1Q9IA

The a251c:s430c double mutant of flavocytochrome c3 from shewanella frigidimarina
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGCGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLCKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords flavocytochrome c3
publication title Probing Domain Mobility in a Flavocytochrome
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 193
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1q9iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1q9iA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1q9iA01
2NVKX 2E4GA 2YLRA 3P4RA 2BK4A 4EQSA 3JSKA 2Z5XA 4UDQA 1KDGA 3S61A 4GCMA 4C77A 1EL5A 2X50A 3ATQA 2X8HA 4Y4MA 1B5QA 2BABA 5HHFA 3SGLA 3UOXA 1FL2A 1KSUA 4ZN0A 5IQ1A 3G5SA 1D5TA 3AE9A 1H7XA 1PXCA 2QA1A 1H82A 3M0OA 2OT4A 1BGNA 4J57A 3UKAA 5U63A 3DGZA 2XLRA 2B7SA 3CGCA 3CPHG 3EPTA 1OJDA 3AEFA 4K22A 4X4JA 1K0JA 1PBDA 4EMWA 3GDNA 5JCMA 2R0GA 1M6IA 1PN0A 1PBEA 3AYIA 4K2XA 1TDFA 4TLXA 1PHHA 4CCQA 1E1LA 4C3YA 1H83A 2VRLA 3DGHA 2RGOA 1E1KA 4BURA 4CY8A 2B9YA 3KD9A 1ZP0A 3UOYA 1F3PA 2XLPA 5J60A 2C3DA 2VRMA 4U8OA 1S2YA 2BK5A 4EMIA 5KRQA 3RKHA 4USQA 3HZLA 4H4RA 1MOKA 4AOXA 3FG2P 2YLSA 4B1BA 4B66A 4GF7A 4YSHA 4EIPA 1O5WA 4FK1C 1IJHA 1TYTA 1P2EA 2EQ6A 3QJ4A 1GRFA 4H2NA 2Y6QA 4Z2TA 3GWDA 2BS2A 3FIMB 4J36A 2BC0A 1KSSA 1N4VA 2XFUA 3CGEA 5U1OA 5C3JA 5JCKA 5CQFA 3AD9B 4U8JA 1LPFA 3UKLA 2UZZA 4EMJA 3QSEA 1NHSA 3II4A 4BV6A 1E6EA 4AP3A 4AP1A 1JNIA 3AD7B 4IVMB 3AEAA 1DOEA 1NG4A 4NTEA 4YT0A 4GDEA 1B8SA 1CC4A 3SFDA 3AE8A 5JCLA 4A7AA 3SXQA 1B37A 3CNDA 2FBWA 3M13A 2XLUA 3GWFA 1YY5A 4LIIA 4NEVA 4O5QA 1GRBA 3EF6A 1IUTA 2FJEA 2ZBWA 1LJ1A 1JRXA 3L1TA 1DJQA 4IV9A 2XVIA 4J33A 3GRTA 2IVEA 3UTHA 2JB1A 4OPTA 2V6OA 2BCGG 2WS3A 4XXGA 1PDHA 3OC4A 1D4DA 1E1NA 2E1MA 2WP5A 1L9DA 4H4UA 1TYPA 3P1WA 4MJWA 4Q17A 1IUVA 2YLZA 3NYCA 2TMDA 3UTFA 2XDOA 4J34A 5BVAA 3BHFA 1F8RA 4CCRA 1N1PA 3FPZA 4OCGA 1UKVG 3D1CA 2APGA 3H8LA 1Y0PA 1GRHA 1FS7A 1EL9A 2YG3A 2WESA 3COXA 1OJ9A 4WJYA 2LFCA 4NEWA 3GSIA 3NYFA 5KWFA 3UKPA 1EL7A 2ACZA 2V60A 4YTNA 4Z2UA 2Z5YA 5BULA 1REOA 5KOWA 2YWLA 4APNA 4H2RA 1Y56B 1XHCA 2GAGB 3AE3A 1M1QA 3L8KA 4EQWA 2XLTA 1LQUA 3F8PA 2PHHA 4H4SA 1IUSA 1N4WA 2XVJA 2XCGA 3VR8A 4X9MA 2DKIA 4N9XA 4OPDA 2GH5A 1DOBA 3LADA 3LB8A 3NH3X 2YLXA 4FX9A 4ZCCA 3SM8A 2ARDA 2W0HA 2WDQA 2X8GA 2C3CA 2C66A 2XFOA 1GERA 1YQ3A 2C75A 3B6DA 2BA9A 4K7ZA 3QSMA 1ZKQA 1JU2A 2WP9A 3MMOA 3NK1X 4Z2RA 2AAQA 2B9WA 1EL8A 4H50A 3NG7X 1MXTA 4J56A 4UDPA 1K4QA 3DJGX 4JNQA 5EB5A 3NHOX 3GD3A 4JY2A 4Y4LA 1DNCA 5KVIA 1DOCA 2JBVA 2VVMA 3NGCX 3AE1A 3I6DA 2BXRA 1PBFA 1TDKA 3RHAA 2WU2A 4Q0TA 4B68A 4TLZA 1CL0A 4U8MA 2Q0KA 3NNEA 2FJDA 2DKHA 1CHUA 1X31B 1COYA 2CDUA 2WEUA 3AWIA 1NENA 1PXBA 3D8XA 2OAMA 3GYIA 2XFQA 2AQJA 3PVCA 2E81A 3AECA 4L3XA 2J3NA 4B69A 4RSLA 3UP4A 5EBKA 4A9WA 4A65A 4EM3A 3H4KA 1ONFA 1PBBA 2ZZBA 4REKA 4WCTA 3BI4A 2R46A 3F8RA 4GR1A 3F29A 1NHQA 3GYXA 1GTEA 2WOVA 3UP5A 2WU5A 2WDVA 5FS6A 1FEBA 3NK0X 4JNAA 3WE0A 3IC9A 2BCPA 4DSGA 4NZHA 3RNMA 2YG7A 1D7LA 4DGKA 1DODA 4ADWA 1JNRA 2H88A 2YAUA 4U2LA 3S5WA 1QDBA 2CULA 1NHPA 1XDIA 3DA1A 5EB4A 1FS9A 3QSSA 4RG4A 3UOZA 4H4PA 4KX6A 1LQTA 4EIQA 3FBSA 3ALJA 2C73A 4OPGA 3B3RA 3OZ2A 5JCNA 3C96A 2V3BA 2WOWA 1ZMCA 4B64A 4OPLA 1KNPA 4YTPA 3UU9A 1V59A 4BK3A 4YXDA 1AOGA 3H8IA 2VVLA 4LA1A 1VDCA 3NYEA 3UTGA 3VQRA 4OVIA 3NIXA 1NEKA 3VRBA 2WPCA 4A6NA 5JCIA 4H7UA 1QLBA 4I58A 4Y4NA 3F8DA 2BC1A 1Q9IA 4A5LA 4EQXA 3UOVA 2EQ7A 4K8DA 1JOAA 1GEUA 2GR3A 5LV9A 2WQYA 3REDA 2XVEA 4H4WA 4O5UA 1GXFA 2WDRA 3FO3A 1VRQB 5DBJA 5ER0A 2NPXA 5L46A 1H81A 3IF9A 4J31A 5FS8A 1CJ2A 4TM0A 1JEHA 1GREA 2XLSA 1BKWA 2OALA 1FT5A 3TORA 2XVFA 1CJCA 4PABA 3LOVA 4CNKA 1OJCA 4TM4A 1CC2A 4M52A 1FEAA 3ITJA 2WPFA 4XWRA 2C72A 1FOHA 4PAAA 3K30A 3O0HA 5C2TA 4Z26A 2B7RA 3QFBA 1CC6A 2GF3A 2VR0A 1ZY8A 2AR8A 2B76A 2GVCA 3AEEA 2I0ZA 4D03A 1RYIA 3R9UA 2OA1A 3BI5A 4JQ9A 3ZYXA 3AEGA 1BGJA 1H7WA 2E5VA 1OJTA 4JN9A 1D4EA 1S3BA 2YR5A 4H4ZA 2CFYA 1Q1RA 3AB1A 3CNPA 2ZZ0A 4C5OA 4U8NA 3AYJA 1GALA 3CNJA 2RF7A 2R45A 3KU9A 1NPXA 5KXJA 2YR4A 3SQPA 1N4UA 2YQUA 5FS7A 4H2QA 3EANA 1K0LA 4X9NA 1KF6A 2A87A 3AD8B 1Z6LA 1QJDA 4WX1A 2VOUA 1ELIA 1GPEA 1TDNA 3Q6JA 3RP7A 2R4EA 3VRAA 1JRZA 1GTHA 1LVLA 2IIDA 2TPRA 2VVLG 1B4VA 3KVEA 4GRTA 4USRA 4Z44A 3URHA 3V76A 3QVRA 2YVFA 2BXSA 3GRSA 1FT6A 3IWAA 4TM3A 2WPEA 2VZ2A 2WP6A 1RP0A 4FK1A 3UKKA 5J7XA 3SFEA 1GRTA 1LTXR 1SP3A 2Y6RA 1ZK7A 1GOSA 2X3NA 3NKSA 2BACA 1IUWA 3KA7A 3CTYA 2C64A 3DJEA 3LZXA 1PBCA 4YSZA 1JRYA 1ZOYA 1SEZA 4EM4A 3BNMA 4BK2A 5FMHA 5BUKA 1NG3A 4CY6A 2C65A 4L3YA 4UDRA 1YKJA 1O95A 4A6NB 4Q4UA 3DK4A 2ZZCA 1M1PA 3LGQA 2XYOA 5GRTA 2WHDA 1DXLA 2JAEA 2YG5A 1BF3A 2V3AA 2E80A 3V3NA 3CPJG 2R0CA 4Q5BA 4YKFA 3BNUA 1W4XA 4YTMA 2Q0LA 4U8LA 3UTEA 3ZDNA 2YG6A 5KVHA 3BNFA 3GMBA 4EQRA 1OAHA 4OPIA 4FDCB 5HXIA 3AEBA 3CPIG 4K5RA 4IVOB 3ICTA 1VG9A 2JB3A 1H84A 1S3EA 3P4PA 4GUVA 2BYBA 1CF3A 1CJ4A 5BRTA 3ICSA 1GSNA 2C76A 2YM1A 3ALLA 3IHMA 3UKQA 5KOXA 4OPCA 3EAOA 3K7TA 1F8SA 2V5ZA 4A99A 2XFPA 1GV4A 4BK1A 1VQWA 1M64A 3GDPA 1Q1WA 1P2HA 4A79A 5CKUA 2R4JA 2OLOA 3NN0X 3BNJA 3VRDB 4Q5CA 4GDPA 3S7WA 4UP3A 3GMCA 2X8CA 1GT8A 2FJBA 2JKCA 2VQ7A 1ZX9A 1GNDA 4H4QA 2H89A 3ALMA 1NAAA 3ICRA 4U8KA 2O9ZA 4YKGA 4DNAA 2GQFA 2HQMA 3G5RA 1H6VA 4IA6A 3SCEA 2JK6A 2RDZA 2GRTA 3GM6A 2RGHA 2YR6A 1Y56A 2EQ8A 4L38A 5HYMA 1D4CA 1HYUA 3FMWA 1BWCA 3ABVA 4U2SA 3AE7A 4B67A 3DJJA 4Z25A 1OJAA 4H4VA 3AE6A 4BJYA 4B65A 2QA2A 3UCLA 1ZOVA 2X99A 3IHGA 1FS8A 2Q7VA 4U8IA 2A89A 2GR2A 1DJNA 1LV0A 1JNZA 3AE4A 3E1TA 3TTBA 5IPYA 4IA5A 3LZWA 1NDAA 2PYXA 3G5QA 1E39A 2C7GA 4YSYA 1GU6A 2GMHA 4H4YA 3L1RA 3LG1A 1D7YA 2B9XA 2BS4A 2XFNA 3BNGA 3AE5A 3RP8A 2ZO5A 1NHRA 3K7QX 2YVGA 1E1MA 5M10A 4ZCDA 3K7MX 3DK8A 4D04A 1XANA 1PJ5A 2WBAA 1GRGA 4XWZA 1KNRA 2Q6UA 3T37A 1M1RA 2IVDA 1TRBA 3C4AA 3CGDA 1PJ7A 1H86A 1FECA 3CGBA 2BS3A 3NTAA 4JDRA 3V3OA 4CNJA 4ICYA 2GMJA 2YLTA 1PS9A 3OWMA 1IUUA 4L3ZA 3PO7A 3ISHA 3PS9A 4I59A 5TR3A 1FCDA 2GAHB 5M0ZA 1TDEA 2GR0A 2R0PA 1BVBA 3P4SA 1ZDLA 1S2QA 3NRNA 5GSNA 1L0VA 1E7PA 3CNSA 4Z24A 3RP6A 4HA6A 1XPQA 2C67A 4JY3A 4BJZA 5EOWA 4YSXA 2RGJA 4KPRA 5U25A 3BI2A 2WETA 4AT0A 3I3LA 4U8PA 3AYLA 1GETA 3BHKA 5HY5A 1PJ6A 1MO9A 3KKJA 1L9CA 3D1IA 2YVJA 3NT6A 1O94A 3M12A 1RSGA 3ATRA 4C74A 2RABA 3AE2A 1EBDA 2V61A 3C4NA 1ZMDA 2YM2A 4Z43A 3NLCA 3UKHA 2R9ZA 1PXAA 3DMEA 4ECHA 1YQZA 4H4TA 4HB9A 2VQBA 3LJPA 3P4QA 3BNHA 1TDOA 3CNTA 2YLWA 3Q9TA 2OLNA 4H2PA 1KFYA 5FS9A 2GB0A 3AEDA 3GYJA 4U2TA 2FJAA 3KPFA 1QO8A 4J2WA 4RG3A 3LXDA 1CBOA 3DH9A 4P9SA 2XVHA 2YG4A 3DJDA 4CBQA 2BK3A 3CN8A 2K3VA 2GR1A 3UKFA 4B63A 3NTDA 4Q1OA 1GESA 2JB2A 1IUXA 4CRTA 4NTDA 1L9EA 3ADAB 2GV8A 2J7AA 3CIRA 3KLJA 4LU6A 4H4XA 2GEWA 3DK9A 4AT2A 4OPUA 1K0IA 1VG0A 2A8XA 3QVPA 1F6MA 1F8WA 4DSHA 4TM1A 4AOSA 4E0VA 4NTCA 2QCUA 2GQWA 5IQ4A 2QAEA 1YQ4A 3UBRA 3GD4A 3NK2X 1GRAA 2C70A 2EQ9A 2WOIA 3NN6X 4K5SA 4YWOA 3VR9A 1BZLA 4C3XA 2CVJA 3QFAA 3AXBA 2F5ZA 1CJ3A 3P9UA
chains in the Genus database with same CATH superfamily
2NVKX 2E4GA 2YLRA 3P4RA 2BK4A 4EQSA 3JSKA 2Z5XA 4UDQA 1KDGA 4G74A 4GCMA 3S61A 1EL5A 2X50A 3ATQA 2X8HA 4Y4MA 1B5QA 2BABA 5HHFA 3SGLA 3UOXA 1FL2A 1KSUA 4ZN0A 5IQ1A 3G5SA 1D5TA 3AE9A 1H7XA 1PXCA 2QA1A 1H82A 3M0OA 2OT4A 1BGNA 4J57A 3UKAA 5U63A 3DGZA 2XLRA 3SZ0A 2B7SA 3CGCA 3CPHG 3EPTA 1OJDA 3AEFA 4K22A 4X4JA 1K0JA 1PBDA 4EMWA 3GDNA 5JCMA 2R0GA 1M6IA 1PN0A 1PBEA 3AYIA 4K2XA 1TDFA 4TLXA 1PHHA 4CCQA 1E1LA 4C3YA 1H83A 2VRLA 3DGHA 2RGOA 1E1KA 4BURA 4CY8A 3T31A 2B9YA 3KD9A 1ZP0A 3UOYA 1F3PA 2XLPA 5J60A 2C3DA 2VRMA 4U8OA 1S2YA 2BK5A 4EMIA 5KRQA 3RKHA 4USQA 3HZLA 4H4RA 1MOKA 4AOXA 3FG2P 2YLSA 4B1BA 4B66A 4GF7A 4YSHA 4EIPA 1O5WA 4FK1C 1IJHA 1TYTA 1P2EA 2EQ6A 3QJ4A 1GRFA 4H2NA 2Y6QA 4Z2TA 3GWDA 2BS2A 3FIMB 4J36A 2BC0A 1KSSA 1N4VA 2XFUA 3CGEA 5U1OA 5C3JA 5JCKA 5CQFA 5KMSA 3AD9B 4U8JA 1LPFA 3UKLA 2UZZA 4EMJA 3QSEA 1NHSA 3II4A 4BV6A 1E6EA 4AP3A 4AP1A 1JNIA 3AD7B 4IVMB 3AEAA 1DOEA 1NG4A 4NTEA 3T2ZA 4YT0A 4GDEA 1B8SA 3HYXA 1CC4A 3SFDA 3AE8A 5JCLA 4A7AA 3SXQA 1B37A 3CNDA 2FBWA 3M13A 2XLUA 3GWFA 1YY5A 4LIIA 4NEVA 4O5QA 1GRBA 3EF6A 1IUTA 2FJEA 2ZBWA 1LJ1A 1JRXA 3L1TA 1DJQA 4IV9A 2XVIA 4J33A 3GRTA 2IVEA 3UTHA 2JB1A 4OPTA 2V6OA 2BCGG 2WS3A 4XXGA 1PDHA 3OC4A 3SXIA 1D4DA 1E1NA 2E1MA 2WP5A 1L9DA 4H4UA 1TYPA 3P1WA 4MJWA 4Q17A 1IUVA 2YLZA 3NYCA 2TMDA 3UTFA 2XDOA 4J34A 5BVAA 3BHFA 1F8RA 4CCRA 1N1PA 3FPZA 4OCGA 1UKVG 3D1CA 2APGA 3H8LA 1Y0PA 1GRHA 1FS7A 1EL9A 2YG3A 2WESA 3COXA 1OJ9A 4WJYA 2LFCA 4NEWA 3GSIA 3NYFA 4G9KA 5KWFA 3UKPA 1EL7A 2ACZA 2V60A 4YTNA 4Z2UA 2Z5YA 5BULA 1REOA 5KOWA 2YWLA 4APNA 4H2RA 1Y56B 1XHCA 2GAGB 3AE3A 1M1QA 3L8KA 4EQWA 2XLTA 1LQUA 3F8PA 2PHHA 4H4SA 1IUSA 1N4WA 2XVJA 2XCGA 3VR8A 4X9MA 2DKIA 4N9XA 4OPDA 2GH5A 1DOBA 3LADA 3LB8A 3NH3X 2YLXA 4FX9A 4ZCCA 3SM8A 2ARDA 2W0HA 2WDQA 2X8GA 2C3CA 2C66A 2XFOA 1GERA 1YQ3A 2C75A 3B6DA 2BA9A 4K7ZA 3QSMA 1ZKQA 1JU2A 2WP9A 3MMOA 3NK1X 4Z2RA 2AAQA 2B9WA 1EL8A 4H50A 3NG7X 1MXTA 4J56A 4UDPA 1K4QA 3DJGX 4JNQA 5EB5A 3NHOX 3GD3A 4JY2A 4Y4LA 1DNCA 5KVIA 1DOCA 2JBVA 2VVMA 3NGCX 3AE1A 3SZWA 3I6DA 2BXRA 1PBFA 1TDKA 3RHAA 2WU2A 4Q0TA 4B68A 4TLZA 1CL0A 4U8MA 2Q0KA 3NNEA 2FJDA 2DKHA 1CHUA 1X31B 1COYA 2CDUA 2WEUA 3AWIA 1NENA 1PXBA 3D8XA 2OAMA 3GYIA 2XFQA 2AQJA 2BRAA 2E81A 3AECA 3PVCA 4L3XA 2J3NA 4B69A 4RSLA 3UP4A 5EBKA 4A9WA 4A65A 4EM3A 3H4KA 1ONFA 1PBBA 2ZZBA 4REKA 4WCTA 3BI4A 2R46A 3F8RA 4GR1A 3F29A 1NHQA 3GYXA 1GTEA 5KNLA 2WOVA 3UP5A 4G6GA 2WU5A 2WDVA 5FS6A 1FEBA 3T14A 3NK0X 4JNAA 3WE0A 3HYWA 3IC9A 2BCPA 4DSGA 4NZHA 3RNMA 2YG7A 2CZSA 1D7LA 4DGKA 1DODA 4II3A 4ADWA 1JNRA 2H88A 2YAUA 4U2LA 3S5WA 1QDBA 2CULA 1NHPA 1XDIA 3DA1A 5EB4A 1FS9A 3QSSA 4RG4A 3UOZA 4H4PA 4KX6A 1LQTA 4EIQA 3FBSA 3ALJA 2C73A 4OPGA 2C4CA 3B3RA 3OZ2A 5JCNA 3C96A 2V3BA 5KMRA 2WOWA 1ZMCA 4B64A 4OPLA 1KNPA 4YTPA 3UU9A 1V59A 4BK3A 4YXDA 1AOGA 3H8IA 2VVLA 4LA1A 1VDCA 3NYEA 3UTGA 3VQRA 4OVIA 3NIXA 1NEKA 3VRBA 2WPCA 4A6NA 5JCIA 4H7UA 1QLBA 4I58A 4Y4NA 3F8DA 2BC1A 1Q9IA 4A5LA 4EQXA 3UOVA 2EQ7A 4K8DA 1JOAA 1GEUA 2GR3A 5LV9A 2WQYA 3REDA 2XVEA 4H4WA 4O5UA 1GXFA 2WDRA 3FO3A 1VRQB 5DBJA 5ER0A 2NPXA 5L46A 1H81A 3IF9A 4G6HA 4J31A 5FS8A 1CJ2A 4TM0A 1JEHA 1GREA 2XLSA 1BKWA 3T0KA 2OALA 1FT5A 3TORA 2XVFA 1CJCA 4PABA 3LOVA 4CNKA 1OJCA 4TM4A 1CC2A 4M52A 1FEAA 3ITJA 2WPFA 4XWRA 2C72A 1FOHA 4PAAA 3K30A 3O0HA 5C2TA 4Z26A 2B7RA 3QFBA 1CC6A 2GF3A 2VR0A 1ZY8A 2AR8A 2B76A 2GVCA 3AEEA 2I0ZA 4D03A 1RYIA 3R9UA 2OA1A 3BI5A 4JQ9A 3ZYXA 3AEGA 1BGJA 1H7WA 2E5VA 1OJTA 4JN9A 1D4EA 1S3BA 2YR5A 4H4ZA 2CFYA 1Q1RA 3AB1A 3CNPA 2ZZ0A 4C5OA 4U8NA 3AYJA 1GALA 4NNJA 3CNJA 2RF7A 2R45A 3KU9A 1NPXA 5KMQA 2YR4A 3SQPA 1N4UA 5KXJA 2YQUA 5FS7A 4H2QA 3EANA 1K0LA 4X9NA 1KF6A 2A87A 3AD8B 5KMPA 1Z6LA 1QJDA 4WX1A 2VOUA 1ELIA 1GPEA 1TDNA 3Q6JA 3RP7A 2R4EA 3VRAA 1JRZA 1GTHA 1LVLA 2IIDA 2TPRA 2VVLG 1B4VA 3KVEA 4GRTA 2BRYA 4USRA 4Z44A 3URHA 3V76A 3QVRA 2YVFA 2BXSA 3GRSA 1FT6A 3IWAA 4TM3A 2WPEA 2VZ2A 2WP6A 1RP0A 4FK1A 3UKKA 4G73A 5J7XA 1GRTA 3SFEA 1LTXR 1SP3A 2Y6RA 1ZK7A 1GOSA 2X3NA 3NKSA 2BACA 1IUWA 3KA7A 3CTYA 2C64A 3DJEA 3LZXA 1PBCA 4YSZA 4II2A 1JRYA 1ZOYA 1SEZA 4EM4A 3BNMA 4BK2A 5FMHA 5BUKA 1NG3A 4CY6A 2C65A 4L3YA 4UDRA 1YKJA 1O95A 4A6NB 4Q4UA 3DK4A 3T2YA 2ZZCA 1M1PA 3LGQA 2XYOA 5GRTA 2WHDA 1DXLA 2JAEA 2YG5A 1BF3A 2V3AA 2E80A 3V3NA 3CPJG 2R0CA 4Q5BA 4YKFA 3BNUA 1W4XA 4YTMA 2Q0LA 4U8LA 3UTEA 3ZDNA 2YG6A 5KVHA 3BNFA 3GMBA 4EQRA 1OAHA 4OPIA 4FDCB 3SY4A 5HXIA 3AEBA 3CPIG 4K5RA 4IVOB 3ICTA 1VG9A 2JB3A 1H84A 1S3EA 3P4PA 4GUVA 2BYBA 1CF3A 1CJ4A 5BRTA 4GAPA 3ICSA 1GSNA 2C76A 2YM1A 3ALLA 3IHMA 3UKQA 5KOXA 4OPCA 3EAOA 3K7TA 4NWZA 1F8SA 2V5ZA 4A99A 2XFPA 1GV4A 4BK1A 1VQWA 1M64A 3GDPA 1Q1WA 1P2HA 4A79A 5CKUA 2R4JA 2OLOA 3NN0X 3BNJA 3VRDB 4Q5CA 4GDPA 3S7WA 4UP3A 3GMCA 2X8CA 1GT8A 2FJBA 2JKCA 2VQ7A 1ZX9A 1GNDA 4H4QA 2H89A 3ALMA 1NAAA 3ICRA 4U8KA 2O9ZA 4YKGA 4DNAA 2GQFA 2HQMA 3G5RA 1H6VA 4IA6A 3SCEA 2JK6A 2RDZA 2GRTA 3GM6A 2RGHA 2YR6A 1Y56A 2EQ8A 4L38A 5HYMA 1D4CA 1HYUA 3FMWA 1BWCA 3ABVA 4U2SA 3AE7A 3SX6A 4B67A 3DJJA 4Z25A 1OJAA 4H4VA 3AE6A 4BJYA 4B65A 2QA2A 3UCLA 1ZOVA 2X99A 3IHGA 1FS8A 2Q7VA 4U8IA 2A89A 2GR2A 1DJNA 1LV0A 1JNZA 3AE4A 3E1TA 3TTBA 5IPYA 4IA5A 3LZWA 1NDAA 2PYXA 3G5QA 1E39A 2C7GA 4YSYA 1GU6A 2GMHA 4GAVA 4H4YA 3L1RA 3LG1A 1D7YA 2B9XA 2BS4A 2XFNA 3BNGA 3AE5A 3RP8A 2ZO5A 1NHRA 3K7QX 2YVGA 1E1MA 5M10A 4ZCDA 3K7MX 3DK8A 4D04A 1XANA 1PJ5A 2WBAA 1GRGA 4XWZA 1KNRA 2Q6UA 3T37A 1M1RA 2IVDA 1TRBA 3C4AA 3CGDA 1PJ7A 1H86A 1FECA 3CGBA 2BS3A 3NTAA 4JDRA 3V3OA 4CNJA 4ICYA 2GMJA 2YLTA 1PS9A 3OWMA 1IUUA 4L3ZA 3PO7A 3ISHA 3PS9A 4I59A 5TR3A 1FCDA 2GAHB 5M0ZA 1TDEA 2GR0A 2R0PA 1BVBA 3P4SA 1ZDLA 1S2QA 3NRNA 5GSNA 1L0VA 1E7PA 3CNSA 4Z24A 3RP6A 4HA6A 3SZCA 1XPQA 2C67A 4JY3A 4BJZA 5EOWA 4YSXA 2RGJA 4KPRA 5U25A 3BI2A 2WETA 4AT0A 3I3LA 4U8PA 3AYLA 1GETA 3BHKA 5HY5A 1PJ6A 1MO9A 3KKJA 1L9CA 3D1IA 2YVJA 3NT6A 1O94A 3M12A 1RSGA 3ATRA 4C74A 2RABA 3AE2A 1EBDA 3T2KA 2V61A 3C4NA 1ZMDA 2YM2A 4C77A 4Z43A 3NLCA 3UKHA 2R9ZA 1PXAA 3DMEA 4ECHA 1YQZA 3HYVA 4H4TA 4HB9A 2VQBA 3LJPA 3P4QA 3BNHA 1TDOA 3CNTA 2YLWA 3Q9TA 2OLNA 4H2PA 1KFYA 5FS9A 2GB0A 3AEDA 3GYJA 4U2TA 2FJAA 3KPFA 1QO8A 4J2WA 4RG3A 3LXDA 1CBOA 3DH9A 4P9SA 2XVHA 2YG4A 3DJDA 4CBQA 2BK3A 3CN8A 2K3VA 2GR1A 3UKFA 4B63A 3NTDA 4Q1OA 1GESA 2JB2A 1IUXA 4CRTA 4NTDA 1L9EA 3ADAB 2GV8A 3CMMA 2J7AA 3CIRA 3KLJA 4LU6A 4H4XA 2GEWA 3DK9A 4AT2A 4OPUA 1K0IA 1VG0A 2A8XA 3QVPA 1F6MA 1F8WA 4DSHA 4TM1A 4AOSA 4E0VA 4NTCA 2QCUA 2GQWA 3KPKA 5IQ4A 2QAEA 1YQ4A 3UBRA 3GD4A 3NK2X 1GRAA 2C70A 2EQ9A 2WOIA 3NN6X 4K5SA 4YWOA 3VR9A 1BZLA 3SZFA 4C3XA 2CVJA 3QFAA 3SYIA 3AXBA 2F5ZA 1CJ3A 3P9UA
chains in the Genus database with same CATH topology
2NVKX 2E4GA 2YLRA 3P4RA 2BK4A 4EQSA 3JSKA 2Z5XA 4UDQA 1KDGA 4G74A 4GCMA 3S61A 1EL5A 2X50A 3ATQA 2X8HA 4Y4MA 1B5QA 2BABA 5HHFA 3SGLA 3UOXA 1FL2A 1KSUA 4ZN0A 5IQ1A 3G5SA 1D5TA 3AE9A 1H7XA 1PXCA 2QA1A 1H82A 3M0OA 2OT4A 1BGNA 4J57A 3UKAA 5U63A 3DGZA 2XLRA 3SZ0A 2B7SA 3CGCA 3CPHG 3EPTA 1OJDA 3AEFA 4K22A 4X4JA 1K0JA 1PBDA 4EMWA 3GDNA 5JCMA 2R0GA 1M6IA 1PN0A 1PBEA 3AYIA 4K2XA 1TDFA 4TLXA 1PHHA 4CCQA 1E1LA 4C3YA 1H83A 2VRLA 3DGHA 2RGOA 1E1KA 4BURA 4CY8A 3T31A 2B9YA 3KD9A 1ZP0A 3UOYA 1F3PA 2XLPA 5J60A 2C3DA 2VRMA 4U8OA 1S2YA 2BK5A 4EMIA 5KRQA 3RKHA 4USQA 3HZLA 4H4RA 1MOKA 4AOXA 3FG2P 2YLSA 4B1BA 4B66A 4GF7A 4YSHA 4EIPA 1O5WA 4FK1C 1IJHA 1TYTA 1P2EA 2EQ6A 3QJ4A 1GRFA 4H2NA 2Y6QA 4Z2TA 3GWDA 2BS2A 3FIMB 4J36A 2BC0A 1KSSA 1N4VA 2XFUA 3CGEA 5U1OA 5C3JA 5JCKA 5CQFA 5KMSA 3AD9B 4U8JA 1LPFA 3UKLA 2UZZA 4EMJA 3QSEA 1NHSA 3II4A 4BV6A 1E6EA 4AP3A 4AP1A 1JNIA 3AD7B 4IVMB 3AEAA 1DOEA 1NG4A 4NTEA 3T2ZA 4YT0A 4GDEA 1B8SA 3HYXA 1CC4A 3SFDA 3AE8A 5JCLA 4A7AA 3SXQA 1B37A 3CNDA 2FBWA 3M13A 2XLUA 3GWFA 1YY5A 4LIIA 4NEVA 4O5QA 1GRBA 3EF6A 1IUTA 2FJEA 2ZBWA 1LJ1A 1JRXA 3L1TA 1DJQA 4IV9A 2XVIA 4J33A 3GRTA 2IVEA 3UTHA 2JB1A 4OPTA 2V6OA 2BCGG 2WS3A 4XXGA 1PDHA 3OC4A 3SXIA 1D4DA 1E1NA 2E1MA 2WP5A 1L9DA 4H4UA 1TYPA 3P1WA 4MJWA 4Q17A 1IUVA 2YLZA 3NYCA 2TMDA 3UTFA 2XDOA 4J34A 5BVAA 3BHFA 1F8RA 4CCRA 1N1PA 3FPZA 4OCGA 1UKVG 3D1CA 2APGA 3H8LA 1Y0PA 1GRHA 1FS7A 1EL9A 2YG3A 2WESA 3COXA 1OJ9A 4WJYA 2LFCA 4NEWA 3GSIA 3NYFA 4G9KA 5KWFA 3UKPA 1EL7A 2ACZA 2V60A 4YTNA 4Z2UA 2Z5YA 5BULA 1REOA 5KOWA 2YWLA 4APNA 4H2RA 1Y56B 1XHCA 2GAGB 3AE3A 1M1QA 3L8KA 4EQWA 2XLTA 1LQUA 3F8PA 2PHHA 4H4SA 1IUSA 1N4WA 2XVJA 2XCGA 3VR8A 4X9MA 2DKIA 4N9XA 4OPDA 2GH5A 1DOBA 3LADA 3LB8A 3NH3X 2YLXA 4FX9A 4ZCCA 3SM8A 2ARDA 2W0HA 2WDQA 2X8GA 2C3CA 2C66A 2XFOA 1GERA 1YQ3A 2C75A 3B6DA 2BA9A 4K7ZA 3QSMA 1ZKQA 1JU2A 2WP9A 3MMOA 3NK1X 4Z2RA 2AAQA 2B9WA 1EL8A 4H50A 3NG7X 1MXTA 4J56A 4UDPA 1K4QA 3DJGX 4JNQA 5EB5A 3NHOX 3GD3A 4JY2A 4Y4LA 1DNCA 5KVIA 1DOCA 2JBVA 2VVMA 3NGCX 3AE1A 3SZWA 3I6DA 2BXRA 1PBFA 1TDKA 3RHAA 2WU2A 4Q0TA 4B68A 4TLZA 1CL0A 4U8MA 2Q0KA 3NNEA 2FJDA 2DKHA 1CHUA 1X31B 1COYA 2CDUA 2WEUA 3AWIA 1NENA 1PXBA 3D8XA 2OAMA 3GYIA 2XFQA 2AQJA 2BRAA 2E81A 3AECA 3PVCA 4L3XA 2J3NA 4B69A 4RSLA 3UP4A 5EBKA 4A9WA 4A65A 4EM3A 3H4KA 1ONFA 1PBBA 2ZZBA 4REKA 4WCTA 3BI4A 2R46A 3F8RA 4GR1A 3F29A 1NHQA 3GYXA 1GTEA 5KNLA 2WOVA 3UP5A 4G6GA 2WU5A 2WDVA 5FS6A 1FEBA 3T14A 3NK0X 4JNAA 3WE0A 3HYWA 3IC9A 2BCPA 4DSGA 4NZHA 3RNMA 2YG7A 1D7LA 4DGKA 1DODA 4II3A 4ADWA 1JNRA 2H88A 2YAUA 4U2LA 3S5WA 1QDBA 2CULA 1NHPA 1XDIA 3DA1A 5EB4A 1FS9A 3QSSA 4RG4A 3UOZA 4H4PA 4KX6A 1LQTA 4EIQA 3FBSA 3ALJA 2C73A 4OPGA 2C4CA 3B3RA 3OZ2A 5JCNA 3C96A 2V3BA 5KMRA 2WOWA 1ZMCA 4B64A 4OPLA 1KNPA 4YTPA 3UU9A 1V59A 4BK3A 4YXDA 1AOGA 3H8IA 2VVLA 4LA1A 1VDCA 3NYEA 3UTGA 3VQRA 4OVIA 3NIXA 1NEKA 3VRBA 2WPCA 4A6NA 5JCIA 4H7UA 1QLBA 4I58A 4Y4NA 3F8DA 2BC1A 1Q9IA 4A5LA 4EQXA 3UOVA 2EQ7A 4K8DA 1JOAA 1GEUA 2GR3A 5LV9A 2WQYA 3REDA 2XVEA 4H4WA 4O5UA 1GXFA 2WDRA 3FO3A 1VRQB 5DBJA 5ER0A 2NPXA 5L46A 1H81A 3IF9A 4G6HA 4J31A 5FS8A 1CJ2A 4TM0A 1JEHA 1GREA 2XLSA 1BKWA 3T0KA 2OALA 1FT5A 3TORA 2XVFA 1CJCA 4PABA 3LOVA 4CNKA 1OJCA 4TM4A 1CC2A 4M52A 1FEAA 3ITJA 2WPFA 4XWRA 2C72A 1FOHA 4PAAA 3K30A 3O0HA 5C2TA 4Z26A 2B7RA 3QFBA 1CC6A 2GF3A 2VR0A 1ZY8A 2AR8A 2B76A 2GVCA 3AEEA 2I0ZA 4D03A 1RYIA 3R9UA 2OA1A 3BI5A 4JQ9A 3ZYXA 3AEGA 1BGJA 1H7WA 2E5VA 1OJTA 4JN9A 1D4EA 1S3BA 2YR5A 4H4ZA 2CFYA 1Q1RA 3AB1A 3CNPA 2ZZ0A 4C5OA 4U8NA 3AYJA 1GALA 4NNJA 3CNJA 2RF7A 2R45A 3KU9A 1NPXA 5KMQA 2YR4A 3SQPA 1N4UA 5KXJA 2YQUA 5FS7A 4H2QA 3EANA 1K0LA 4X9NA 1KF6A 2A87A 3AD8B 5KMPA 1Z6LA 1QJDA 4WX1A 2VOUA 1ELIA 1GPEA 1TDNA 3Q6JA 3RP7A 2R4EA 3VRAA 1JRZA 1GTHA 1LVLA 2IIDA 2TPRA 2VVLG 1B4VA 3KVEA 4GRTA 2BRYA 4USRA 4Z44A 3URHA 3V76A 3QVRA 2YVFA 2BXSA 3GRSA 1FT6A 3IWAA 4TM3A 2WPEA 2VZ2A 2WP6A 1RP0A 4FK1A 3UKKA 4G73A 5J7XA 1GRTA 3SFEA 1LTXR 1SP3A 2Y6RA 1ZK7A 1GOSA 2X3NA 3NKSA 2BACA 1IUWA 3KA7A 3CTYA 2C64A 3DJEA 3LZXA 1PBCA 4YSZA 4II2A 1JRYA 1ZOYA 1SEZA 4EM4A 3BNMA 4BK2A 5FMHA 5BUKA 1NG3A 4CY6A 2C65A 4L3YA 4UDRA 1YKJA 1O95A 4A6NB 4Q4UA 3DK4A 3T2YA 2ZZCA 1M1PA 3LGQA 2XYOA 5GRTA 2WHDA 1DXLA 2JAEA 2YG5A 1BF3A 2V3AA 2E80A 3V3NA 3CPJG 2R0CA 4Q5BA 4YKFA 3BNUA 1W4XA 4YTMA 2Q0LA 4U8LA 3UTEA 3ZDNA 2YG6A 5KVHA 3BNFA 3GMBA 4EQRA 1OAHA 4OPIA 4FDCB 3SY4A 5HXIA 3AEBA 3CPIG 4K5RA 4IVOB 3ICTA 1VG9A 2JB3A 1H84A 1S3EA 3P4PA 4GUVA 2BYBA 1CF3A 1CJ4A 5BRTA 4GAPA 3ICSA 1GSNA 2C76A 2YM1A 3ALLA 3IHMA 3UKQA 5KOXA 4OPCA 3EAOA 3K7TA 4NWZA 1F8SA 2V5ZA 4A99A 2XFPA 1GV4A 4BK1A 1VQWA 1M64A 3GDPA 1Q1WA 1P2HA 4A79A 5CKUA 2R4JA 2OLOA 3NN0X 3BNJA 3VRDB 4Q5CA 4GDPA 3S7WA 4UP3A 3GMCA 2X8CA 1GT8A 2FJBA 2JKCA 2VQ7A 1ZX9A 1GNDA 4H4QA 2H89A 3ALMA 1NAAA 3ICRA 4U8KA 2O9ZA 4YKGA 4DNAA 2GQFA 2HQMA 3G5RA 1H6VA 4IA6A 3SCEA 2JK6A 2RDZA 2GRTA 3GM6A 2RGHA 2YR6A 1Y56A 2EQ8A 4L38A 5HYMA 1D4CA 1HYUA 3FMWA 1BWCA 3ABVA 4U2SA 3AE7A 3SX6A 4B67A 3DJJA 4Z25A 1OJAA 4H4VA 3AE6A 4BJYA 4B65A 2QA2A 3UCLA 1ZOVA 2X99A 3IHGA 1FS8A 2Q7VA 4U8IA 2A89A 2GR2A 1DJNA 1LV0A 1JNZA 3AE4A 3E1TA 3TTBA 5IPYA 4IA5A 3LZWA 1NDAA 2PYXA 3G5QA 1E39A 2C7GA 4YSYA 1GU6A 2GMHA 4GAVA 4H4YA 3L1RA 3LG1A 1D7YA 2B9XA 2BS4A 2XFNA 3BNGA 3AE5A 3RP8A 2ZO5A 1NHRA 3K7QX 2YVGA 1E1MA 5M10A 4ZCDA 3K7MX 3DK8A 4D04A 1XANA 1PJ5A 2WBAA 1GRGA 4XWZA 1KNRA 2Q6UA 3T37A 1M1RA 2IVDA 1TRBA 3C4AA 3CGDA 1PJ7A 1H86A 1FECA 3CGBA 2BS3A 3NTAA 4JDRA 3V3OA 4CNJA 4ICYA 2GMJA 2YLTA 1PS9A 3OWMA 1IUUA 4L3ZA 3PO7A 3ISHA 3PS9A 4I59A 5TR3A 1FCDA 2GAHB 5M0ZA 1TDEA 2GR0A 2R0PA 1BVBA 3P4SA 1ZDLA 1S2QA 3NRNA 5GSNA 1L0VA 1E7PA 3CNSA 4Z24A 3RP6A 4HA6A 3SZCA 1XPQA 2C67A 4JY3A 4BJZA 5EOWA 4YSXA 2RGJA 4KPRA 5U25A 3BI2A 2WETA 4AT0A 3I3LA 4U8PA 3AYLA 1GETA 3BHKA 5HY5A 1PJ6A 1MO9A 3KKJA 1L9CA 3D1IA 2YVJA 3NT6A 1O94A 3M12A 1RSGA 3ATRA 4C74A 2RABA 3AE2A 1EBDA 3T2KA 2V61A 3C4NA 1ZMDA 2YM2A 4C77A 4Z43A 3NLCA 3UKHA 2R9ZA 1PXAA 3DMEA 4ECHA 1YQZA 3HYVA 4H4TA 4HB9A 2VQBA 3LJPA 3P4QA 3BNHA 1TDOA 3CNTA 2YLWA 3Q9TA 2OLNA 4H2PA 1KFYA 5FS9A 2GB0A 3AEDA 3GYJA 4U2TA 2FJAA 3KPFA 1QO8A 4J2WA 4RG3A 3LXDA 1CBOA 3DH9A 4P9SA 2XVHA 2YG4A 3DJDA 4CBQA 2BK3A 3CN8A 2K3VA 2GR1A 3UKFA 4B63A 3NTDA 4Q1OA 1GESA 2JB2A 1IUXA 4CRTA 4NTDA 1L9EA 3ADAB 2GV8A 3CMMA 2J7AA 3CIRA 3KLJA 4LU6A 4H4XA 2GEWA 3DK9A 4AT2A 4OPUA 1K0IA 1VG0A 2A8XA 3QVPA 1F6MA 1F8WA 4DSHA 4TM1A 4AOSA 4E0VA 4NTCA 2QCUA 2GQWA 3KPKA 5IQ4A 2QAEA 1YQ4A 3UBRA 3GD4A 3NK2X 1GRAA 2C70A 2EQ9A 2WOIA 3NN6X 4K5SA 4YWOA 3VR9A 1BZLA 3SZFA 4C3XA 2CVJA 3QFAA 3SYIA 3AXBA 2F5ZA 1CJ3A 3P9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVK X;  2E4G A;  2YLR A;  3P4R A;  2BK4 A;  4EQS A;  3JSK A;  2Z5X A;  4UDQ A;  1KDG A;  3S61 A;  4GCM A;  4C77 A;  1EL5 A;  2X50 A;  3ATQ A;  2X8H A;  4Y4M A;  1B5Q A;  2BAB A;  5HHF A;  3SGL A;  3UOX A;  1FL2 A;  1KSU A;  4ZN0 A;  5IQ1 A;  3G5S A;  1D5T A;  3AE9 A;  1H7X A;  1PXC A;  2QA1 A;  1H82 A;  3M0O A;  2OT4 A;  1BGN A;  4J57 A;  3UKA A;  5U63 A;  3DGZ A;  2XLR A;  2B7S A;  3CGC A;  3CPH G;  3EPT A;  1OJD A;  3AEF A;  4K22 A;  4X4J A;  1K0J A;  1PBD A;  4EMW A;  3GDN A;  5JCM A;  2R0G A;  1M6I A;  1PN0 A;  1PBE A;  3AYI A;  4K2X A;  1TDF A;  4TLX A;  1PHH A;  4CCQ A;  1E1L A;  4C3Y A;  1H83 A;  2VRL A;  3DGH A;  2RGO A;  1E1K A;  4BUR A;  4CY8 A;  2B9Y A;  3KD9 A;  1ZP0 A;  3UOY A;  1F3P A;  2XLP A;  5J60 A;  2C3D A;  2VRM A;  4U8O A;  1S2Y A;  2BK5 A;  4EMI A;  5KRQ A;  3RKH A;  4USQ A;  3HZL A;  4H4R A;  1MOK A;  4AOX A;  3FG2 P;  2YLS A;  4B1B A;  4B66 A;  4GF7 A;  4YSH A;  4EIP A;  1O5W A;  4FK1 C;  1IJH A;  1TYT A;  1P2E A;  2EQ6 A;  3QJ4 A;  1GRF A;  4H2N A;  2Y6Q A;  4Z2T A;  3GWD A;  2BS2 A;  3FIM B;  4J36 A;  2BC0 A;  1KSS A;  1N4V A;  2XFU A;  3CGE A;  5U1O A;  5C3J A;  5JCK A;  5CQF A;  3AD9 B;  4U8J A;  1LPF A;  3UKL A;  2UZZ A;  4EMJ A;  3QSE A;  1NHS A;  3II4 A;  4BV6 A;  1E6E A;  4AP3 A;  4AP1 A;  1JNI A;  3AD7 B;  4IVM B;  3AEA A;  1DOE A;  1NG4 A;  4NTE A;  4YT0 A;  4GDE A;  1B8S A;  1CC4 A;  3SFD A;  3AE8 A;  5JCL A;  4A7A A;  3SXQ A;  1B37 A;  3CND A;  2FBW A;  3M13 A;  2XLU A;  3GWF A;  1YY5 A;  4LII A;  4NEV A;  4O5Q A;  1GRB A;  3EF6 A;  1IUT A;  2FJE A;  2ZBW A;  1LJ1 A;  1JRX A;  3L1T A;  1DJQ A;  4IV9 A;  2XVI A;  4J33 A;  3GRT A;  2IVE A;  3UTH A;  2JB1 A;  4OPT A;  2V6O A;  2BCG G;  2WS3 A;  4XXG A;  1PDH A;  3OC4 A;  1D4D A;  1E1N A;  2E1M A;  2WP5 A;  1L9D A;  4H4U A;  1TYP A;  3P1W A;  4MJW A;  4Q17 A;  1IUV A;  2YLZ A;  3NYC A;  2TMD A;  3UTF A;  2XDO A;  4J34 A;  5BVA A;  3BHF A;  1F8R A;  4CCR A;  1N1P A;  3FPZ A;  4OCG A;  1UKV G;  3D1C A;  2APG A;  3H8L A;  1Y0P A;  1GRH A;  1FS7 A;  1EL9 A;  2YG3 A;  2WES A;  3COX A;  1OJ9 A;  4WJY A;  2LFC A;  4NEW A;  3GSI A;  3NYF A;  5KWF A;  3UKP A;  1EL7 A;  2ACZ A;  2V60 A;  4YTN A;  4Z2U A;  2Z5Y A;  5BUL A;  1REO A;  5KOW A;  2YWL A;  4APN A;  4H2R A;  1Y56 B;  1XHC A;  2GAG B;  3AE3 A;  1M1Q A;  3L8K A;  4EQW A;  2XLT A;  1LQU A;  3F8P A;  2PHH A;  4H4S A;  1IUS A;  1N4W A;  2XVJ A;  2XCG A;  3VR8 A;  4X9M A;  2DKI A;  4N9X A;  4OPD A;  2GH5 A;  1DOB A;  3LAD A;  3LB8 A;  3NH3 X;  2YLX A;  4FX9 A;  4ZCC A;  3SM8 A;  2ARD A;  2W0H A;  2WDQ A;  2X8G A;  2C3C A;  2C66 A;  2XFO A;  1GER A;  1YQ3 A;  2C75 A;  3B6D A;  2BA9 A;  4K7Z A;  3QSM A;  1ZKQ A;  1JU2 A;  2WP9 A;  3MMO A;  3NK1 X;  4Z2R A;  2AAQ A;  2B9W A;  1EL8 A;  4H50 A;  3NG7 X;  1MXT A;  4J56 A;  4UDP A;  1K4Q A;  3DJG X;  4JNQ A;  5EB5 A;  3NHO X;  3GD3 A;  4JY2 A;  4Y4L A;  1DNC A;  5KVI A;  1DOC A;  2JBV A;  2VVM A;  3NGC X;  3AE1 A;  3I6D A;  2BXR A;  1PBF A;  1TDK A;  3RHA A;  2WU2 A;  4Q0T A;  4B68 A;  4TLZ A;  1CL0 A;  4U8M A;  2Q0K A;  3NNE A;  2FJD A;  2DKH A;  1CHU A;  1X31 B;  1COY A;  2CDU A;  2WEU A;  3AWI A;  1NEN A;  1PXB A;  3D8X A;  2OAM A;  3GYI A;  2XFQ A;  2AQJ A;  3PVC A;  2E81 A;  3AEC A;  4L3X A;  2J3N A;  4B69 A;  4RSL A;  3UP4 A;  5EBK A;  4A9W A;  4A65 A;  4EM3 A;  3H4K A;  1ONF A;  1PBB A;  2ZZB A;  4REK A;  4WCT A;  3BI4 A;  2R46 A;  3F8R A;  4GR1 A;  3F29 A;  1NHQ A;  3GYX A;  1GTE A;  2WOV A;  3UP5 A;  2WU5 A;  2WDV A;  5FS6 A;  1FEB A;  3NK0 X;  4JNA A;  3WE0 A;  3IC9 A;  2BCP A;  4DSG A;  4NZH A;  3RNM A;  2YG7 A;  1D7L A;  4DGK A;  1DOD A;  4ADW A;  1JNR A;  2H88 A;  2YAU A;  4U2L A;  3S5W A;  1QDB A;  2CUL A;  1NHP A;  1XDI A;  3DA1 A;  5EB4 A;  1FS9 A;  3QSS A;  4RG4 A;  3UOZ A;  4H4P A;  4KX6 A;  1LQT A;  4EIQ A;  3FBS A;  3ALJ A;  2C73 A;  4OPG A;  3B3R A;  3OZ2 A;  5JCN A;  3C96 A;  2V3B A;  2WOW A;  1ZMC A;  4B64 A;  4OPL A;  1KNP A;  4YTP A;  3UU9 A;  1V59 A;  4BK3 A;  4YXD A;  1AOG A;  3H8I A;  2VVL A;  4LA1 A;  1VDC A;  3NYE A;  3UTG A;  3VQR A;  4OVI A;  3NIX A;  1NEK A;  3VRB A;  2WPC A;  4A6N A;  5JCI A;  4H7U A;  1QLB A;  4I58 A;  4Y4N A;  3F8D A;  2BC1 A;  1Q9I A;  4A5L A;  4EQX A;  3UOV A;  2EQ7 A;  4K8D A;  1JOA A;  1GEU A;  2GR3 A;  5LV9 A;  2WQY A;  3RED A;  2XVE A;  4H4W A;  4O5U A;  1GXF A;  2WDR A;  3FO3 A;  1VRQ B;  5DBJ A;  5ER0 A;  2NPX A;  5L46 A;  1H81 A;  3IF9 A;  4J31 A;  5FS8 A;  1CJ2 A;  4TM0 A;  1JEH A;  1GRE A;  2XLS A;  1BKW A;  2OAL A;  1FT5 A;  3TOR A;  2XVF A;  1CJC A;  4PAB A;  3LOV A;  4CNK A;  1OJC A;  4TM4 A;  1CC2 A;  4M52 A;  1FEA A;  3ITJ A;  2WPF A;  4XWR A;  2C72 A;  1FOH A;  4PAA A;  3K30 A;  3O0H A;  5C2T A;  4Z26 A;  2B7R A;  3QFB A;  1CC6 A;  2GF3 A;  2VR0 A;  1ZY8 A;  2AR8 A;  2B76 A;  2GVC A;  3AEE A;  2I0Z A;  4D03 A;  1RYI A;  3R9U A;  2OA1 A;  3BI5 A;  4JQ9 A;  3ZYX A;  3AEG A;  1BGJ A;  1H7W A;  2E5V A;  1OJT A;  4JN9 A;  1D4E A;  1S3B A;  2YR5 A;  4H4Z A;  2CFY A;  1Q1R A;  3AB1 A;  3CNP A;  2ZZ0 A;  4C5O A;  4U8N A;  3AYJ A;  1GAL A;  3CNJ A;  2RF7 A;  2R45 A;  3KU9 A;  1NPX A;  5KXJ A;  2YR4 A;  3SQP A;  1N4U A;  2YQU A;  5FS7 A;  4H2Q A;  3EAN A;  1K0L A;  4X9N A;  1KF6 A;  2A87 A;  3AD8 B;  1Z6L A;  1QJD A;  4WX1 A;  2VOU A;  1ELI A;  1GPE A;  1TDN A;  3Q6J A;  3RP7 A;  2R4E A;  3VRA A;  1JRZ A;  1GTH A;  1LVL A;  2IID A;  2TPR A;  2VVL G;  1B4V A;  3KVE A;  4GRT A;  4USR A;  4Z44 A;  3URH A;  3V76 A;  3QVR A;  2YVF A;  2BXS A;  3GRS A;  1FT6 A;  3IWA A;  4TM3 A;  2WPE A;  2VZ2 A;  2WP6 A;  1RP0 A;  4FK1 A;  3UKK A;  5J7X A;  3SFE A;  1GRT A;  1LTX R;  1SP3 A;  2Y6R A;  1ZK7 A;  1GOS A;  2X3N A;  3NKS A;  2BAC A;  1IUW A;  3KA7 A;  3CTY A;  2C64 A;  3DJE A;  3LZX A;  1PBC A;  4YSZ A;  1JRY A;  1ZOY A;  1SEZ A;  4EM4 A;  3BNM A;  4BK2 A;  5FMH A;  5BUK A;  1NG3 A;  4CY6 A;  2C65 A;  4L3Y A;  4UDR A;  1YKJ A;  1O95 A;  4A6N B;  4Q4U A;  3DK4 A;  2ZZC A;  1M1P A;  3LGQ A;  2XYO A;  5GRT A;  2WHD A;  1DXL A;  2JAE A;  2YG5 A;  1BF3 A;  2V3A A;  2E80 A;  3V3N A;  3CPJ G;  2R0C A;  4Q5B A;  4YKF A;  3BNU A;  1W4X A;  4YTM A;  2Q0L A;  4U8L A;  3UTE A;  3ZDN A;  2YG6 A;  5KVH A;  3BNF A;  3GMB A;  4EQR A;  1OAH A;  4OPI A;  4FDC B;  5HXI A;  3AEB A;  3CPI G;  4K5R A;  4IVO B;  3ICT A;  1VG9 A;  2JB3 A;  1H84 A;  1S3E A;  3P4P A;  4GUV A;  2BYB A;  1CF3 A;  1CJ4 A;  5BRT A;  3ICS A;  1GSN A;  2C76 A;  2YM1 A;  3ALL A;  3IHM A;  3UKQ A;  5KOX A;  4OPC A;  3EAO A;  3K7T A;  1F8S A;  2V5Z A;  4A99 A;  2XFP A;  1GV4 A;  4BK1 A;  1VQW A;  1M64 A;  3GDP A;  1Q1W A;  1P2H A;  4A79 A;  5CKU A;  2R4J A;  2OLO A;  3NN0 X;  3BNJ A;  3VRD B;  4Q5C A;  4GDP A;  3S7W A;  4UP3 A;  3GMC A;  2X8C A;  1GT8 A;  2FJB A;  2JKC A;  2VQ7 A;  1ZX9 A;  1GND A;  4H4Q A;  2H89 A;  3ALM A;  1NAA A;  3ICR A;  4U8K A;  2O9Z A;  4YKG A;  4DNA A;  2GQF A;  2HQM A;  3G5R A;  1H6V A;  4IA6 A;  3SCE A;  2JK6 A;  2RDZ A;  2GRT A;  3GM6 A;  2RGH A;  2YR6 A;  1Y56 A;  2EQ8 A;  4L38 A;  5HYM A;  1D4C A;  1HYU A;  3FMW A;  1BWC A;  3ABV A;  4U2S A;  3AE7 A;  4B67 A;  3DJJ A;  4Z25 A;  1OJA A;  4H4V A;  3AE6 A;  4BJY A;  4B65 A;  2QA2 A;  3UCL A;  1ZOV A;  2X99 A;  3IHG A;  1FS8 A;  2Q7V A;  4U8I A;  2A89 A;  2GR2 A;  1DJN A;  1LV0 A;  1JNZ A;  3AE4 A;  3E1T A;  3TTB A;  5IPY A;  4IA5 A;  3LZW A;  1NDA A;  2PYX A;  3G5Q A;  1E39 A;  2C7G A;  4YSY A;  1GU6 A;  2GMH A;  4H4Y A;  3L1R A;  3LG1 A;  1D7Y A;  2B9X A;  2BS4 A;  2XFN A;  3BNG A;  3AE5 A;  3RP8 A;  2ZO5 A;  1NHR A;  3K7Q X;  2YVG A;  1E1M A;  5M10 A;  4ZCD A;  3K7M X;  3DK8 A;  4D04 A;  1XAN A;  1PJ5 A;  2WBA A;  1GRG A;  4XWZ A;  1KNR A;  2Q6U A;  3T37 A;  1M1R A;  2IVD A;  1TRB A;  3C4A A;  3CGD A;  1PJ7 A;  1H86 A;  1FEC A;  3CGB A;  2BS3 A;  3NTA A;  4JDR A;  3V3O A;  4CNJ A;  4ICY A;  2GMJ A;  2YLT A;  1PS9 A;  3OWM A;  1IUU A;  4L3Z A;  3PO7 A;  3ISH A;  3PS9 A;  4I59 A;  5TR3 A;  1FCD A;  2GAH B;  5M0Z A;  1TDE A;  2GR0 A;  2R0P A;  1BVB A;  3P4S A;  1ZDL A;  1S2Q A;  3NRN A;  5GSN A;  1L0V A;  1E7P A;  3CNS A;  4Z24 A;  3RP6 A;  4HA6 A;  1XPQ A;  2C67 A;  4JY3 A;  4BJZ A;  5EOW A;  4YSX A;  2RGJ A;  4KPR A;  5U25 A;  3BI2 A;  2WET A;  4AT0 A;  3I3L A;  4U8P A;  3AYL A;  1GET A;  3BHK A;  5HY5 A;  1PJ6 A;  1MO9 A;  3KKJ A;  1L9C A;  3D1I A;  2YVJ A;  3NT6 A;  1O94 A;  3M12 A;  1RSG A;  3ATR A;  4C74 A;  2RAB A;  3AE2 A;  1EBD A;  2V61 A;  3C4N A;  1ZMD A;  2YM2 A;  4Z43 A;  3NLC A;  3UKH A;  2R9Z A;  1PXA A;  3DME A;  4ECH A;  1YQZ A;  4H4T A;  4HB9 A;  2VQB A;  3LJP A;  3P4Q A;  3BNH A;  1TDO A;  3CNT A;  2YLW A;  3Q9T A;  2OLN A;  4H2P A;  1KFY A;  5FS9 A;  2GB0 A;  3AED A;  3GYJ A;  4U2T A;  2FJA A;  3KPF A;  1QO8 A;  4J2W A;  4RG3 A;  3LXD A;  1CBO A;  3DH9 A;  4P9S A;  2XVH A;  2YG4 A;  3DJD A;  4CBQ A;  2BK3 A;  3CN8 A;  2K3V A;  2GR1 A;  3UKF A;  4B63 A;  3NTD A;  4Q1O A;  1GES A;  2JB2 A;  1IUX A;  4CRT A;  4NTD A;  1L9E A;  3ADA B;  2GV8 A;  2J7A A;  3CIR A;  3KLJ A;  4LU6 A;  4H4X A;  2GEW A;  3DK9 A;  4AT2 A;  4OPU A;  1K0I A;  1VG0 A;  2A8X A;  3QVP A;  1F6M A;  1F8W A;  4DSH A;  4TM1 A;  4AOS A;  4E0V A;  4NTC A;  2QCU A;  2GQW A;  5IQ4 A;  2QAE A;  1YQ4 A;  3UBR A;  3GD4 A;  3NK2 X;  1GRA A;  2C70 A;  2EQ9 A;  2WOI A;  3NN6 X;  4K5S A;  4YWO A;  3VR9 A;  1BZL A;  4C3X A;  2CVJ A;  3QFA A;  3AXB A;  2F5Z A;  1CJ3 A;  3P9U A; 
#chains in the Genus database with same CATH topology
 2NVK X;  2E4G A;  2YLR A;  3P4R A;  2BK4 A;  4EQS A;  3JSK A;  2Z5X A;  4UDQ A;  1KDG A;  4G74 A;  4GCM A;  3S61 A;  1EL5 A;  2X50 A;  3ATQ A;  2X8H A;  4Y4M A;  1B5Q A;  2BAB A;  5HHF A;  3SGL A;  3UOX A;  1FL2 A;  1KSU A;  4ZN0 A;  5IQ1 A;  3G5S A;  1D5T A;  3AE9 A;  1H7X A;  1PXC A;  2QA1 A;  1H82 A;  3M0O A;  2OT4 A;  1BGN A;  4J57 A;  3UKA A;  5U63 A;  3DGZ A;  2XLR A;  3SZ0 A;  2B7S A;  3CGC A;  3CPH G;  3EPT A;  1OJD A;  3AEF A;  4K22 A;  4X4J A;  1K0J A;  1PBD A;  4EMW A;  3GDN A;  5JCM A;  2R0G A;  1M6I A;  1PN0 A;  1PBE A;  3AYI A;  4K2X A;  1TDF A;  4TLX A;  1PHH A;  4CCQ A;  1E1L A;  4C3Y A;  1H83 A;  2VRL A;  3DGH A;  2RGO A;  1E1K A;  4BUR A;  4CY8 A;  3T31 A;  2B9Y A;  3KD9 A;  1ZP0 A;  3UOY A;  1F3P A;  2XLP A;  5J60 A;  2C3D A;  2VRM A;  4U8O A;  1S2Y A;  2BK5 A;  4EMI A;  5KRQ A;  3RKH A;  4USQ A;  3HZL A;  4H4R A;  1MOK A;  4AOX A;  3FG2 P;  2YLS A;  4B1B A;  4B66 A;  4GF7 A;  4YSH A;  4EIP A;  1O5W A;  4FK1 C;  1IJH A;  1TYT A;  1P2E A;  2EQ6 A;  3QJ4 A;  1GRF A;  4H2N A;  2Y6Q A;  4Z2T A;  3GWD A;  2BS2 A;  3FIM B;  4J36 A;  2BC0 A;  1KSS A;  1N4V A;  2XFU A;  3CGE A;  5U1O A;  5C3J A;  5JCK A;  5CQF A;  5KMS A;  3AD9 B;  4U8J A;  1LPF A;  3UKL A;  2UZZ A;  4EMJ A;  3QSE A;  1NHS A;  3II4 A;  4BV6 A;  1E6E A;  4AP3 A;  4AP1 A;  1JNI A;  3AD7 B;  4IVM B;  3AEA A;  1DOE A;  1NG4 A;  4NTE A;  3T2Z A;  4YT0 A;  4GDE A;  1B8S A;  3HYX A;  1CC4 A;  3SFD A;  3AE8 A;  5JCL A;  4A7A A;  3SXQ A;  1B37 A;  3CND A;  2FBW A;  3M13 A;  2XLU A;  3GWF A;  1YY5 A;  4LII A;  4NEV A;  4O5Q A;  1GRB A;  3EF6 A;  1IUT A;  2FJE A;  2ZBW A;  1LJ1 A;  1JRX A;  3L1T A;  1DJQ A;  4IV9 A;  2XVI A;  4J33 A;  3GRT A;  2IVE A;  3UTH A;  2JB1 A;  4OPT A;  2V6O A;  2BCG G;  2WS3 A;  4XXG A;  1PDH A;  3OC4 A;  3SXI A;  1D4D A;  1E1N A;  2E1M A;  2WP5 A;  1L9D A;  4H4U A;  1TYP A;  3P1W A;  4MJW A;  4Q17 A;  1IUV A;  2YLZ A;  3NYC A;  2TMD A;  3UTF A;  2XDO A;  4J34 A;  5BVA A;  3BHF A;  1F8R A;  4CCR A;  1N1P A;  3FPZ A;  4OCG A;  1UKV G;  3D1C A;  2APG A;  3H8L A;  1Y0P A;  1GRH A;  1FS7 A;  1EL9 A;  2YG3 A;  2WES A;  3COX A;  1OJ9 A;  4WJY A;  2LFC A;  4NEW A;  3GSI A;  3NYF A;  4G9K A;  5KWF A;  3UKP A;  1EL7 A;  2ACZ A;  2V60 A;  4YTN A;  4Z2U A;  2Z5Y A;  5BUL A;  1REO A;  5KOW A;  2YWL A;  4APN A;  4H2R A;  1Y56 B;  1XHC A;  2GAG B;  3AE3 A;  1M1Q A;  3L8K A;  4EQW A;  2XLT A;  1LQU A;  3F8P A;  2PHH A;  4H4S A;  1IUS A;  1N4W A;  2XVJ A;  2XCG A;  3VR8 A;  4X9M A;  2DKI A;  4N9X A;  4OPD A;  2GH5 A;  1DOB A;  3LAD A;  3LB8 A;  3NH3 X;  2YLX A;  4FX9 A;  4ZCC A;  3SM8 A;  2ARD A;  2W0H A;  2WDQ A;  2X8G A;  2C3C A;  2C66 A;  2XFO A;  1GER A;  1YQ3 A;  2C75 A;  3B6D A;  2BA9 A;  4K7Z A;  3QSM A;  1ZKQ A;  1JU2 A;  2WP9 A;  3MMO A;  3NK1 X;  4Z2R A;  2AAQ A;  2B9W A;  1EL8 A;  4H50 A;  3NG7 X;  1MXT A;  4J56 A;  4UDP A;  1K4Q A;  3DJG X;  4JNQ A;  5EB5 A;  3NHO X;  3GD3 A;  4JY2 A;  4Y4L A;  1DNC A;  5KVI A;  1DOC A;  2JBV A;  2VVM A;  3NGC X;  3AE1 A;  3SZW A;  3I6D A;  2BXR A;  1PBF A;  1TDK A;  3RHA A;  2WU2 A;  4Q0T A;  4B68 A;  4TLZ A;  1CL0 A;  4U8M A;  2Q0K A;  3NNE A;  2FJD A;  2DKH A;  1CHU A;  1X31 B;  1COY A;  2CDU A;  2WEU A;  3AWI A;  1NEN A;  1PXB A;  3D8X A;  2OAM A;  3GYI A;  2XFQ A;  2AQJ A;  2BRA A;  2E81 A;  3AEC A;  3PVC A;  4L3X A;  2J3N A;  4B69 A;  4RSL A;  3UP4 A;  5EBK A;  4A9W A;  4A65 A;  4EM3 A;  3H4K A;  1ONF A;  1PBB A;  2ZZB A;  4REK A;  4WCT A;  3BI4 A;  2R46 A;  3F8R A;  4GR1 A;  3F29 A;  1NHQ A;  3GYX A;  1GTE A;  5KNL A;  2WOV A;  3UP5 A;  4G6G A;  2WU5 A;  2WDV A;  5FS6 A;  1FEB A;  3T14 A;  3NK0 X;  4JNA A;  3WE0 A;  3HYW A;  3IC9 A;  2BCP A;  4DSG A;  4NZH A;  3RNM A;  2YG7 A;  2CZS A;  1D7L A;  4DGK A;  1DOD A;  4II3 A;  4ADW A;  1JNR A;  2H88 A;  2YAU A;  4U2L A;  3S5W A;  1QDB A;  2CUL A;  1NHP A;  1XDI A;  3DA1 A;  5EB4 A;  1FS9 A;  3QSS A;  4RG4 A;  3UOZ A;  4H4P A;  4KX6 A;  1LQT A;  4EIQ A;  3FBS A;  3ALJ A;  2C73 A;  4OPG A;  2C4C A;  3B3R A;  3OZ2 A;  5JCN A;  3C96 A;  2V3B A;  5KMR A;  2WOW A;  1ZMC A;  4B64 A;  4OPL A;  1KNP A;  4YTP A;  3UU9 A;  1V59 A;  4BK3 A;  4YXD A;  1AOG A;  3H8I A;  2VVL A;  4LA1 A;  1VDC A;  3NYE A;  3UTG A;  3VQR A;  4OVI A;  3NIX A;  1NEK A;  3VRB A;  2WPC A;  4A6N A;  5JCI A;  4H7U A;  1QLB A;  4I58 A;  4Y4N A;  3F8D A;  2BC1 A;  1Q9I A;  4A5L A;  4EQX A;  3UOV A;  2EQ7 A;  4K8D A;  1JOA A;  1GEU A;  2GR3 A;  5LV9 A;  2WQY A;  3RED A;  2XVE A;  4H4W A;  4O5U A;  1GXF A;  2WDR A;  3FO3 A;  1VRQ B;  5DBJ A;  5ER0 A;  2NPX A;  5L46 A;  1H81 A;  3IF9 A;  4G6H A;  4J31 A;  5FS8 A;  1CJ2 A;  4TM0 A;  1JEH A;  1GRE A;  2XLS A;  1BKW A;  3T0K A;  2OAL A;  1FT5 A;  3TOR A;  2XVF A;  1CJC A;  4PAB A;  3LOV A;  4CNK A;  1OJC A;  4TM4 A;  1CC2 A;  4M52 A;  1FEA A;  3ITJ A;  2WPF A;  4XWR A;  2C72 A;  1FOH A;  4PAA A;  3K30 A;  3O0H A;  5C2T A;  4Z26 A;  2B7R A;  3QFB A;  1CC6 A;  2GF3 A;  2VR0 A;  1ZY8 A;  2AR8 A;  2B76 A;  2GVC A;  3AEE A;  2I0Z A;  4D03 A;  1RYI A;  3R9U A;  2OA1 A;  3BI5 A;  4JQ9 A;  3ZYX A;  3AEG A;  1BGJ A;  1H7W A;  2E5V A;  1OJT A;  4JN9 A;  1D4E A;  1S3B A;  2YR5 A;  4H4Z A;  2CFY A;  1Q1R A;  3AB1 A;  3CNP A;  2ZZ0 A;  4C5O A;  4U8N A;  3AYJ A;  1GAL A;  4NNJ A;  3CNJ A;  2RF7 A;  2R45 A;  3KU9 A;  1NPX A;  5KMQ A;  2YR4 A;  3SQP A;  1N4U A;  5KXJ A;  2YQU A;  5FS7 A;  4H2Q A;  3EAN A;  1K0L A;  4X9N A;  1KF6 A;  2A87 A;  3AD8 B;  5KMP A;  1Z6L A;  1QJD A;  4WX1 A;  2VOU A;  1ELI A;  1GPE A;  1TDN A;  3Q6J A;  3RP7 A;  2R4E A;  3VRA A;  1JRZ A;  1GTH A;  1LVL A;  2IID A;  2TPR A;  2VVL G;  1B4V A;  3KVE A;  4GRT A;  2BRY A;  4USR A;  4Z44 A;  3URH A;  3V76 A;  3QVR A;  2YVF A;  2BXS A;  3GRS A;  1FT6 A;  3IWA A;  4TM3 A;  2WPE A;  2VZ2 A;  2WP6 A;  1RP0 A;  4FK1 A;  3UKK A;  4G73 A;  5J7X A;  1GRT A;  3SFE A;  1LTX R;  1SP3 A;  2Y6R A;  1ZK7 A;  1GOS A;  2X3N A;  3NKS A;  2BAC A;  1IUW A;  3KA7 A;  3CTY A;  2C64 A;  3DJE A;  3LZX A;  1PBC A;  4YSZ A;  4II2 A;  1JRY A;  1ZOY A;  1SEZ A;  4EM4 A;  3BNM A;  4BK2 A;  5FMH A;  5BUK A;  1NG3 A;  4CY6 A;  2C65 A;  4L3Y A;  4UDR A;  1YKJ A;  1O95 A;  4A6N B;  4Q4U A;  3DK4 A;  3T2Y A;  2ZZC A;  1M1P A;  3LGQ A;  2XYO A;  5GRT A;  2WHD A;  1DXL A;  2JAE A;  2YG5 A;  1BF3 A;  2V3A A;  2E80 A;  3V3N A;  3CPJ G;  2R0C A;  4Q5B A;  4YKF A;  3BNU A;  1W4X A;  4YTM A;  2Q0L A;  4U8L A;  3UTE A;  3ZDN A;  2YG6 A;  5KVH A;  3BNF A;  3GMB A;  4EQR A;  1OAH A;  4OPI A;  4FDC B;  3SY4 A;  5HXI A;  3AEB A;  3CPI G;  4K5R A;  4IVO B;  3ICT A;  1VG9 A;  2JB3 A;  1H84 A;  1S3E A;  3P4P A;  4GUV A;  2BYB A;  1CF3 A;  1CJ4 A;  5BRT A;  4GAP A;  3ICS A;  1GSN A;  2C76 A;  2YM1 A;  3ALL A;  3IHM A;  3UKQ A;  5KOX A;  4OPC A;  3EAO A;  3K7T A;  4NWZ A;  1F8S A;  2V5Z A;  4A99 A;  2XFP A;  1GV4 A;  4BK1 A;  1VQW A;  1M64 A;  3GDP A;  1Q1W A;  1P2H A;  4A79 A;  5CKU A;  2R4J A;  2OLO A;  3NN0 X;  3BNJ A;  3VRD B;  4Q5C A;  4GDP A;  3S7W A;  4UP3 A;  3GMC A;  2X8C A;  1GT8 A;  2FJB A;  2JKC A;  2VQ7 A;  1ZX9 A;  1GND A;  4H4Q A;  2H89 A;  3ALM A;  1NAA A;  3ICR A;  4U8K A;  2O9Z A;  4YKG A;  4DNA A;  2GQF A;  2HQM A;  3G5R A;  1H6V A;  4IA6 A;  3SCE A;  2JK6 A;  2RDZ A;  2GRT A;  3GM6 A;  2RGH A;  2YR6 A;  1Y56 A;  2EQ8 A;  4L38 A;  5HYM A;  1D4C A;  1HYU A;  3FMW A;  1BWC A;  3ABV A;  4U2S A;  3AE7 A;  3SX6 A;  4B67 A;  3DJJ A;  4Z25 A;  1OJA A;  4H4V A;  3AE6 A;  4BJY A;  4B65 A;  2QA2 A;  3UCL A;  1ZOV A;  2X99 A;  3IHG A;  1FS8 A;  2Q7V A;  4U8I A;  2A89 A;  2GR2 A;  1DJN A;  1LV0 A;  1JNZ A;  3AE4 A;  3E1T A;  3TTB A;  5IPY A;  4IA5 A;  3LZW A;  1NDA A;  2PYX A;  3G5Q A;  1E39 A;  2C7G A;  4YSY A;  1GU6 A;  2GMH A;  4GAV A;  4H4Y A;  3L1R A;  3LG1 A;  1D7Y A;  2B9X A;  2BS4 A;  2XFN A;  3BNG A;  3AE5 A;  3RP8 A;  2ZO5 A;  1NHR A;  3K7Q X;  2YVG A;  1E1M A;  5M10 A;  4ZCD A;  3K7M X;  3DK8 A;  4D04 A;  1XAN A;  1PJ5 A;  2WBA A;  1GRG A;  4XWZ A;  1KNR A;  2Q6U A;  3T37 A;  1M1R A;  2IVD A;  1TRB A;  3C4A A;  3CGD A;  1PJ7 A;  1H86 A;  1FEC A;  3CGB A;  2BS3 A;  3NTA A;  4JDR A;  3V3O A;  4CNJ A;  4ICY A;  2GMJ A;  2YLT A;  1PS9 A;  3OWM A;  1IUU A;  4L3Z A;  3PO7 A;  3ISH A;  3PS9 A;  4I59 A;  5TR3 A;  1FCD A;  2GAH B;  5M0Z A;  1TDE A;  2GR0 A;  2R0P A;  1BVB A;  3P4S A;  1ZDL A;  1S2Q A;  3NRN A;  5GSN A;  1L0V A;  1E7P A;  3CNS A;  4Z24 A;  3RP6 A;  4HA6 A;  3SZC A;  1XPQ A;  2C67 A;  4JY3 A;  4BJZ A;  5EOW A;  4YSX A;  2RGJ A;  4KPR A;  5U25 A;  3BI2 A;  2WET A;  4AT0 A;  3I3L A;  4U8P A;  3AYL A;  1GET A;  3BHK A;  5HY5 A;  1PJ6 A;  1MO9 A;  3KKJ A;  1L9C A;  3D1I A;  2YVJ A;  3NT6 A;  1O94 A;  3M12 A;  1RSG A;  3ATR A;  4C74 A;  2RAB A;  3AE2 A;  1EBD A;  3T2K A;  2V61 A;  3C4N A;  1ZMD A;  2YM2 A;  4C77 A;  4Z43 A;  3NLC A;  3UKH A;  2R9Z A;  1PXA A;  3DME A;  4ECH A;  1YQZ A;  3HYV A;  4H4T A;  4HB9 A;  2VQB A;  3LJP A;  3P4Q A;  3BNH A;  1TDO A;  3CNT A;  2YLW A;  3Q9T A;  2OLN A;  4H2P A;  1KFY A;  5FS9 A;  2GB0 A;  3AED A;  3GYJ A;  4U2T A;  2FJA A;  3KPF A;  1QO8 A;  4J2W A;  4RG3 A;  3LXD A;  1CBO A;  3DH9 A;  4P9S A;  2XVH A;  2YG4 A;  3DJD A;  4CBQ A;  2BK3 A;  3CN8 A;  2K3V A;  2GR1 A;  3UKF A;  4B63 A;  3NTD A;  4Q1O A;  1GES A;  2JB2 A;  1IUX A;  4CRT A;  4NTD A;  1L9E A;  3ADA B;  2GV8 A;  3CMM A;  2J7A A;  3CIR A;  3KLJ A;  4LU6 A;  4H4X A;  2GEW A;  3DK9 A;  4AT2 A;  4OPU A;  1K0I A;  1VG0 A;  2A8X A;  3QVP A;  1F6M A;  1F8W A;  4DSH A;  4TM1 A;  4AOS A;  4E0V A;  4NTC A;  2QCU A;  2GQW A;  3KPK A;  5IQ4 A;  2QAE A;  1YQ4 A;  3UBR A;  3GD4 A;  3NK2 X;  1GRA A;  2C70 A;  2EQ9 A;  2WOI A;  3NN6 X;  4K5S A;  4YWO A;  3VR9 A;  1BZL A;  3SZF A;  4C3X A;  2CVJ A;  3QFA A;  3SYI A;  3AXB A;  2F5Z A;  1CJ3 A;  3P9U A; 
#chains in the Genus database with same CATH homology
 2NVK X;  2E4G A;  2YLR A;  3P4R A;  2BK4 A;  4EQS A;  3JSK A;  2Z5X A;  4UDQ A;  1KDG A;  4G74 A;  4GCM A;  3S61 A;  1EL5 A;  2X50 A;  3ATQ A;  2X8H A;  4Y4M A;  1B5Q A;  2BAB A;  5HHF A;  3SGL A;  3UOX A;  1FL2 A;  1KSU A;  4ZN0 A;  5IQ1 A;  3G5S A;  1D5T A;  3AE9 A;  1H7X A;  1PXC A;  2QA1 A;  1H82 A;  3M0O A;  2OT4 A;  1BGN A;  4J57 A;  3UKA A;  5U63 A;  3DGZ A;  2XLR A;  3SZ0 A;  2B7S A;  3CGC A;  3CPH G;  3EPT A;  1OJD A;  3AEF A;  4K22 A;  4X4J A;  1K0J A;  1PBD A;  4EMW A;  3GDN A;  5JCM A;  2R0G A;  1M6I A;  1PN0 A;  1PBE A;  3AYI A;  4K2X A;  1TDF A;  4TLX A;  1PHH A;  4CCQ A;  1E1L A;  4C3Y A;  1H83 A;  2VRL A;  3DGH A;  2RGO A;  1E1K A;  4BUR A;  4CY8 A;  3T31 A;  2B9Y A;  3KD9 A;  1ZP0 A;  3UOY A;  1F3P A;  2XLP A;  5J60 A;  2C3D A;  2VRM A;  4U8O A;  1S2Y A;  2BK5 A;  4EMI A;  5KRQ A;  3RKH A;  4USQ A;  3HZL A;  4H4R A;  1MOK A;  4AOX A;  3FG2 P;  2YLS A;  4B1B A;  4B66 A;  4GF7 A;  4YSH A;  4EIP A;  1O5W A;  4FK1 C;  1IJH A;  1TYT A;  1P2E A;  2EQ6 A;  3QJ4 A;  1GRF A;  4H2N A;  2Y6Q A;  4Z2T A;  3GWD A;  2BS2 A;  3FIM B;  4J36 A;  2BC0 A;  1KSS A;  1N4V A;  2XFU A;  3CGE A;  5U1O A;  5C3J A;  5JCK A;  5CQF A;  5KMS A;  3AD9 B;  4U8J A;  1LPF A;  3UKL A;  2UZZ A;  4EMJ A;  3QSE A;  1NHS A;  3II4 A;  4BV6 A;  1E6E A;  4AP3 A;  4AP1 A;  1JNI A;  3AD7 B;  4IVM B;  3AEA A;  1DOE A;  1NG4 A;  4NTE A;  3T2Z A;  4YT0 A;  4GDE A;  1B8S A;  3HYX A;  1CC4 A;  3SFD A;  3AE8 A;  5JCL A;  4A7A A;  3SXQ A;  1B37 A;  3CND A;  2FBW A;  3M13 A;  2XLU A;  3GWF A;  1YY5 A;  4LII A;  4NEV A;  4O5Q A;  1GRB A;  3EF6 A;  1IUT A;  2FJE A;  2ZBW A;  1LJ1 A;  1JRX A;  3L1T A;  1DJQ A;  4IV9 A;  2XVI A;  4J33 A;  3GRT A;  2IVE A;  3UTH A;  2JB1 A;  4OPT A;  2V6O A;  2BCG G;  2WS3 A;  4XXG A;  1PDH A;  3OC4 A;  3SXI A;  1D4D A;  1E1N A;  2E1M A;  2WP5 A;  1L9D A;  4H4U A;  1TYP A;  3P1W A;  4MJW A;  4Q17 A;  1IUV A;  2YLZ A;  3NYC A;  2TMD A;  3UTF A;  2XDO A;  4J34 A;  5BVA A;  3BHF A;  1F8R A;  4CCR A;  1N1P A;  3FPZ A;  4OCG A;  1UKV G;  3D1C A;  2APG A;  3H8L A;  1Y0P A;  1GRH A;  1FS7 A;  1EL9 A;  2YG3 A;  2WES A;  3COX A;  1OJ9 A;  4WJY A;  2LFC A;  4NEW A;  3GSI A;  3NYF A;  4G9K A;  5KWF A;  3UKP A;  1EL7 A;  2ACZ A;  2V60 A;  4YTN A;  4Z2U A;  2Z5Y A;  5BUL A;  1REO A;  5KOW A;  2YWL A;  4APN A;  4H2R A;  1Y56 B;  1XHC A;  2GAG B;  3AE3 A;  1M1Q A;  3L8K A;  4EQW A;  2XLT A;  1LQU A;  3F8P A;  2PHH A;  4H4S A;  1IUS A;  1N4W A;  2XVJ A;  2XCG A;  3VR8 A;  4X9M A;  2DKI A;  4N9X A;  4OPD A;  2GH5 A;  1DOB A;  3LAD A;  3LB8 A;  3NH3 X;  2YLX A;  4FX9 A;  4ZCC A;  3SM8 A;  2ARD A;  2W0H A;  2WDQ A;  2X8G A;  2C3C A;  2C66 A;  2XFO A;  1GER A;  1YQ3 A;  2C75 A;  3B6D A;  2BA9 A;  4K7Z A;  3QSM A;  1ZKQ A;  1JU2 A;  2WP9 A;  3MMO A;  3NK1 X;  4Z2R A;  2AAQ A;  2B9W A;  1EL8 A;  4H50 A;  3NG7 X;  1MXT A;  4J56 A;  4UDP A;  1K4Q A;  3DJG X;  4JNQ A;  5EB5 A;  3NHO X;  3GD3 A;  4JY2 A;  4Y4L A;  1DNC A;  5KVI A;  1DOC A;  2JBV A;  2VVM A;  3NGC X;  3AE1 A;  3SZW A;  3I6D A;  2BXR A;  1PBF A;  1TDK A;  3RHA A;  2WU2 A;  4Q0T A;  4B68 A;  4TLZ A;  1CL0 A;  4U8M A;  2Q0K A;  3NNE A;  2FJD A;  2DKH A;  1CHU A;  1X31 B;  1COY A;  2CDU A;  2WEU A;  3AWI A;  1NEN A;  1PXB A;  3D8X A;  2OAM A;  3GYI A;  2XFQ A;  2AQJ A;  2BRA A;  2E81 A;  3AEC A;  3PVC A;  4L3X A;  2J3N A;  4B69 A;  4RSL A;  3UP4 A;  5EBK A;  4A9W A;  4A65 A;  4EM3 A;  3H4K A;  1ONF A;  1PBB A;  2ZZB A;  4REK A;  4WCT A;  3BI4 A;  2R46 A;  3F8R A;  4GR1 A;  3F29 A;  1NHQ A;  3GYX A;  1GTE A;  5KNL A;  2WOV A;  3UP5 A;  4G6G A;  2WU5 A;  2WDV A;  5FS6 A;  1FEB A;  3T14 A;  3NK0 X;  4JNA A;  3WE0 A;  3HYW A;  3IC9 A;  2BCP A;  4DSG A;  4NZH A;  3RNM A;  2YG7 A;  1D7L A;  4DGK A;  1DOD A;  4II3 A;  4ADW A;  1JNR A;  2H88 A;  2YAU A;  4U2L A;  3S5W A;  1QDB A;  2CUL A;  1NHP A;  1XDI A;  3DA1 A;  5EB4 A;  1FS9 A;  3QSS A;  4RG4 A;  3UOZ A;  4H4P A;  4KX6 A;  1LQT A;  4EIQ A;  3FBS A;  3ALJ A;  2C73 A;  4OPG A;  2C4C A;  3B3R A;  3OZ2 A;  5JCN A;  3C96 A;  2V3B A;  5KMR A;  2WOW A;  1ZMC A;  4B64 A;  4OPL A;  1KNP A;  4YTP A;  3UU9 A;  1V59 A;  4BK3 A;  4YXD A;  1AOG A;  3H8I A;  2VVL A;  4LA1 A;  1VDC A;  3NYE A;  3UTG A;  3VQR A;  4OVI A;  3NIX A;  1NEK A;  3VRB A;  2WPC A;  4A6N A;  5JCI A;  4H7U A;  1QLB A;  4I58 A;  4Y4N A;  3F8D A;  2BC1 A;  1Q9I A;  4A5L A;  4EQX A;  3UOV A;  2EQ7 A;  4K8D A;  1JOA A;  1GEU A;  2GR3 A;  5LV9 A;  2WQY A;  3RED A;  2XVE A;  4H4W A;  4O5U A;  1GXF A;  2WDR A;  3FO3 A;  1VRQ B;  5DBJ A;  5ER0 A;  2NPX A;  5L46 A;  1H81 A;  3IF9 A;  4G6H A;  4J31 A;  5FS8 A;  1CJ2 A;  4TM0 A;  1JEH A;  1GRE A;  2XLS A;  1BKW A;  3T0K A;  2OAL A;  1FT5 A;  3TOR A;  2XVF A;  1CJC A;  4PAB A;  3LOV A;  4CNK A;  1OJC A;  4TM4 A;  1CC2 A;  4M52 A;  1FEA A;  3ITJ A;  2WPF A;  4XWR A;  2C72 A;  1FOH A;  4PAA A;  3K30 A;  3O0H A;  5C2T A;  4Z26 A;  2B7R A;  3QFB A;  1CC6 A;  2GF3 A;  2VR0 A;  1ZY8 A;  2AR8 A;  2B76 A;  2GVC A;  3AEE A;  2I0Z A;  4D03 A;  1RYI A;  3R9U A;  2OA1 A;  3BI5 A;  4JQ9 A;  3ZYX A;  3AEG A;  1BGJ A;  1H7W A;  2E5V A;  1OJT A;  4JN9 A;  1D4E A;  1S3B A;  2YR5 A;  4H4Z A;  2CFY A;  1Q1R A;  3AB1 A;  3CNP A;  2ZZ0 A;  4C5O A;  4U8N A;  3AYJ A;  1GAL A;  4NNJ A;  3CNJ A;  2RF7 A;  2R45 A;  3KU9 A;  1NPX A;  5KMQ A;  2YR4 A;  3SQP A;  1N4U A;  5KXJ A;  2YQU A;  5FS7 A;  4H2Q A;  3EAN A;  1K0L A;  4X9N A;  1KF6 A;  2A87 A;  3AD8 B;  5KMP A;  1Z6L A;  1QJD A;  4WX1 A;  2VOU A;  1ELI A;  1GPE A;  1TDN A;  3Q6J A;  3RP7 A;  2R4E A;  3VRA A;  1JRZ A;  1GTH A;  1LVL A;  2IID A;  2TPR A;  2VVL G;  1B4V A;  3KVE A;  4GRT A;  2BRY A;  4USR A;  4Z44 A;  3URH A;  3V76 A;  3QVR A;  2YVF A;  2BXS A;  3GRS A;  1FT6 A;  3IWA A;  4TM3 A;  2WPE A;  2VZ2 A;  2WP6 A;  1RP0 A;  4FK1 A;  3UKK A;  4G73 A;  5J7X A;  1GRT A;  3SFE A;  1LTX R;  1SP3 A;  2Y6R A;  1ZK7 A;  1GOS A;  2X3N A;  3NKS A;  2BAC A;  1IUW A;  3KA7 A;  3CTY A;  2C64 A;  3DJE A;  3LZX A;  1PBC A;  4YSZ A;  4II2 A;  1JRY A;  1ZOY A;  1SEZ A;  4EM4 A;  3BNM A;  4BK2 A;  5FMH A;  5BUK A;  1NG3 A;  4CY6 A;  2C65 A;  4L3Y A;  4UDR A;  1YKJ A;  1O95 A;  4A6N B;  4Q4U A;  3DK4 A;  3T2Y A;  2ZZC A;  1M1P A;  3LGQ A;  2XYO A;  5GRT A;  2WHD A;  1DXL A;  2JAE A;  2YG5 A;  1BF3 A;  2V3A A;  2E80 A;  3V3N A;  3CPJ G;  2R0C A;  4Q5B A;  4YKF A;  3BNU A;  1W4X A;  4YTM A;  2Q0L A;  4U8L A;  3UTE A;  3ZDN A;  2YG6 A;  5KVH A;  3BNF A;  3GMB A;  4EQR A;  1OAH A;  4OPI A;  4FDC B;  3SY4 A;  5HXI A;  3AEB A;  3CPI G;  4K5R A;  4IVO B;  3ICT A;  1VG9 A;  2JB3 A;  1H84 A;  1S3E A;  3P4P A;  4GUV A;  2BYB A;  1CF3 A;  1CJ4 A;  5BRT A;  4GAP A;  3ICS A;  1GSN A;  2C76 A;  2YM1 A;  3ALL A;  3IHM A;  3UKQ A;  5KOX A;  4OPC A;  3EAO A;  3K7T A;  4NWZ A;  1F8S A;  2V5Z A;  4A99 A;  2XFP A;  1GV4 A;  4BK1 A;  1VQW A;  1M64 A;  3GDP A;  1Q1W A;  1P2H A;  4A79 A;  5CKU A;  2R4J A;  2OLO A;  3NN0 X;  3BNJ A;  3VRD B;  4Q5C A;  4GDP A;  3S7W A;  4UP3 A;  3GMC A;  2X8C A;  1GT8 A;  2FJB A;  2JKC A;  2VQ7 A;  1ZX9 A;  1GND A;  4H4Q A;  2H89 A;  3ALM A;  1NAA A;  3ICR A;  4U8K A;  2O9Z A;  4YKG A;  4DNA A;  2GQF A;  2HQM A;  3G5R A;  1H6V A;  4IA6 A;  3SCE A;  2JK6 A;  2RDZ A;  2GRT A;  3GM6 A;  2RGH A;  2YR6 A;  1Y56 A;  2EQ8 A;  4L38 A;  5HYM A;  1D4C A;  1HYU A;  3FMW A;  1BWC A;  3ABV A;  4U2S A;  3AE7 A;  3SX6 A;  4B67 A;  3DJJ A;  4Z25 A;  1OJA A;  4H4V A;  3AE6 A;  4BJY A;  4B65 A;  2QA2 A;  3UCL A;  1ZOV A;  2X99 A;  3IHG A;  1FS8 A;  2Q7V A;  4U8I A;  2A89 A;  2GR2 A;  1DJN A;  1LV0 A;  1JNZ A;  3AE4 A;  3E1T A;  3TTB A;  5IPY A;  4IA5 A;  3LZW A;  1NDA A;  2PYX A;  3G5Q A;  1E39 A;  2C7G A;  4YSY A;  1GU6 A;  2GMH A;  4GAV A;  4H4Y A;  3L1R A;  3LG1 A;  1D7Y A;  2B9X A;  2BS4 A;  2XFN A;  3BNG A;  3AE5 A;  3RP8 A;  2ZO5 A;  1NHR A;  3K7Q X;  2YVG A;  1E1M A;  5M10 A;  4ZCD A;  3K7M X;  3DK8 A;  4D04 A;  1XAN A;  1PJ5 A;  2WBA A;  1GRG A;  4XWZ A;  1KNR A;  2Q6U A;  3T37 A;  1M1R A;  2IVD A;  1TRB A;  3C4A A;  3CGD A;  1PJ7 A;  1H86 A;  1FEC A;  3CGB A;  2BS3 A;  3NTA A;  4JDR A;  3V3O A;  4CNJ A;  4ICY A;  2GMJ A;  2YLT A;  1PS9 A;  3OWM A;  1IUU A;  4L3Z A;  3PO7 A;  3ISH A;  3PS9 A;  4I59 A;  5TR3 A;  1FCD A;  2GAH B;  5M0Z A;  1TDE A;  2GR0 A;  2R0P A;  1BVB A;  3P4S A;  1ZDL A;  1S2Q A;  3NRN A;  5GSN A;  1L0V A;  1E7P A;  3CNS A;  4Z24 A;  3RP6 A;  4HA6 A;  3SZC A;  1XPQ A;  2C67 A;  4JY3 A;  4BJZ A;  5EOW A;  4YSX A;  2RGJ A;  4KPR A;  5U25 A;  3BI2 A;  2WET A;  4AT0 A;  3I3L A;  4U8P A;  3AYL A;  1GET A;  3BHK A;  5HY5 A;  1PJ6 A;  1MO9 A;  3KKJ A;  1L9C A;  3D1I A;  2YVJ A;  3NT6 A;  1O94 A;  3M12 A;  1RSG A;  3ATR A;  4C74 A;  2RAB A;  3AE2 A;  1EBD A;  3T2K A;  2V61 A;  3C4N A;  1ZMD A;  2YM2 A;  4C77 A;  4Z43 A;  3NLC A;  3UKH A;  2R9Z A;  1PXA A;  3DME A;  4ECH A;  1YQZ A;  3HYV A;  4H4T A;  4HB9 A;  2VQB A;  3LJP A;  3P4Q A;  3BNH A;  1TDO A;  3CNT A;  2YLW A;  3Q9T A;  2OLN A;  4H2P A;  1KFY A;  5FS9 A;  2GB0 A;  3AED A;  3GYJ A;  4U2T A;  2FJA A;  3KPF A;  1QO8 A;  4J2W A;  4RG3 A;  3LXD A;  1CBO A;  3DH9 A;  4P9S A;  2XVH A;  2YG4 A;  3DJD A;  4CBQ A;  2BK3 A;  3CN8 A;  2K3V A;  2GR1 A;  3UKF A;  4B63 A;  3NTD A;  4Q1O A;  1GES A;  2JB2 A;  1IUX A;  4CRT A;  4NTD A;  1L9E A;  3ADA B;  2GV8 A;  3CMM A;  2J7A A;  3CIR A;  3KLJ A;  4LU6 A;  4H4X A;  2GEW A;  3DK9 A;  4AT2 A;  4OPU A;  1K0I A;  1VG0 A;  2A8X A;  3QVP A;  1F6M A;  1F8W A;  4DSH A;  4TM1 A;  4AOS A;  4E0V A;  4NTC A;  2QCU A;  2GQW A;  3KPK A;  5IQ4 A;  2QAE A;  1YQ4 A;  3UBR A;  3GD4 A;  3NK2 X;  1GRA A;  2C70 A;  2EQ9 A;  2WOI A;  3NN6 X;  4K5S A;  4YWO A;  3VR9 A;  1BZL A;  3SZF A;  4C3X A;  2CVJ A;  3QFA A;  3SYI A;  3AXB A;  2F5Z A;  1CJ3 A;  3P9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...