3Q1MA

Crystal structure of bmrr dimer bound to dna and the ligand 4-amino-quinaldine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q1mA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q1mA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q1mA03
3T97B 2HVAA 3D71A 3Q3DA 2ZHGA 2ZHHA 5KATA 5KAXA 5I41B 4WLSA 2BOWA 3LURA 5D8CA 3D6YA 3Q5PA 3D70A 3E0HA 4A1MA 4B0YA 3R8JA 1Q06A 4WLWA 3Q1MA 5E01A 2J5UA 2OQQA 3HH0A 2KCUA 3GK6A 5D90A 1Q09A 3G9RA 3IAOA 1R8EA 3GP4A 5KAUA 5GQQA 3B49A 5KAWA 1D5YA 2DG6A 1JYHA 3GPVA 4J2NA 4R24B 4R4LA 1DIPA 3R8KA 1JBGA 4AYZA 3QAOA 1Q0AA 4R22B 1Q05A 3UCSA 1Q08A 3Q5SA 1R8DA 4AYZB 5I44A 1BOWA 4R4EA 3Q5RA 1EXIA 5KAVA 3D6ZA 1Q07A 2JMLA 2VZ4A 1EXJA 3Q2YA 5KCBA 4R4MA 2GOVA
chains in the Genus database with same CATH superfamily
1FZCC 1KV4A 5KLIC 1Q7YQ 1BCCJ 1NU1E 2OARA 3R8JA 2M3BA 1QL1A 3FWLA 5AW0B 3FXEA 4PV1C 1A02F 3VMZA 1KB9I 1NTMG 5AVTB 3USSA 2K9JB 2B87B 1J1DB 1KQGB 1S2EA 1M1JB 3V2QA 1NU1J 2ZAEB 1URQD 4Z1MH 5AW8B 2KI7B 4TT3H 3HUSA 2XDJA 4AQRD 1SFCD 2LXBA 5I44A 3H1HG 3H1LD 3EZ2A 5C39A 2W83C 1YHQP 3VOPA 4JF7A 1IJDB 5AW3B 2IZ1A 1ZXGA 1N73A 4U3FD 3II6A 3BATA 4I1LA 1VF5C 3A0BH 1VQLP 1NGMB 4U3FG 2Y9ZA 2OYHB 2JO1A 1S1CX 3VMXA 4ASVA 4UB6E 1Z56A 5KLVJ 1VQOP 1GMJA 1VL2A 1S9KE 3V4QA 3E0HA 1BE3E 2RKLA 3WU2E 1URQB 5KLVK 3RL0B 1QVFO 1CI6A 1JY2P 1USEA 3P8MC 3BCCE 1LTAC 3GHGC 2E5YA 4H0LC 2C9LY 2Q7CA 1OWAA 2BCCJ 3AE7C 1EZVD 3LIEA 2I8DA 4PD4I 1PFIA 1HTLC 1NTKK 1PPJD 2NRGA 2AXTE 3CWBJ 2E74D 2V7QJ 1Y6UA 2WPVB 1L0LK 2WSFH 3L71J 1LTIC 1OZHA 1R5LA 1R8EA 5GTHE 2E43A 3L74D 3UCSA 1SQPK 3KHUA 1HF9A 3G3ZA 3TGUE 5CBOA 3N4XA 1EZVI 4HKZH 5APWA 1LT1A 4OVNF 3HD7B 2Q1KA 2XNDH 3H1HE 5CJ0A 1PIXA 2BCCG 1EQ7A 1LWUB 1JTHA 3RL0C 1IK9A 2N1TA 2YKPA 4H0LD 1EC5A 1N73B 3LW5J 2K37A 2WSEJ 5AVXB 1ZR4A 3GP4A 1W2EA 2D2CD 5CJ4A 5CCHD 2W6AA 1YI2P 1SFCA 3AE1C 4I2LC 1NVOA 3AE4C 3NTNA 2V7QH 1R5SA 2QJPC 3AE6C 2FYUK 1H0TA 2CPBA 1Q90D 3IR9A 2QJYB 2H43A 2K3RA 2HR3A 3CXHD 1E79H 2XZRA 1IO4A 4KJMA 3H1HJ 1GW4A 5KAXA 3BCCG 1JO5A 1AA0A 3AE2C 3CCRP 5AW7B 1FDMA 1RF1A 1CW5A 3IAOA 4ZNCA 2WT7B 4R4LA 1CI6B 1NH4A 5B5EE 3M9HA 4GKGA 2R3CA 2WMMA 1HJBA 5APXA 3M0AA 3H1JD 1VQKP 1LTSC 1J1EC 3L71D 2C9NY 1BDCA 2A45G 1S5LX 1YJNP 5KJ7A 3L71E 1BOWA 3VYIA 3Q5RA 3TSIA 1GK4A 2JEEA 1KILE 4N3YB 2IBZI 1EZVE 5KAIE 2QJPB 4L75A 4C46A 4WBAA 1IFPA 5TJHA 3NXSA 4R4EA 4GOFA 1VQ8P 2BCCE 1KMIZ 1KB9H 1M1KQ 5BVZA 2YIUC 1WRGA 3PLNA 1AVOA 1L4AB 1MV8A 3S9OA 3A7OA 3L72D 5KLVE 3L74G 2FYUE 2WSCH 3A0HE 1NTKD 1KZUB 3WMM0 5KAWA 1RHZB 3EQ2A 1KD1Q 3OAKA 3H1IG 3HTKA 1J1DC 1SLQA 2HODB 4DJGA 1NJIQ 4CPGA 3C9IA 3B5NC 1NKNA 1GU4A 1FDIA 1ZP0C 3GHGB 1LWUC 1LGHB 3L70D 3OJAB 1BSNA 1N86A 3GPVA 2FYNC 2KIKA 1SP4A 3AE8C 3FX0A 5AVYB 2WSEH 1RE4A 3AEGC 3BRVB 3H1LG 1IFIA 1ZW0A 4IL6E 4W80A 1PPJE 1KORA 2JP3A 2QIWA 2FXOA 1VF5B 3BVHA 1FZBA 3L35A 4JYCA 4AUWA 1DEBA 1N7SD 4H13C 3V4WA 3A5TA 1Q08A 5CBNA 2P58A 2WPSA 3KPEA 3L73G 4JBZA 1SQQJ 2ZYGA 1AFOA 1HGZA 3E1RA 1SQVE 1YBKA 2KSEA 2R5BA 2ZT9D 1GL2B 2WPQA 1H88A 3MIWA 1DX7A 1SQVD 1H89A 5KLVD 1HWTC 2AEMA 2BCCD 3WUUA 4GDOA 1W2BO 1IFMA 1PP9D 1NU1D 4UB8E 3Q3DA 3BCCJ 2LXCB 1FJKA 2L5GB 2KZJA 1JTHB 4EIJA 3R8KA 4EOTA 1XTCC 1SQBJ 3QH9A 2PP6A 2C0WA 2WSSH 4N6JA 1RF0A 2ZT9B 2KNCA 5TISE 2Z4EA 1RY3A 3H32B 4RO0A 1YITP 2QVAA 1MKMA 2L91A 4M3LA 4UB8H 1X79B 1VQ6P 2WSFJ 1HVVA 3RK2B 4BXLA 1VQ5P 2OYIB 2P2UA 3V5BA 3EZFA 2QJKB 2H89C 1T6AA 2HG5D 1JNMA 1DD4A 3L74J 5CCHC 1FZCB 3CC2P 4A1MA 3L73E 1LT9A 1PPJG 3JSVC 2JKVA 1MFZA 3SFDC 3KYQA 3GLMA 3RK3C 3U59A 3CWBD 3CLQA 1L0NK 1ZRTE 3G6EP 1L2PA 3NFQA 1SS1A 3F5HA 2XV5A 1KILC 2BEZF 4DCZA 4H13B 5DJTB 1LNQA 2QJYC 3P7KA 3CI9A 1HH0A 2J59M 3IFMA 3CCEP 1SQVJ 1BGYG 1N7SB 1DIPA 1RF0C 1JBGA 3C8VA 1S72P 1EXIA 4N78E 3H1LJ 5CCGA 4LLHA 1BGYE 3GF3A 1K04A 5KAIH 1WMKA 3G9RA 2B87A 3FGAD 3L75J 4R22B 4RESB 2IDBA 3CX5H 3CX5D 4AYCA 1WT6A 3H1IJ 2AXTH 3B8EB 1NTZE 2AXCA 1PGOA 1U7MA 5D8CA 2KS1B 3AEBC 4W7ZA 1N2DC 3WUTA 3H25A 5KAUA 3CMEP 5GTHH 3L37A 2E75D 1RF1C 1Q86Q 4Y28J 1PP9J 2RH0A 3O6QA 1GZLA 2IYPA 4DZOA 3BCCD 3AE5C 1SQBG 2H8PD 2ZXEB 5I41B 3LURA 3PRJA 2IYOA 5EFWB 4JYBA 1M8OB 4BRYA 3CCQP 1SQBD 4D6TE 3EFFK 1NAYA 4XA4A 2FFDA 1NTKJ 3L4FA 5DJUB 3HE4A 4OGQB 1KQLA 3PHLA 2KLUA 1L0NJ 3CC4P 4KT0J 2YMKA 3B5ND 4W7YA 1RE3C 2Q9IA 1JOCA 2R3SA 3H1JJ 3KXDA 2IBZG 3HD7D 1P84I 3AE3C 2K9YA 2FKWB 5E79E 2ZHHA 1URQC 1P84D 1SQPJ 1GL2A 4HH2A 1MZ9A 2E76B 1XTGB 4H0LB 3Q5SA 3O8ZA 3FXDA 3JCUH 4I7ZB 3RGUA 1RQVA 3B5NB 2HYNA 3H1JG 3AECC 1OX3A 5CCHA 5KAFE 1GK6A 4EYYQ 5KLIB 2Y0EA 1VQ7P 2C0XA 1IFDA 2HFED 2HVAA 3FWNA 1OVRA 1JY2N 4OGQC 3GF7A 1KILD 1JB0J 4ZMDA 3KDPB 2JJLA 3A0BE 2ZVNB 4D6TD 3W67A 2I1JA 1RH6A 2FYUD 3VMYA 2A06G 2M5AA 4RKUJ 4LHFA 5CHXA 1L0LE 2RMZA 2O01H 1GL2C 5APTA 5AVZB 3M9QA 1EDIA 2Y0DA 2P7JA 3LW5H 5APQA 3TGUD 2E74C 1IK7A 2ZFCA 2GUVA 1ZN5A 1H0TB 2NPSB 3AEAC 1L0LG 2BASA 2WQYC 5M1BA 1KQFB 1LTTC 3TDKA 2IBZE 1LP1B 3Q5PA 2ZYDA 2JDIH 1LT9B 1HGVA 2KUBA 1FC2C 3JC22 5B5EH 1M1JA 1U57A 2OTLP 2OTKE 4DCKA 1D7MA 1EZVG 3OW2O 4L73A 2A45H 1U7JA 3EZ6A 1FE6A 1T2KC 1ZMEC 3RK2D 3I56P 5B66E 3D6YA 2ZVOB 2KZIA 2YKOA 1KYOE 1EDJA 4NPFX 1NTKG 2QJKC 3SSUA 3V2PA 5AW4B 1JCCA 3B5NA 5AVSB 2YXQB 3V2NA 1EDKA 4Y99C 3HD7A 4U3FE 5APYA 3RK3B 3H1KE 3AEDC 3E7KA 3Q1MA 4PD4E 5GQQA 1W5CE 3VP8A 1KILB 1FDOA 5KTBA 3G4SP 1JY2O 3RBXA 2E74B 2V4HA 1VQMP 1RF1B 1JY3O 1IFJA 1L0ND 2M8RA 1L0LD 2KS1A 2DW3A 2OQQA 1VF5D 1BE3J 4NPDA 1NKZB 2IBZD 2POHA 4OGQD 1JY3N 5AW2B 3CPWO 1L4AD 2QEXP 2WPRA 5AW1B 3SWFA 1BE3G 3TK1A 2PAJA 1YJWP 1NTMK 1NTMD 1BCCD 3MUDC 1KQSO 2NPSA 4BRYB 4HYTB 4RJTA 1JYHA 4J2NA 1LP1A 1KILA 1NTMJ 1SQVG 1OMIA 1SQXK 4YPCA 1H8AA 2GOVA 2BOWA 1G1JA 3SWKA 1MUUA 3H1HD 2P67A 3KZIH 3QWOC 4WY4C 4OH8B 5CMZA 5KJ7C 1M7LA 2FXMA 2Z5HA 1LWUA 3CXHH 4C7NB 1LTJB 3L75D 1OW6A 3H1KD 4I7ZC 2FYNB 5GTIH 1M90Q 4L74A 5D90A 1L0NE 2E76D 5AW5B 3E1IA 1NO4A 2N9YB 2WZ7A 3S1KA 1Q05A 1M57D 2YNYA 2KOGA 3CL3D 4WVZA 2CPSA 1FU1A 2QSIA 1RE3A 3GW6A 3L70G 1SQVK 1N7SC 4K35A 3P8CE 3CD6P 3MUDA 3S4RA 5KKZB 1NTME 2DG6A 4R24B 3K5BA 4ZKPA 2GUSA 2PRRA 4KHXA 1TU3F 1DEEG 1J1EB 1SVFA 1P84H 1FBMA 1FJPA 2AEJA 2KLVA 4EI2A 2J58A 3MD0A 1X8YA 2OYIC 3EWKA 2YO2A 1BSHA 3JCUE 3D6ZA 2OTJP 3EZ7A 3SFEC 1NTZK 2K88A 3M91A 3TNUB 1BDDA 2E76C 1GU5A 1LTBC 3L70J 1S5LH 2G8YA 3L72J 2Q6QA 2O01J 1Q07A 2PGDA 2O1JA 3AEEC 3H1KJ 1L4AA 1JCDA 3M0DA 1S9KD 2WITA 3U1AA 1JUNA 5CCGD 4HJGH 1Q2NA 1PV3A 4PV1D 2WTYA 1SQQK 1LTJA 2XNXA 3ABVC 2PFXA 1SQPD 1UIIA 5KAVA 4B86A 2K9JA 3GHGA 5KATA 2QG4A 2HPCB 4Y99B 3PP5A 3L71G 2N9BA 1SQQD 1GD2E 3RK3E 2LKMA 4H13D 2FYZA 4UB6H 4IFMA 2O01N 2QM7A 3KQGA 1VQNP 3L70E 1PGJA 1OVUA 4ASWA 2KNCB 2BEQD 1S4XA 2FYUG 3MP7B 3CCSP 4NPEA 1OW7A 3TYYA 4QMAA 3BASA 2JWDA 5B66H 3L73D 3H1IE 1KTMA 1IC2A 2YMYA 5KAFH 1CSBA 1QX8A 3TF5A 1DH3A 1K9MQ 4LGDE 2D2CB 3MHVA 4PJ0E 5BU5A 3OA7A 3HUSB 2R44A 2Z5IA 3P8CD 4ZKUA 1MFTA 3SWYA 1T8ZA 4AYZA 3F89A 4YTPC 1GL2D 3ZDMA 1JM0A 3MGNA 1SFCC 1ZR2A 4H44D 1PM6A 3CCMP 1FZCA 2E75C 1YTZT 2XKMA 1Q09A 1SQPG 1NYHA 1T3UA 2CK3H 2FY8A 1LT9C 2W6JH 3M9BA 1NTZD 1P84E 3HE5B 1NAFA 4GT1A 2R32A 1G1IA 3CCLP 4PV1B 2QA4P 4AYZB 1L0LJ 2KXPB 2IFMA 2SPZA 3O6QB 4WWIA 1G2CB 1OXZA 3IN6A 4XFJA 4TLFA 1JY3P 2Y0CA 2A06E 4D6TJ 3L74E 1SQBK 1Q0AA 3W68A 1PZQA 1LX8A 4A7PA 1SFCB 2OYOA 5L8RJ 1AVYA 3RK3D 4C7NA 4IFFA 1ZRTD 4YXDC 3VN0A 3L75E 2IX7C 5KLVG 1X22A 2JMLA 1X0TA 1T2KD 4BWNA 1YJ9P 5AW9B 3HTKB 2W90A 3CC7P 1AQ5A 1AQTA 3NMDA 1FZGA 2W6BA 1SQPE 1K05A 4N78D 1HUCA 1QLED 2WT7A 5AVUB 3HE4B 2N1TC 1J2JB 2UWJE 1FS0E 4WLSA 1BGYD 2E5TA 3I55P 1KYOH 5E01A 3WU2H 1IFNA 5GTIE 4L76A 2R5DA 1BCCE 1K73Q 3IF4A 3U1CA 3CXHE 2A06D 3ITKA 2M3EA 3LIDA 1QEXA 2W8ZA 2Q3IA 3CWBG 2HPCA 3CXHI 1KB9D 3P32A 1Q82Q 2KB7P 2NPSC 1NHLA 1DD3A 3M0DC 2Q3EA 3QAOA 1FOSE 3B4SA 4OWFA 3AEFC 1KFMA 1FOSF 2M5AB 1CZQA 2QE7H 3L72E 3C1LA 5CCGC 2GM4A 1PP9E 4B0YA 5TISH 4U7JA 1PGQA 1YYCA 1RQUA 1S3JA 4MN4C 2NPSD 1PP9G 4JPZB 1RE4C 3V2RA 3RL0g 1NTZJ 2D2CC 3TNUA 3T97A 4D6TG 3HUSC 3R4YA 2J5UA 2N1TD 3N7NA 3KZIE 2RN0A 2ZYAA 1N8RQ 2IFNA 1KC8Q 1JEKA 2MKVA 4PJ0H 2VZ4A 3Q2YA 4K3AA 5APUA 2O3JA 1AV1A 1N7LA 1OVVA 2QM8A 2KK7A 3L75G 3G71P 3H1LE 5APSA 1Q06A 2FYUJ 2M0BA 2WWWA 1AJYA 3HH0A 1YQ3C 1SQXD 4PD4H 1UIXA 3A2AA 2KSJA 5H2FE 4HB1A 2IZ0A 1R8DA 1EDLA 3CCVP 1NU1G 2B89A 2ZXXA 3I5CA 1OIPA 2HODA 1QGKB 1BGYJ 3GMAA 1USDA 4PD4D 4WLWA 2LR2A 2H7HA 4DT0A 1VQ9P 1VPCA 5H2FH 2I1KA 2ITAA 3H1JE 3L73J 1LTGC 2WSCJ 1JMMA 1BCCG 3H1ID 2B88A 1E5WA 2KYVA 1HJ0A 3D71A 2OYHC 2IPPA 1LJ2A 2KCUA 4IOIH 5AVQB 3VMAA 1PL5A 1KYOI 3L72G 2G3AA 3BRTB 2OYIA 3VTPC 2E42A 1S5LE 1OW8A 4IL6H 3CX5I 3RK2C 3A3YB 2E75B 3MTUE 5AVVB 1G2CA 3GG2A 1ZOYC 3PH0A 2OGUA 2ZHGA 4WY4B 1T3JA 5KJ7D 2FFDC 3L36A 3R2PA 4WY4D 1FZAA 3A0HH 1D5YA 1NOHA 1LTJC 1Y9BA 1ZV8A 4JQ0D 3UIAA 3WUVA 2K1AA 2ZJSE 5E79H 1GTWA 3HD7C 1L4AC 4YXWH 3PTZA 5K5GB 3EZ9A 1SQXJ 1YTZI 2Q5UA 3RL0D 1KFNA 5AVWB 3B49A 2FXPA 2H88C 4LC1A 2JR8A 3HE5A 1NTZG 1QVGO 1OFCX 3CX5E 1Y47A 4WB4A 1GW3A 1JMBA 5KKZC 5AW6B 1KN7A 3D70A 2N1TB 2IEFA 1KYOD 4DOJA 2JWAA 2W27A 1NWQA 4XE5B 4GOEA 2P10A 2O1KA 5AVRB 2YKQA 2A45I 4H44B 5APVA 4I6MC 3MZWB 4EDFA 1URQA 2KP8A 2GA1A 3H32A 1N73C 1RH5B 5BU8B 2FFDB 3TGUG 3B71A 1QL2A 2B9BA 2MJZA 3H1KG 3TGUJ 1SQQG 1PGPA 1EXJA 3M06A 1NTKE 3V6IA 1N7SA 1Y8AA 1L0NG 4O9BA 4GIFA 2P1JA 1NU1K 1SQQE 3H6PA 1YIJP 3HRNA 2Y9YA 4GODA 1K8AQ 1VQPP 3CWBE 3CCUP 5KCBA 4R4MA 1Q81Q 2KVVA 2FBWC 3PJSK 2YXRB 2QRXA 3AE9C 3RBZA 1FZEA 4IFDK 4H44C 1SQXG 1X9VA 3T97B 1ZLLA 2ZT9C 1VQ4P 1M1JC 2HLOA 2OYHA 3CMAP 3GK6A 2NZ2A 2XU6A 1SQXE 1SQBE 1A02J 3CCJP 4U3FJ 1FAVA 2YO3A 4IL6X 2OG0A 2AEFA 4WY4A 2WVRA 1KB9E 1HBWA 1GDTA 3VP9A 2YIUB 1IZNB 2VRSA 1FZFA 1BE3D 1VDFA 1YQ4C 4C7RA 3EFGA 1M56D
chains in the Genus database with same CATH topology
3AE1C 1PM6A 2YIUC 2BEZF 3Q3DA 1ZOYC 5KLIC 4H0LC 2ZHGA 4RKUJ 5KATA 3AE4C 3S9OA 4DCZA 4H13B 4KT0J 2YMKA 3AE7C 2QJYC 2E75C 4LHFA 2QJPC 3AE6C 3R4YA 3R8JA 2J5UA 2OQQA 1Q90D 1VF5D 1Q09A 4OGQD 3RK3E 5KAWA 1D5YA 2DG6A 1NYHA 1Y9BA 3R8KA 4R24B 4PV1C 1DIPA 1JBGA 3C8VA 2MKVA 2E74C 3AE3C 4H13D 1IK7A 1EXIA 1TU3F 2VZ4A 1K05A 3AEAC 3Q2YA 5KCBA 2WQYC 4R4MA 5M1BA 1KQFB 2E74D 2V7QJ 2K9YA 2KVVA 1Y6UA 2FBWC 1KQGB 2ZHHA 2ZT9B 2WPVB 5KAXA 4WLSA 1FDIA 1ZP0C 3GF3A 1K04A 3AE2C 3Q5PA 3EZ9A 3AE9C 1Q06A 1AJYA 5E01A 4Z1MH 3HH0A 1WMKA 1YQ3C 1UIXA 3IAOA 3G9RA 1R8EA 2E76B 4TT3H 3B49A 2FXPA 4PV1B 2H88C 1JYHA 3GPVA 4J2NA 2FYNC 4R4LA 3FGAD 1U57A 4H0LB 3UCSA 4R22B 3Q5SA 4AYZB 3AE8C 1R8DA 3EWKA 5I44A 2BEQD 1OMIA 2IDBA 4H44C 1HF9A 3AEGC 1MKMA 3D6ZA 1OW7A 3EZ2A 3EZ7A 1KORA 4I7ZB 3SFEC 2JP3A 2GOVA 3T97B 3IN6A 3EZ6A 2ZT9C 4XFJA 1RQVA 2QIWA 2BOWA 1ZMEC 5KKZC 5D8CA 2E76C 3AECC 3D6YA 1VF5B 3D70A 2WSFJ 3GMAA 4WLWA 3AEBC 1KTMA 2IEFA 1PIXA 3GK6A 2NZ2A 2QJKC 3H25A 1DD3A 4H13C 5KAUA 1VF5C 1S5LX 3QAOA 1Q0AA 2E75D 1Q08A 2P10A 1NGMB 4IL6X 3EZFA 1BOWA 2D2CB 2OG0A 2G8YA 2H89C 3Q5RA 2JO1A 2WSCJ 3AEFC 4H0LD 4H44B 1S1CX 4Y28J 1LX8A 2O01J 1Q07A 3O6QA 1DD4A 3LW5J 3AEEC 1KILE 2WSEJ 2HVAA 1HJ0A 3D71A 1GMJA 5L8RJ 3AE5C 1VL2A 1OW6A 5I41B 3LURA 4I7ZC 4OGQC 3E0HA 4A1MA 4B0YA 3GF7A 2ZT9D 3AEDC 2KCUA 3Q1MA 5D90A 3RL0g 4U7JA 1JB0J 3SFDC 1PV3A 4PV1D 3GP4A 1PL5A 5GQQA 3GLMA 3B71A 2E76D 4AYZA 2G3AA 1ZRTE 1RQUA 1Q05A 4YTPC 3ABVC 2D2CD 1FDOA 4YXDC 2QSIA 4R4EA 1YQ4C 2E74B 5KAVA 1RH6A 1OW8A 4GDOA 2JMLA 1KMIZ 1EXJA 2E75B 4H44D 2D2CC 4OGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T97 B;  2HVA A;  3D71 A;  3Q3D A;  2ZHG A;  2ZHH A;  5KAT A;  5KAX A;  5I41 B;  4WLS A;  2BOW A;  3LUR A;  5D8C A;  3D6Y A;  3Q5P A;  3D70 A;  3E0H A;  4A1M A;  4B0Y A;  3R8J A;  1Q06 A;  4WLW A;  3Q1M A;  5E01 A;  2J5U A;  2OQQ A;  3HH0 A;  2KCU A;  3GK6 A;  5D90 A;  1Q09 A;  3G9R A;  3IAO A;  1R8E A;  3GP4 A;  5KAU A;  5GQQ A;  3B49 A;  5KAW A;  1D5Y A;  2DG6 A;  1JYH A;  3GPV A;  4J2N A;  4R24 B;  4R4L A;  1DIP A;  3R8K A;  1JBG A;  4AYZ A;  3QAO A;  1Q0A A;  4R22 B;  1Q05 A;  3UCS A;  1Q08 A;  3Q5S A;  1R8D A;  4AYZ B;  5I44 A;  1BOW A;  4R4E A;  3Q5R A;  1EXI A;  5KAV A;  3D6Z A;  1Q07 A;  2JML A;  2VZ4 A;  1EXJ A;  3Q2Y A;  5KCB A;  4R4M A;  2GOV A; 
#chains in the Genus database with same CATH topology
 1FZC C;  1KV4 A;  5KLI C;  1Q7Y Q;  1BCC J;  1NU1 E;  2OAR A;  3R8J A;  2M3B A;  1QL1 A;  3FWL A;  5AW0 B;  3FXE A;  4PV1 C;  1A02 F;  3VMZ A;  1KB9 I;  1NTM G;  5AVT B;  3USS A;  2K9J B;  2B87 B;  1J1D B;  1KQG B;  1S2E A;  1M1J B;  3V2Q A;  1NU1 J;  2ZAE B;  1URQ D;  4Z1M H;  5AW8 B;  2KI7 B;  4TT3 H;  3HUS A;  2XDJ A;  4AQR D;  1SFC D;  2LXB A;  5I44 A;  3H1H G;  3H1L D;  3EZ2 A;  5C39 A;  2W83 C;  1YHQ P;  3VOP A;  4JF7 A;  1IJD B;  5AW3 B;  2IZ1 A;  1ZXG A;  1N73 A;  4U3F D;  3II6 A;  3BAT A;  4I1L A;  1VF5 C;  3A0B H;  1VQL P;  1NGM B;  4U3F G;  2Y9Z A;  2OYH B;  2JO1 A;  1S1C X;  3VMX A;  4ASV A;  4UB6 E;  1Z56 A;  5KLV J;  1VQO P;  1GMJ A;  1VL2 A;  1S9K E;  3V4Q A;  3E0H A;  1BE3 E;  2RKL A;  3WU2 E;  1URQ B;  5KLV K;  3RL0 B;  1QVF O;  1CI6 A;  1JY2 P;  1USE A;  3P8M C;  3BCC E;  1LTA C;  3GHG C;  2E5Y A;  4H0L C;  2C9L Y;  2Q7C A;  1OWA A;  2BCC J;  3AE7 C;  1EZV D;  3LIE A;  2I8D A;  4PD4 I;  1PFI A;  1HTL C;  1NTK K;  1PPJ D;  2NRG A;  2AXT E;  3CWB J;  2E74 D;  2V7Q J;  1Y6U A;  2WPV B;  1L0L K;  2WSF H;  3L71 J;  1LTI C;  1OZH A;  1R5L A;  1R8E A;  5GTH E;  2E43 A;  3L74 D;  3UCS A;  1SQP K;  3KHU A;  1HF9 A;  3G3Z A;  3TGU E;  5CBO A;  3N4X A;  1EZV I;  4HKZ H;  5APW A;  1LT1 A;  4OVN F;  3HD7 B;  2Q1K A;  2XND H;  3H1H E;  5CJ0 A;  1PIX A;  2BCC G;  1EQ7 A;  1LWU B;  1JTH A;  3RL0 C;  1IK9 A;  2N1T A;  2YKP A;  4H0L D;  1EC5 A;  1N73 B;  3LW5 J;  2K37 A;  2WSE J;  5AVX B;  1ZR4 A;  3GP4 A;  1W2E A;  2D2C D;  5CJ4 A;  5CCH D;  2W6A A;  1YI2 P;  1SFC A;  3AE1 C;  4I2L C;  1NVO A;  3AE4 C;  3NTN A;  2V7Q H;  1R5S A;  2QJP C;  3AE6 C;  2FYU K;  1H0T A;  2CPB A;  1Q90 D;  3IR9 A;  2QJY B;  2H43 A;  2K3R A;  2HR3 A;  3CXH D;  1E79 H;  2XZR A;  1IO4 A;  4KJM A;  3H1H J;  1GW4 A;  5KAX A;  3BCC G;  1JO5 A;  1AA0 A;  3AE2 C;  3CCR P;  5AW7 B;  1FDM A;  1RF1 A;  1CW5 A;  3IAO A;  4ZNC A;  2WT7 B;  4R4L A;  1CI6 B;  1NH4 A;  5B5E E;  3M9H A;  4GKG A;  2R3C A;  2WMM A;  1HJB A;  5APX A;  3M0A A;  3H1J D;  1VQK P;  1LTS C;  1J1E C;  3L71 D;  2C9N Y;  1BDC A;  2A45 G;  1S5L X;  1YJN P;  5KJ7 A;  3L71 E;  1BOW A;  3VYI A;  3Q5R A;  3TSI A;  1GK4 A;  2JEE A;  1KIL E;  4N3Y B;  2IBZ I;  1EZV E;  5KAI E;  2QJP B;  4L75 A;  4C46 A;  4WBA A;  1IFP A;  5TJH A;  3NXS A;  4R4E A;  4GOF A;  1VQ8 P;  2BCC E;  1KMI Z;  1KB9 H;  1M1K Q;  5BVZ A;  2YIU C;  1WRG A;  3PLN A;  1AVO A;  1L4A B;  1MV8 A;  3S9O A;  3A7O A;  3L72 D;  5KLV E;  3L74 G;  2FYU E;  2WSC H;  3A0H E;  1NTK D;  1KZU B;  3WMM 0;  5KAW A;  1RHZ B;  3EQ2 A;  1KD1 Q;  3OAK A;  3H1I G;  3HTK A;  1J1D C;  1SLQ A;  2HOD B;  4DJG A;  1NJI Q;  4CPG A;  3C9I A;  3B5N C;  1NKN A;  1GU4 A;  1FDI A;  1ZP0 C;  3GHG B;  1LWU C;  1LGH B;  3L70 D;  3OJA B;  1BSN A;  1N86 A;  3GPV A;  2FYN C;  2KIK A;  1SP4 A;  3AE8 C;  3FX0 A;  5AVY B;  2WSE H;  1RE4 A;  3AEG C;  3BRV B;  3H1L G;  1IFI A;  1ZW0 A;  4IL6 E;  4W80 A;  1PPJ E;  1KOR A;  2JP3 A;  2QIW A;  2FXO A;  1VF5 B;  3BVH A;  1FZB A;  3L35 A;  4JYC A;  4AUW A;  1DEB A;  1N7S D;  4H13 C;  3V4W A;  3A5T A;  1Q08 A;  5CBN A;  2P58 A;  2WPS A;  3KPE A;  3L73 G;  4JBZ A;  1SQQ J;  2ZYG A;  1AFO A;  1HGZ A;  3E1R A;  1SQV E;  1YBK A;  2KSE A;  2R5B A;  2ZT9 D;  1GL2 B;  2WPQ A;  1H88 A;  3MIW A;  1DX7 A;  1SQV D;  1H89 A;  5KLV D;  1HWT C;  2AEM A;  2BCC D;  3WUU A;  4GDO A;  1W2B O;  1IFM A;  1PP9 D;  1NU1 D;  4UB8 E;  3Q3D A;  3BCC J;  2LXC B;  1FJK A;  2L5G B;  2KZJ A;  1JTH B;  4EIJ A;  3R8K A;  4EOT A;  1XTC C;  1SQB J;  3QH9 A;  2PP6 A;  2C0W A;  2WSS H;  4N6J A;  1RF0 A;  2ZT9 B;  2KNC A;  5TIS E;  2Z4E A;  1RY3 A;  3H32 B;  4RO0 A;  1YIT P;  2QVA A;  1MKM A;  2L91 A;  4M3L A;  4UB8 H;  1X79 B;  1VQ6 P;  2WSF J;  1HVV A;  3RK2 B;  4BXL A;  1VQ5 P;  2OYI B;  2P2U A;  3V5B A;  3EZF A;  2QJK B;  2H89 C;  1T6A A;  2HG5 D;  1JNM A;  1DD4 A;  3L74 J;  5CCH C;  1FZC B;  3CC2 P;  4A1M A;  3L73 E;  1LT9 A;  1PPJ G;  3JSV C;  2JKV A;  1MFZ A;  3SFD C;  3KYQ A;  3GLM A;  3RK3 C;  3U59 A;  3CWB D;  3CLQ A;  1L0N K;  1ZRT E;  3G6E P;  1L2P A;  3NFQ A;  1SS1 A;  3F5H A;  2XV5 A;  1KIL C;  2BEZ F;  4DCZ A;  4H13 B;  5DJT B;  1LNQ A;  2QJY C;  3P7K A;  3CI9 A;  1HH0 A;  2J59 M;  3IFM A;  3CCE P;  1SQV J;  1BGY G;  1N7S B;  1DIP A;  1RF0 C;  1JBG A;  3C8V A;  1S72 P;  1EXI A;  4N78 E;  3H1L J;  5CCG A;  4LLH A;  1BGY E;  3GF3 A;  1K04 A;  5KAI H;  1WMK A;  3G9R A;  2B87 A;  3FGA D;  3L75 J;  4R22 B;  4RES B;  2IDB A;  3CX5 H;  3CX5 D;  4AYC A;  1WT6 A;  3H1I J;  2AXT H;  3B8E B;  1NTZ E;  2AXC A;  1PGO A;  1U7M A;  5D8C A;  2KS1 B;  3AEB C;  4W7Z A;  1N2D C;  3WUT A;  3H25 A;  5KAU A;  3CME P;  5GTH H;  3L37 A;  2E75 D;  1RF1 C;  1Q86 Q;  4Y28 J;  1PP9 J;  2RH0 A;  3O6Q A;  1GZL A;  2IYP A;  4DZO A;  3BCC D;  3AE5 C;  1SQB G;  2H8P D;  2ZXE B;  5I41 B;  3LUR A;  3PRJ A;  2IYO A;  5EFW B;  4JYB A;  1M8O B;  4BRY A;  3CCQ P;  1SQB D;  4D6T E;  3EFF K;  1NAY A;  4XA4 A;  2FFD A;  1NTK J;  3L4F A;  5DJU B;  3HE4 A;  4OGQ B;  1KQL A;  3PHL A;  2KLU A;  1L0N J;  3CC4 P;  4KT0 J;  2YMK A;  3B5N D;  4W7Y A;  1RE3 C;  2Q9I A;  1JOC A;  2R3S A;  3H1J J;  3KXD A;  2IBZ G;  3HD7 D;  1P84 I;  3AE3 C;  2K9Y A;  2FKW B;  5E79 E;  2ZHH A;  1URQ C;  1P84 D;  1SQP J;  1GL2 A;  4HH2 A;  1MZ9 A;  2E76 B;  1XTG B;  4H0L B;  3Q5S A;  3O8Z A;  3FXD A;  3JCU H;  4I7Z B;  3RGU A;  1RQV A;  3B5N B;  2HYN A;  3H1J G;  3AEC C;  1OX3 A;  5CCH A;  5KAF E;  1GK6 A;  4EYY Q;  5KLI B;  2Y0E A;  1VQ7 P;  2C0X A;  1IFD A;  2HFE D;  2HVA A;  3FWN A;  1OVR A;  1JY2 N;  4OGQ C;  3GF7 A;  1KIL D;  1JB0 J;  4ZMD A;  3KDP B;  2JJL A;  3A0B E;  2ZVN B;  4D6T D;  3W67 A;  2I1J A;  1RH6 A;  2FYU D;  3VMY A;  2A06 G;  2M5A A;  4RKU J;  4LHF A;  5CHX A;  1L0L E;  2RMZ A;  2O01 H;  1GL2 C;  5APT A;  5AVZ B;  3M9Q A;  1EDI A;  2Y0D A;  2P7J A;  3LW5 H;  5APQ A;  3TGU D;  2E74 C;  1IK7 A;  2ZFC A;  2GUV A;  1ZN5 A;  1H0T B;  2NPS B;  3AEA C;  1L0L G;  2BAS A;  2WQY C;  5M1B A;  1KQF B;  1LTT C;  3TDK A;  2IBZ E;  1LP1 B;  3Q5P A;  2ZYD A;  2JDI H;  1LT9 B;  1HGV A;  2KUB A;  1FC2 C;  3JC2 2;  5B5E H;  1M1J A;  1U57 A;  2OTL P;  2OTK E;  4DCK A;  1D7M A;  1EZV G;  3OW2 O;  4L73 A;  2A45 H;  1U7J A;  3EZ6 A;  1FE6 A;  1T2K C;  1ZME C;  3RK2 D;  3I56 P;  5B66 E;  3D6Y A;  2ZVO B;  2KZI A;  2YKO A;  1KYO E;  1EDJ A;  4NPF X;  1NTK G;  2QJK C;  3SSU A;  3V2P A;  5AW4 B;  1JCC A;  3B5N A;  5AVS B;  2YXQ B;  3V2N A;  1EDK A;  4Y99 C;  3HD7 A;  4U3F E;  5APY A;  3RK3 B;  3H1K E;  3AED C;  3E7K A;  3Q1M A;  4PD4 E;  5GQQ A;  1W5C E;  3VP8 A;  1KIL B;  1FDO A;  5KTB A;  3G4S P;  1JY2 O;  3RBX A;  2E74 B;  2V4H A;  1VQM P;  1RF1 B;  1JY3 O;  1IFJ A;  1L0N D;  2M8R A;  1L0L D;  2KS1 A;  2DW3 A;  2OQQ A;  1VF5 D;  1BE3 J;  4NPD A;  1NKZ B;  2IBZ D;  2POH A;  4OGQ D;  1JY3 N;  5AW2 B;  3CPW O;  1L4A D;  2QEX P;  2WPR A;  5AW1 B;  3SWF A;  1BE3 G;  3TK1 A;  2PAJ A;  1YJW P;  1NTM K;  1NTM D;  1BCC D;  3MUD C;  1KQS O;  2NPS A;  4BRY B;  4HYT B;  4RJT A;  1JYH A;  4J2N A;  1LP1 A;  1KIL A;  1NTM J;  1SQV G;  1OMI A;  1SQX K;  4YPC A;  1H8A A;  2GOV A;  2BOW A;  1G1J A;  3SWK A;  1MUU A;  3H1H D;  2P67 A;  3KZI H;  3QWO C;  4WY4 C;  4OH8 B;  5CMZ A;  5KJ7 C;  1M7L A;  2FXM A;  2Z5H A;  1LWU A;  3CXH H;  4C7N B;  1LTJ B;  3L75 D;  1OW6 A;  3H1K D;  4I7Z C;  2FYN B;  5GTI H;  1M90 Q;  4L74 A;  5D90 A;  1L0N E;  2E76 D;  5AW5 B;  3E1I A;  1NO4 A;  2N9Y B;  2WZ7 A;  3S1K A;  1Q05 A;  1M57 D;  2YNY A;  2KOG A;  3CL3 D;  4WVZ A;  2CPS A;  1FU1 A;  2QSI A;  1RE3 A;  3GW6 A;  3L70 G;  1SQV K;  1N7S C;  4K35 A;  3P8C E;  3CD6 P;  3MUD A;  3S4R A;  5KKZ B;  1NTM E;  2DG6 A;  4R24 B;  3K5B A;  4ZKP A;  2GUS A;  2PRR A;  4KHX A;  1TU3 F;  1DEE G;  1J1E B;  1SVF A;  1P84 H;  1FBM A;  1FJP A;  2AEJ A;  2KLV A;  4EI2 A;  2J58 A;  3MD0 A;  1X8Y A;  2OYI C;  3EWK A;  2YO2 A;  1BSH A;  3JCU E;  3D6Z A;  2OTJ P;  3EZ7 A;  3SFE C;  1NTZ K;  2K88 A;  3M91 A;  3TNU B;  1BDD A;  2E76 C;  1GU5 A;  1LTB C;  3L70 J;  1S5L H;  2G8Y A;  3L72 J;  2Q6Q A;  2O01 J;  1Q07 A;  2PGD A;  2O1J A;  3AEE C;  3H1K J;  1L4A A;  1JCD A;  3M0D A;  1S9K D;  2WIT A;  3U1A A;  1JUN A;  5CCG D;  4HJG H;  1Q2N A;  1PV3 A;  4PV1 D;  2WTY A;  1SQQ K;  1LTJ A;  2XNX A;  3ABV C;  2PFX A;  1SQP D;  1UII A;  5KAV A;  4B86 A;  2K9J A;  3GHG A;  5KAT A;  2QG4 A;  2HPC B;  4Y99 B;  3PP5 A;  3L71 G;  2N9B A;  1SQQ D;  1GD2 E;  3RK3 E;  2LKM A;  4H13 D;  2FYZ A;  4UB6 H;  4IFM A;  2O01 N;  2QM7 A;  3KQG A;  1VQN P;  3L70 E;  1PGJ A;  1OVU A;  4ASW A;  2KNC B;  2BEQ D;  1S4X A;  2FYU G;  3MP7 B;  3CCS P;  4NPE A;  1OW7 A;  3TYY A;  4QMA A;  3BAS A;  2JWD A;  5B66 H;  3L73 D;  3H1I E;  1KTM A;  1IC2 A;  2YMY A;  5KAF H;  1CSB A;  1QX8 A;  3TF5 A;  1DH3 A;  1K9M Q;  4LGD E;  2D2C B;  3MHV A;  4PJ0 E;  5BU5 A;  3OA7 A;  3HUS B;  2R44 A;  2Z5I A;  3P8C D;  4ZKU A;  1MFT A;  3SWY A;  1T8Z A;  4AYZ A;  3F89 A;  4YTP C;  1GL2 D;  3ZDM A;  1JM0 A;  3MGN A;  1SFC C;  1ZR2 A;  4H44 D;  1PM6 A;  3CCM P;  1FZC A;  2E75 C;  1YTZ T;  2XKM A;  1Q09 A;  1SQP G;  1NYH A;  1T3U A;  2CK3 H;  2FY8 A;  1LT9 C;  2W6J H;  3M9B A;  1NTZ D;  1P84 E;  3HE5 B;  1NAF A;  4GT1 A;  2R32 A;  1G1I A;  3CCL P;  4PV1 B;  2QA4 P;  4AYZ B;  1L0L J;  2KXP B;  2IFM A;  2SPZ A;  3O6Q B;  4WWI A;  1G2C B;  1OXZ A;  3IN6 A;  4XFJ A;  4TLF A;  1JY3 P;  2Y0C A;  2A06 E;  4D6T J;  3L74 E;  1SQB K;  1Q0A A;  3W68 A;  1PZQ A;  1LX8 A;  4A7P A;  1SFC B;  2OYO A;  5L8R J;  1AVY A;  3RK3 D;  4C7N A;  4IFF A;  1ZRT D;  4YXD C;  3VN0 A;  3L75 E;  2IX7 C;  5KLV G;  1X22 A;  2JML A;  1X0T A;  1T2K D;  4BWN A;  1YJ9 P;  5AW9 B;  3HTK B;  2W90 A;  3CC7 P;  1AQ5 A;  1AQT A;  3NMD A;  1FZG A;  2W6B A;  1SQP E;  1K05 A;  4N78 D;  1HUC A;  1QLE D;  2WT7 A;  5AVU B;  3HE4 B;  2N1T C;  1J2J B;  2UWJ E;  1FS0 E;  4WLS A;  1BGY D;  2E5T A;  3I55 P;  1KYO H;  5E01 A;  3WU2 H;  1IFN A;  5GTI E;  4L76 A;  2R5D A;  1BCC E;  1K73 Q;  3IF4 A;  3U1C A;  3CXH E;  2A06 D;  3ITK A;  2M3E A;  3LID A;  1QEX A;  2W8Z A;  2Q3I A;  3CWB G;  2HPC A;  3CXH I;  1KB9 D;  3P32 A;  1Q82 Q;  2KB7 P;  2NPS C;  1NHL A;  1DD3 A;  3M0D C;  2Q3E A;  3QAO A;  1FOS E;  3B4S A;  4OWF A;  3AEF C;  1KFM A;  1FOS F;  2M5A B;  1CZQ A;  2QE7 H;  3L72 E;  3C1L A;  5CCG C;  2GM4 A;  1PP9 E;  4B0Y A;  5TIS H;  4U7J A;  1PGQ A;  1YYC A;  1RQU A;  1S3J A;  4MN4 C;  2NPS D;  1PP9 G;  4JPZ B;  1RE4 C;  3V2R A;  3RL0 g;  1NTZ J;  2D2C C;  3TNU A;  3T97 A;  4D6T G;  3HUS C;  3R4Y A;  2J5U A;  2N1T D;  3N7N A;  3KZI E;  2RN0 A;  2ZYA A;  1N8R Q;  2IFN A;  1KC8 Q;  1JEK A;  2MKV A;  4PJ0 H;  2VZ4 A;  3Q2Y A;  4K3A A;  5APU A;  2O3J A;  1AV1 A;  1N7L A;  1OVV A;  2QM8 A;  2KK7 A;  3L75 G;  3G71 P;  3H1L E;  5APS A;  1Q06 A;  2FYU J;  2M0B A;  2WWW A;  1AJY A;  3HH0 A;  1YQ3 C;  1SQX D;  4PD4 H;  1UIX A;  3A2A A;  2KSJ A;  5H2F E;  4HB1 A;  2IZ0 A;  1R8D A;  1EDL A;  3CCV P;  1NU1 G;  2B89 A;  2ZXX A;  3I5C A;  1OIP A;  2HOD A;  1QGK B;  1BGY J;  3GMA A;  1USD A;  4PD4 D;  4WLW A;  2LR2 A;  2H7H A;  4DT0 A;  1VQ9 P;  1VPC A;  5H2F H;  2I1K A;  2ITA A;  3H1J E;  3L73 J;  1LTG C;  2WSC J;  1JMM A;  1BCC G;  3H1I D;  2B88 A;  1E5W A;  2KYV A;  1HJ0 A;  3D71 A;  2OYH C;  2IPP A;  1LJ2 A;  2KCU A;  4IOI H;  5AVQ B;  3VMA A;  1PL5 A;  1KYO I;  3L72 G;  2G3A A;  3BRT B;  2OYI A;  3VTP C;  2E42 A;  1S5L E;  1OW8 A;  4IL6 H;  3CX5 I;  3RK2 C;  3A3Y B;  2E75 B;  3MTU E;  5AVV B;  1G2C A;  3GG2 A;  1ZOY C;  3PH0 A;  2OGU A;  2ZHG A;  4WY4 B;  1T3J A;  5KJ7 D;  2FFD C;  3L36 A;  3R2P A;  4WY4 D;  1FZA A;  3A0H H;  1D5Y A;  1NOH A;  1LTJ C;  1Y9B A;  1ZV8 A;  4JQ0 D;  3UIA A;  3WUV A;  2K1A A;  2ZJS E;  5E79 H;  1GTW A;  3HD7 C;  1L4A C;  4YXW H;  3PTZ A;  5K5G B;  3EZ9 A;  1SQX J;  1YTZ I;  2Q5U A;  3RL0 D;  1KFN A;  5AVW B;  3B49 A;  2FXP A;  2H88 C;  4LC1 A;  2JR8 A;  3HE5 A;  1NTZ G;  1QVG O;  1OFC X;  3CX5 E;  1Y47 A;  4WB4 A;  1GW3 A;  1JMB A;  5KKZ C;  5AW6 B;  1KN7 A;  3D70 A;  2N1T B;  2IEF A;  1KYO D;  4DOJ A;  2JWA A;  2W27 A;  1NWQ A;  4XE5 B;  4GOE A;  2P10 A;  2O1K A;  5AVR B;  2YKQ A;  2A45 I;  4H44 B;  5APV A;  4I6M C;  3MZW B;  4EDF A;  1URQ A;  2KP8 A;  2GA1 A;  3H32 A;  1N73 C;  1RH5 B;  5BU8 B;  2FFD B;  3TGU G;  3B71 A;  1QL2 A;  2B9B A;  2MJZ A;  3H1K G;  3TGU J;  1SQQ G;  1PGP A;  1EXJ A;  3M06 A;  1NTK E;  3V6I A;  1N7S A;  1Y8A A;  1L0N G;  4O9B A;  4GIF A;  2P1J A;  1NU1 K;  1SQQ E;  3H6P A;  1YIJ P;  3HRN A;  2Y9Y A;  4GOD A;  1K8A Q;  1VQP P;  3CWB E;  3CCU P;  5KCB A;  4R4M A;  1Q81 Q;  2KVV A;  2FBW C;  3PJS K;  2YXR B;  2QRX A;  3AE9 C;  3RBZ A;  1FZE A;  4IFD K;  4H44 C;  1SQX G;  1X9V A;  3T97 B;  1ZLL A;  2ZT9 C;  1VQ4 P;  1M1J C;  2HLO A;  2OYH A;  3CMA P;  3GK6 A;  2NZ2 A;  2XU6 A;  1SQX E;  1SQB E;  1A02 J;  3CCJ P;  4U3F J;  1FAV A;  2YO3 A;  4IL6 X;  2OG0 A;  2AEF A;  4WY4 A;  2WVR A;  1KB9 E;  1HBW A;  1GDT A;  3VP9 A;  2YIU B;  1IZN B;  2VRS A;  1FZF A;  1BE3 D;  1VDF A;  1YQ4 C;  4C7R A;  3EFG A;  1M56 D; 
#chains in the Genus database with same CATH homology
 3AE1 C;  1PM6 A;  2YIU C;  2BEZ F;  3Q3D A;  1ZOY C;  5KLI C;  4H0L C;  2ZHG A;  4RKU J;  5KAT A;  3AE4 C;  3S9O A;  4DCZ A;  4H13 B;  4KT0 J;  2YMK A;  3AE7 C;  2QJY C;  2E75 C;  4LHF A;  2QJP C;  3AE6 C;  3R4Y A;  3R8J A;  2J5U A;  2OQQ A;  1Q90 D;  1VF5 D;  1Q09 A;  4OGQ D;  3RK3 E;  5KAW A;  1D5Y A;  2DG6 A;  1NYH A;  1Y9B A;  3R8K A;  4R24 B;  4PV1 C;  1DIP A;  1JBG A;  3C8V A;  2MKV A;  2E74 C;  3AE3 C;  4H13 D;  1IK7 A;  1EXI A;  1TU3 F;  2VZ4 A;  1K05 A;  3AEA C;  3Q2Y A;  5KCB A;  2WQY C;  4R4M A;  5M1B A;  1KQF B;  2E74 D;  2V7Q J;  2K9Y A;  2KVV A;  1Y6U A;  2FBW C;  1KQG B;  2ZHH A;  2ZT9 B;  2WPV B;  5KAX A;  4WLS A;  1FDI A;  1ZP0 C;  3GF3 A;  1K04 A;  3AE2 C;  3Q5P A;  3EZ9 A;  3AE9 C;  1Q06 A;  1AJY A;  5E01 A;  4Z1M H;  3HH0 A;  1WMK A;  1YQ3 C;  1UIX A;  3IAO A;  3G9R A;  1R8E A;  2E76 B;  4TT3 H;  3B49 A;  2FXP A;  4PV1 B;  2H88 C;  1JYH A;  3GPV A;  4J2N A;  2FYN C;  4R4L A;  3FGA D;  1U57 A;  4H0L B;  3UCS A;  4R22 B;  3Q5S A;  4AYZ B;  3AE8 C;  1R8D A;  3EWK A;  5I44 A;  2BEQ D;  1OMI A;  2IDB A;  4H44 C;  1HF9 A;  3AEG C;  1MKM A;  3D6Z A;  1OW7 A;  3EZ2 A;  3EZ7 A;  1KOR A;  4I7Z B;  3SFE C;  2JP3 A;  2GOV A;  3T97 B;  3IN6 A;  3EZ6 A;  2ZT9 C;  4XFJ A;  1RQV A;  2QIW A;  2BOW A;  1ZME C;  5KKZ C;  5D8C A;  2E76 C;  3AEC C;  3D6Y A;  1VF5 B;  3D70 A;  2WSF J;  3GMA A;  4WLW A;  3AEB C;  1KTM A;  2IEF A;  1PIX A;  3GK6 A;  2NZ2 A;  2QJK C;  3H25 A;  1DD3 A;  4H13 C;  5KAU A;  1VF5 C;  1S5L X;  3QAO A;  1Q0A A;  2E75 D;  1Q08 A;  2P10 A;  1NGM B;  4IL6 X;  3EZF A;  1BOW A;  2D2C B;  2OG0 A;  2G8Y A;  2H89 C;  3Q5R A;  2JO1 A;  2WSC J;  3AEF C;  4H0L D;  4H44 B;  1S1C X;  4Y28 J;  1LX8 A;  2O01 J;  1Q07 A;  3O6Q A;  1DD4 A;  3LW5 J;  3AEE C;  1KIL E;  2WSE J;  2HVA A;  1HJ0 A;  3D71 A;  1GMJ A;  5L8R J;  3AE5 C;  1VL2 A;  1OW6 A;  5I41 B;  3LUR A;  4I7Z C;  4OGQ C;  3E0H A;  4A1M A;  4B0Y A;  3GF7 A;  2ZT9 D;  3AED C;  2KCU A;  3Q1M A;  5D90 A;  3RL0 g;  4U7J A;  1JB0 J;  3SFD C;  1PV3 A;  4PV1 D;  3GP4 A;  1PL5 A;  5GQQ A;  3GLM A;  3B71 A;  2E76 D;  4AYZ A;  2G3A A;  1ZRT E;  1RQU A;  1Q05 A;  4YTP C;  3ABV C;  2D2C D;  1FDO A;  4YXD C;  2QSI A;  4R4E A;  1YQ4 C;  2E74 B;  5KAV A;  1RH6 A;  1OW8 A;  4GDO A;  2JML A;  1KMI Z;  1EXJ A;  2E75 B;  4H44 D;  2D2C C;  4OGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...