5M10 A;  4CCQ A;  4B63 A;  2V60 A;  4EMW A;  2R46 A;  3R9U A;  3GD3 A;  4K8D A;  3UBR A;  3GD4 A;  5U63 A;  4GR1 A;  1KNR A;  1REO A;  1JRY A;  3TTB A;  2X50 A;  5M0Z A;  4JN9 A;  4IA6 A;  3SGL A;  3VR9 A;  1S3B A;  3H8L A;  4Z25 A;  3B6D A;  2ZO5 A;  2CDU A;  3KVE A;  1O5W A;  2YG5 A;  4WJY A;  2J3N A;  1CF3 A;  2VVM A;  2C65 A;  4K2X A;  3IHG A;  2RF7 A;  2WBA A;  3AEE A;  1B5Q A;  1FCD A;  1GTE A;  2WEU A;  1H81 A;  2Q7V A;  2QA2 A;  1GRE A;  1JRX A;  2ZZB A;  4GAP A;  4X9M A;  1GAL A;  4FX9 A;  1GRH A;  3DJJ A;  1BGN A;  2BXR A;  3PO7 A;  4N9X A;  1S2Y A;  4II2 A;  4JNA A;  1F3P A;  1D4C A;  2WPF A;  3CGD A;  4G74 A;  1IUW A;  2VZ2 A;  5HY5 A;  2B9X A;  4U2T A;  5EOW A;  2XLS A;  3T2K A;  1SEZ A;  3AB1 A;  1IUU A;  3AED A;  4KPR A;  1SP3 A;  3NLC A;  3DJD A;  1D4E A;  2BRA A;  1UKV G;  2YG4 A;  5EB5 A;  3H8I A;  2AAQ A;  1ZK7 A;  4YTN A;  2PHH A;  3AD7 B;  3ALM A;  3L8K A;  3QJ4 A;  2XVH A;  3T0K A;  4ZN0 A;  2VOU A;  2FJE A;  1GRF A;  2WP6 A;  3UKF A;  3H4K A;  2JB1 A;  1NHS A;  3K30 A;  1GRA A;  1GTH A;  4OPT A;  3VRA A;  3AYL A;  4H2N A;  3URH A;  4B66 A;  3BNF A;  4CNJ A;  2XLT A;  4G9K A;  2C75 A;  4M52 A;  1ZOY A;  4DNA A;  3CMM A;  3ATQ A;  4U8P A;  4Q1O A;  3C4A A;  4HB9 A;  1JNR A;  4H4Q A;  4PAA A;  3SFE A;  4Y4L A;  4JY3 A;  2BS3 A;  3CND A;  4H2P A;  2AR8 A;  4H4P A;  5C2T A;  2GH5 A;  2YLZ A;  3NH3 X;  3WE0 A;  5KOX A;  3S7W A;  2XVI A;  3GSI A;  2DKH A;  1Q1R A;  1CC2 A;  1ELI A;  1MXT A;  2C3C A;  3LZW A;  1BZL A;  3JSK A;  2VVL A;  4FDC B;  2X3N A;  4G6H A;  4BK1 A;  3P4R A;  1FT5 A;  4WX1 A;  1BF3 A;  3K7T A;  3GWF A;  1M64 A;  1JNI A;  1NEK A;  1PHH A;  4H2R A;  4XWR A;  2GV8 A;  1KDG A;  4J33 A;  1L9C A;  3NNE A;  3P4S A;  3F8P A;  1CL0 A;  2JKC A;  1GRT A;  4HA6 A;  3LG1 A;  2C76 A;  4UDQ A;  2XFP A;  1YQ3 A;  1N4W A;  4H4X A;  4CY6 A;  1PDH A;  1F6M A;  3T31 A;  4YTP A;  5GSN A;  2BA9 A;  4EIQ A;  2RGO A;  3ICR A;  4X4J A;  2Q6U A;  4AT2 A;  3VRD B;  2CVJ A;  2BRY A;  2RGH A;  2YM1 A;  3GDP A;  3QFA A;  4H4W A;  1GSN A;  4C5O A;  4K22 A;  3TOR A;  1Q1W A;  3Q6J A;  2C4C A;  3AEC A;  5CQF A;  3QFB A;  2WU5 A;  3FBS A;  1KFY A;  4J34 A;  4E0V A;  2WU2 A;  1EL7 A;  2WDQ A;  4NTC A;  3F8R A;  2VR0 A;  2ZBW A;  3HYV A;  3M13 A;  1QLB A;  2X8C A;  3GM6 A;  1GRG A;  1H6V A;  4Z2R A;  1YKJ A;  4U8J A;  3G5Q A;  1BWC A;  1DOD A;  2YM2 A;  3NYF A;  3LOV A;  3SZF A;  2OT4 A;  5U25 A;  3NK2 X;  2R9Z A;  3FPZ A;  3SYI A;  1ONF A;  2XDO A;  3ZYX A;  3UKA A;  2Z5X A;  2RDZ A;  3KA7 A;  5JCI A;  1GPE A;  2BS4 A;  3AE7 A;  3UU9 A;  4EMJ A;  3CGE A;  3UOX A;  2E5V A;  3GMC A;  3LAD A;  2B7S A;  3GYJ A;  4AOS A;  5BRT A;  1DJQ A;  2XLR A;  2YVG A;  3PS9 A;  1EBD A;  2GQF A;  2YR5 A;  1IUX A;  3NG7 X;  4Z2T A;  1PXB A;  1FEA A;  1E1L A;  3IF9 A;  1FEB A;  1ZKQ A;  2AQJ A;  2VRM A;  2Z5Y A;  3Q9T A;  3CPI G;  4AOX A;  2UZZ A;  4NTD A;  1OJA A;  5KXJ A;  3CTY A;  1LV0 A;  4GUV A;  1PXA A;  2YR6 A;  4APN A;  1Y0P A;  1CJ4 A;  1M1Q A;  1RSG A;  4JNQ A;  3T37 A;  4NNJ A;  1V59 A;  3HZL A;  3II4 A;  4U8I A;  3GYX A;  1TYT A;  3RED A;  1COY A;  3E1T A;  3KPF A;  3CNT A;  4GAV A;  4J56 A;  2XCG A;  4Q5C A;  3C96 A;  2X99 A;  3ADA B;  2APG A;  2QAE A;  3ISH A;  1LJ1 A;  1E6E A;  1NDA A;  1IUS A;  3RHA A;  5HXI A;  4YXD A;  4D03 A;  4H4S A;  3ICS A;  5DBJ A;  1K0I A;  5KMR A;  4Y4N A;  2WP9 A;  2WPE A;  4H4U A;  1FOH A;  3AD8 B;  1NEN A;  3SXI A;  2OAM A;  4NEW A;  4U2L A;  3UKL A;  2YLX A;  1LQT A;  3BI4 A;  5U1O A;  3NT6 A;  5KMQ A;  2CFY A; 
#chains in the Genus database with same CATH homology
 3QSS A;  3KPK A;  1M6I A;  4Y4M A;  4B64 A;  4IVM B;  5KWF A;  3AE9 A;  1S2Q A;  3ICT A;  4LU6 A;  2VQ7 A;  4ICY A;  4U2S A;  4DSG A;  1PBB A;  1FS9 A;  1FS8 A;  5CKU A;  1PJ5 A;  1VQW A;  2R0G A;  3GDN A;  2YLW A;  3T2Y A;  1Z6L A;  5FS7 A;  1IUT A;  3BI2 A;  4CRT A;  5LV9 A;  3FIM B;  3UP5 A;  2E4G A;  1K4Q A;  3DK4 A;  3BHF A;  1VDC A;  1BVB A;  3K7Q X;  4ZCD A;  4O5Q A;  1AOG A;  1B8S A;  2GR2 A;  3CNP A;  3GRT A;  4RG4 A;  4EMI A;  1KSS A;  4GDP A;  1NHR A;  2V3A A;  3AXB A;  3DME A;  4P9S A;  5KVI A;  1IJH A;  1F8W A;  4X9N A;  2ARD A;  3HYX A;  4J57 A;  3DGH A;  1N4V A;  2K3V A;  2GEW A;  3GRS A;  1MOK A;  5KOW A;  2FJA A;  2Y6R A;  2WQY A;  1M1P A;  2JAE A;  3DK8 A;  1CBO A;  2J7A A;  1O95 A;  4K5S A;  4NTE A;  1GV4 A;  3FO3 A;  1PBF A;  3CGC A;  1GER A;  4OVI A;  5EBK A;  1LTX R;  4Q0T A;  2GMH A;  4JQ9 A;  5KMP A;  3UOV A;  4YT0 A;  4WCT A;  3L1R A;  3BNG A;  4A65 A;  4UDR A;  1CJ2 A;  4D04 A;  3M12 A;  4AP3 A;  3VR8 A;  5JCN A;  5FS8 A;  3I6D A;  3AYJ A;  1LVL A;  2VQB A;  5C3J A;  1NPX A;  1FEC A;  1L0V A;  4Q4U A;  4J2W A;  2WDV A;  2PYX A;  1E39 A;  3UKK A;  4YKG A;  2EQ9 A;  2VRL A;  4GRT A;  1PJ6 A;  3RNM A;  1RP0 A;  3NRN A;  3M0O A;  2XLU A;  3AEG A;  3G5S A;  5J7X A;  5J60 A;  4LA1 A;  2V6O A;  4BV6 A;  4O5U A;  1NHP A;  1CJC A;  1K0L A;  1NG4 A;  1F8R A;  5EB4 A;  4Z24 A;  4JDR A;  2B7R A;  1D7L A;  2IVD A;  3V3N A;  3AE8 A;  4EQX A;  4EQR A;  4U8L A;  4EIP A;  1Y56 A;  1PJ7 A;  2OA1 A;  3SX6 A;  1E1K A;  4C77 A;  2BAB A;  1OAH A;  1DJN A;  2R0P A;  1D4D A;  1X31 B;  4Q5B A;  4L38 A;  4Q17 A;  1GXF A;  5HHF A;  2GR3 A;  3G5R A;  3SXQ A;  5FMH A;  4TM0 A;  4FK1 A;  2BYB A;  2F5Z A;  2YVJ A;  5TR3 A;  3OWM A;  2XFQ A;  2I0Z A;  3AEF A;  4OPL A;  4Z43 A;  1CC6 A;  3P9U A;  1XDI A;  4C74 A;  1N1P A;  1PN0 A;  2QCU A;  4C3Y A;  3SQP A;  3CN8 A;  2C73 A;  4GF7 A;  3UTF A;  1H7X A;  2A8X A;  3BNJ A;  2Q0L A;  4TM4 A;  2WHD A;  2Y6Q A;  2X8G A;  1TYP A;  2R4J A;  1OJ9 A;  1H83 A;  5KRQ A;  4TM1 A;  3UP4 A;  4OPD A;  3UTG A;  2JBV A;  4II3 A;  3P4Q A;  4REK A;  1E1M A;  2YG6 A;  1XHC A;  3MMO A;  1DNC A;  3BI5 A;  4A79 A;  5KNL A;  2JK6 A;  3UKQ A;  3AD9 B;  1RYI A;  4OPI A;  3P1W A;  3OC4 A;  1B37 A;  1PBE A;  1H84 A;  4USR A;  3ZDN A;  5KVH A;  2BAC A;  1TDE A;  4YTM A;  3LZX A;  2GB0 A;  4TLZ A;  3SZ0 A;  4K7Z A;  3KU9 A;  3UTE A;  4NEV A;  4GCM A;  4H2Q A;  1ZY8 A;  1DOC A;  2WP5 A;  3T14 A;  2C67 A;  4U8O A;  3AE2 A;  3RP8 A;  2TMD A;  3C4N A;  2GR0 A;  2VVL G;  2YVF A;  3D8X A;  2YLR A;  3NHO X;  5IPY A;  1DOB A;  4G73 A;  5L46 A;  2GVC A;  1ZMD A;  2WOI A;  3KKJ A;  4YWO A;  2XFU A;  4OPU A;  4B65 A;  3QSM A;  2WDR A;  4IA5 A;  4C3X A;  3S5W A;  2V5Z A;  2YG3 A;  4H4T A;  2BCG G;  1O94 A;  2C7G A;  1D5T A;  2R4E A;  4H7U A;  1PS9 A;  2GAH B;  2XVJ A;  3BNU A;  1EL8 A;  3NKS A;  3OZ2 A;  4B1B A;  4U8N A;  5IQ4 A;  1GEU A;  3GYI A;  4Z2U A;  1CJ3 A;  1HYU A;  3AYI A;  2C64 A;  4FK1 C;  1NAA A;  1PBC A;  5ER0 A;  2YG7 A;  3ALJ A;  3VRB A;  1GND A;  1GRB A;  3I3L A;  2W0H A;  1JRZ A;  3S61 A;  3QSE A;  2BS2 A;  2YAU A;  1DXL A;  2JB2 A;  1EL9 A;  4U8K A;  1L9D A;  1JOA A;  4XXG A;  4ADW A;  2GF3 A;  2E80 A;  1JNZ A;  4PAB A;  3KLJ A;  4AT0 A;  3SM8 A;  2BXS A;  1GT8 A;  1FL2 A;  1FS7 A;  3AE3 A;  5FS6 A;  4TLX A;  4RG3 A;  2EQ8 A;  2A87 A;  3DA1 A;  4ZCC A;  3SZC A;  1BGJ A;  2FJB A;  2IID A;  3NK1 X;  2DKI A;  3CIR A;  1LQU A;  2A89 A;  1NG3 A;  3BHK A;  1VG9 A;  3CGB A;  3RP6 A;  3EPT A;  3UKH A;  4DGK A;  1H7W A;  3NIX A;  3GWD A;  2Q0K A;  3KD9 A;  4CY8 A;  3AE5 A;  3ITJ A;  2E81 A;  1ZP0 A;  2XVF A;  1TDK A;  4LII A;  2XLP A;  4UP3 A;  3AWI A;  4NZH A;  3COX A;  3NYC A;  5FS9 A;  2WPC A;  1GES A;  2GRT A;  4GDE A;  5GRT A;  1Y56 B;  4ECH A;  3SZW A;  1JEH A;  2EQ6 A;  1QO8 A;  2BCP A;  4H50 A;  4J36 A;  2V3B A;  3UCL A;  1VRQ B;  5JCK A;  2OAL A;  2XFN A;  2OLO A;  4JY2 A;  3GMB A;  2JB3 A;  4OCG A;  2WET A;  4B67 A;  3D1C A;  4I59 A;  2C3D A;  2B9Y A;  1QJD A;  4CBQ A;  2C66 A;  3QVP A;  1PXC A;  4BK3 A;  3EAN A;  2ZZC A;  1ZOV A;  4H4R A;  3V76 A;  1ZMC A;  4A9W A;  4Z26 A;  3B3R A;  2WOW A;  4MJW A;  3AE1 A;  4EM4 A;  2CUL A;  4B69 A;  2LFC A;  2H89 A;  4A5L A;  4IVO B;  1NHQ A;  3DK9 A;  4EM3 A;  1E1N A;  5JCM A;  2BK3 A;  3QVR A;  4H4Z A;  3DGZ A;  3BNM A;  2GMJ A;  4IV9 A;  4CNK A;  2XYO A;  2RAB A;  3LB8 A;  3ABV A;  1FT6 A;  1H86 A;  2BK5 A;  3CPJ G;  2FJD A;  3LGQ A;  2QA1 A;  2X8H A;  3T2Z A;  2IVE A;  1TDF A;  1TRB A;  3AE4 A;  1CHU A;  4CCR A;  3NK0 X;  3K7M X;  4Z44 A;  1TDN A;  4BJY A;  1YQ4 A;  4YSX A;  1KNP A;  1Q9I A;  3AE6 A;  3L1T A;  2O9Z A;  2YQU A;  2B9W A;  3SCE A;  2GAG B;  1XAN A;  2FBW A;  3DJE A;  2YR4 A;  3D1I A;  4G6G A;  3AEB A;  2R0C A;  3NTD A;  2C70 A;  1YQZ A;  2ACZ A;  4XWZ A;  2XFO A;  2B76 A;  3RKH A;  4EQW A;  3CNS A;  1KSU A;  4A6N B;  3RP7 A;  2XVE A;  1TDO A;  1ZDL A;  1PBD A;  1GET A;  2TPR A;  5IQ1 A;  4L3X A;  4K5R A;  2R45 A;  2BK4 A;  1H82 A;  3UOY A;  3DJG X;  1CC4 A;  1VG0 A;  4L3Z A;  4L3Y A;  2WS3 A;  3PVC A;  4BJZ A;  3EAO A;  1XPQ A;  3DH9 A;  4EQS A;  4H4V A;  1N4U A;  1B4V A;  1K0J A;  2OLN A;  3P4P A;  2YLT A;  4RSL A;  1ZX9 A;  2YLS A;  3EF6 A;  4H4Y A;  3UOZ A;  3UTH A;  4KX6 A;  4YSY A;  4NWZ A;  4DSH A;  5KMS A;  4BUR A;  2BC1 A;  2H88 A;  2YWL A;  2GR1 A;  1F8S A;  3CNJ A;  3CPH G;  3AEA A;  4UDP A;  1W4X A;  2WES A;  3FG2 P;  2NPX A;  1LPF A;  5HYM A;  5BUL A;  3LJP A;  3NTA A;  4AP1 A;  5JCL A;  1KF6 A;  3V3O A;  1EL5 A;  2V61 A;  4U8M A;  4B68 A;  1JU2 A;  3ATR A;  4OPC A;  1E7P A;  4A6N A;  1GOS A;  2EQ7 A;  1IUV A;  4YSH A;  1OJT A;  1L9E A;  3NGC X;  1MO9 A;  2RGJ A;  2WOV A;  3F8D A;  3IC9 A;  1BKW A;  4TM3 A;  4USQ A;  1S3E A;  4YSZ A;  3O0H A;  1M1R A;  5BVA A;  4J31 A;  2E1M A;  3NN6 X;  1GU6 A;  5BUK A;  2ZZ0 A;  3SY4 A;  3LXD A;  3IWA A;  3ALL A;  3BNH A;  3HYW A;  1D7Y A;  3FMW A;  4OPG A;  4YKF A;  1P2E A;  3VQR A;  4A99 A;  3F29 A;  1YY5 A;  1QDB A;  2HQM A;  4I58 A;  1DOE A;  2GQW A;  4A7A A;  1P2H A;  2C72 A;  1OJC A;  2NVK X;  3NYE A;  4BK2 A;  3SFD A;  3UKP A;  2BC0 A;  1OJD A;  3NN0 X;  3IHM A;  5M10 A;  4CCQ A;  4B63 A;  2V60 A;  4EMW A;  2R46 A;  3R9U A;  3GD3 A;  4K8D A;  3UBR A;  3GD4 A;  5U63 A;  4GR1 A;  1KNR A;  1REO A;  1JRY A;  3TTB A;  2X50 A;  5M0Z A;  4JN9 A;  4IA6 A;  3SGL A;  3VR9 A;  1S3B A;  3H8L A;  4Z25 A;  3B6D A;  2ZO5 A;  2CDU A;  3KVE A;  1O5W A;  2YG5 A;  4WJY A;  2J3N A;  1CF3 A;  2VVM A;  2C65 A;  4K2X A;  3IHG A;  2RF7 A;  2WBA A;  3AEE A;  1B5Q A;  1FCD A;  1GTE A;  2WEU A;  1H81 A;  2Q7V A;  2QA2 A;  1GRE A;  1JRX A;  2ZZB A;  4GAP A;  4X9M A;  1GAL A;  4FX9 A;  1GRH A;  3DJJ A;  1BGN A;  2BXR A;  3PO7 A;  4N9X A;  1S2Y A;  4II2 A;  4JNA A;  1F3P A;  1D4C A;  2WPF A;  3CGD A;  4G74 A;  1IUW A;  2VZ2 A;  5HY5 A;  2B9X A;  4U2T A;  5EOW A;  2XLS A;  3T2K A;  1SEZ A;  3AB1 A;  1IUU A;  3AED A;  4KPR A;  1SP3 A;  3NLC A;  3DJD A;  1D4E A;  2BRA A;  1UKV G;  2YG4 A;  5EB5 A;  3H8I A;  2AAQ A;  1ZK7 A;  4YTN A;  2PHH A;  3AD7 B;  3ALM A;  3L8K A;  3QJ4 A;  2XVH A;  3T0K A;  4ZN0 A;  2VOU A;  2FJE A;  1GRF A;  2WP6 A;  3UKF A;  3H4K A;  2JB1 A;  1NHS A;  3K30 A;  1GRA A;  1GTH A;  4OPT A;  3VRA A;  3AYL A;  4H2N A;  3URH A;  4B66 A;  3BNF A;  4CNJ A;  2XLT A;  4G9K A;  2C75 A;  4M52 A;  1ZOY A;  4DNA A;  3CMM A;  3ATQ A;  4U8P A;  4Q1O A;  3C4A A;  4HB9 A;  1JNR A;  4H4Q A;  4PAA A;  3SFE A;  4Y4L A;  4JY3 A;  2BS3 A;  3CND A;  4H2P A;  2AR8 A;  4H4P A;  5C2T A;  2GH5 A;  2YLZ A;  3NH3 X;  3WE0 A;  5KOX A;  3S7W A;  2XVI A;  3GSI A;  2DKH A;  1Q1R A;  1CC2 A;  1ELI A;  1MXT A;  2C3C A;  3LZW A;  1BZL A;  3JSK A;  2VVL A;  4FDC B;  2X3N A;  4G6H A;  4BK1 A;  3P4R A;  1FT5 A;  4WX1 A;  1BF3 A;  3K7T A;  3GWF A;  1M64 A;  1JNI A;  1NEK A;  1PHH A;  4H2R A;  4XWR A;  2GV8 A;  1KDG A;  4J33 A;  1L9C A;  3NNE A;  3P4S A;  3F8P A;  1CL0 A;  2JKC A;  1GRT A;  4HA6 A;  3LG1 A;  2C76 A;  4UDQ A;  2XFP A;  1YQ3 A;  1N4W A;  4H4X A;  4CY6 A;  1PDH A;  1F6M A;  3T31 A;  4YTP A;  5GSN A;  2BA9 A;  4EIQ A;  2RGO A;  3ICR A;  4X4J A;  2Q6U A;  4AT2 A;  3VRD B;  2CVJ A;  2BRY A;  2RGH A;  2YM1 A;  3GDP A;  3QFA A;  4H4W A;  1GSN A;  4C5O A;  4K22 A;  3TOR A;  1Q1W A;  3Q6J A;  2C4C A;  3AEC A;  5CQF A;  3QFB A;  2WU5 A;  3FBS A;  1KFY A;  4J34 A;  4E0V A;  2WU2 A;  1EL7 A;  2WDQ A;  4NTC A;  3F8R A;  2VR0 A;  2ZBW A;  3HYV A;  3M13 A;  1QLB A;  2X8C A;  3GM6 A;  1GRG A;  1H6V A;  4Z2R A;  1YKJ A;  4U8J A;  3G5Q A;  1BWC A;  1DOD A;  2YM2 A;  3NYF A;  3LOV A;  3SZF A;  2OT4 A;  5U25 A;  3NK2 X;  2R9Z A;  3FPZ A;  3SYI A;  1ONF A;  2XDO A;  3ZYX A;  3UKA A;  2Z5X A;  2RDZ A;  3KA7 A;  5JCI A;  1GPE A;  2BS4 A;  3AE7 A;  3UU9 A;  4EMJ A;  3CGE A;  3UOX A;  2E5V A;  3GMC A;  3LAD A;  2B7S A;  3GYJ A;  4AOS A;  5BRT A;  1DJQ A;  2XLR A;  2YVG A;  3PS9 A;  1EBD A;  2GQF A;  2YR5 A;  1IUX A;  3NG7 X;  4Z2T A;  1PXB A;  1FEA A;  1E1L A;  3IF9 A;  1FEB A;  1ZKQ A;  2AQJ A;  2VRM A;  2Z5Y A;  3Q9T A;  3CPI G;  4AOX A;  2UZZ A;  4NTD A;  1OJA A;  5KXJ A;  3CTY A;  1LV0 A;  4GUV A;  1PXA A;  2YR6 A;  4APN A;  1Y0P A;  1CJ4 A;  1M1Q A;  1RSG A;  4JNQ A;  3T37 A;  4NNJ A;  1V59 A;  3HZL A;  3II4 A;  4U8I A;  3GYX A;  1TYT A;  3RED A;  1COY A;  3E1T A;  3KPF A;  3CNT A;  4GAV A;  4J56 A;  2XCG A;  4Q5C A;  3C96 A;  2X99 A;  3ADA B;  2APG A;  2QAE A;  3ISH A;  1LJ1 A;  1E6E A;  1NDA A;  1IUS A;  3RHA A;  5HXI A;  4YXD A;  4D03 A;  4H4S A;  3ICS A;  5DBJ A;  1K0I A;  5KMR A;  4Y4N A;  2WP9 A;  2WPE A;  4H4U A;  1FOH A;  3AD8 B;  1NEN A;  3SXI A;  2OAM A;  4NEW A;  4U2L A;  3UKL A;  2YLX A;  1LQT A;  3BI4 A;  5U1O A;  3NT6 A;  5KMQ A;  2CFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...