The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
155
|
structure length |
155
|
Chain Sequence |
MNYEIKQEEKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPAEKLRCDTVVTVPGYFTLPENSEGVILTEITGGQYAVAVARVVGDDFAKPWYQFFNSLLQDSAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the Escherichia coli SbmC protein that protects cells from the DNA replication inhibitor microcin B17.
pubmed doi rcsb |
| molecule keywords |
DNA Gyrase inhibitory protein
|
| molecule tags |
Unknown function
|
| source organism |
Escherichia coli
|
| total genus |
39
|
| structure length |
155
|
| sequence length |
155
|
| ec nomenclature | |
| pdb deposition date | 2001-09-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF14526 | Cass2 | Integron-associated effector binding protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Barrel | Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A | Regulatory factor, effector binding domain |
#chains in the Genus database with same CATH superfamily 5KAU A; 3Q5P A; 3Q3D A; 3Q5R A; 5GQQ A; 1R8E A; 3Q2Y A; 3B49 A; 3R8J A; 4A1M A; 4B0Y A; 3GK6 A; 3D6Y A; 3D70 A; 5KAW A; 1D5Y A; 5KAV A; 4AYZ B; 5KAX A; 3LUR A; 5KAT A; 3D6Z A; 4AYZ A; 3Q1M A; 3D71 A; 3Q5S A; 5KCB A; 2KCU A; 3E0H A; 3R8K A; 3IAO A; 1EXI A; 2HVA A; 1JYH A; 1EXJ A; 1BOW A; 2BOW A; 2GOV A; #chains in the Genus database with same CATH topology 5KAU A; 3Q5P A; 3Q3D A; 3Q5R A; 5GQQ A; 1R8E A; 3Q2Y A; 3B49 A; 3R8J A; 4A1M A; 4B0Y A; 3GK6 A; 3D6Y A; 3D70 A; 5KAW A; 1D5Y A; 5KAV A; 4AYZ B; 5KAX A; 3LUR A; 5KAT A; 3D6Z A; 4AYZ A; 3Q1M A; 3D71 A; 3Q5S A; 5KCB A; 2KCU A; 3E0H A; 3R8K A; 3IAO A; 1EXI A; 2HVA A; 1JYH A; 1EXJ A; 1BOW A; 2BOW A; 2GOV A; #chains in the Genus database with same CATH homology 5KAU A; 3Q5P A; 3Q3D A; 3Q5R A; 5GQQ A; 1R8E A; 3Q2Y A; 3B49 A; 3R8J A; 4A1M A; 4B0Y A; 3GK6 A; 3D6Y A; 3D70 A; 5KAW A; 1D5Y A; 5KAV A; 4AYZ B; 5KAX A; 3LUR A; 5KAT A; 3D6Z A; 4AYZ A; 3Q1M A; 3D71 A; 3Q5S A; 5KCB A; 2KCU A; 3E0H A; 3R8K A; 3IAO A; 1EXI A; 2HVA A; 1JYH A; 1EXJ A; 1BOW A; 2BOW A; 2GOV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...