3Q1MA

Crystal structure of bmrr dimer bound to dna and the ligand 4-amino-quinaldine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q1mA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q1mA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q1mA03
1R8DA 3Q1MA 1Q08A 4R4EA 2BOWA 3GPVA 4AYZB 1Q0AA 3Q5RA 4J2NA 3UCSA 2OQQA 2KCUA 5KAUA 4AYZA 1Q09A 2GOVA 1JYHA 1JBGA 3T97B 1Q07A 4R4LA 3E0HA 2ZHHA 5GQQA 5KAVA 5KATA 1Q06A 3Q2YA 1D5YA 1Q05A 5I41B 4WLWA 3LURA 2ZHGA 3Q3DA 3G9RA 3B49A 3GP4A 5KAXA 1EXJA 3HH0A 3Q5PA 1BOWA 3IAOA 1R8EA 5KAWA 4R24B 3D70A 3GK6A 2JMLA 5D90A 4B0YA 2DG6A 3R8JA 2HVAA 5D8CA 2J5UA 2VZ4A 1EXIA 4A1MA 3R8KA 4R22B 3D6YA 1DIPA 5KCBA 3D71A 3Q5SA 5I44A 4R4MA 5E01A 4WLSA 3QAOA 3D6ZA
chains in the Genus database with same CATH superfamily
1VQ6P 2FYZA 1NTKK 1FE6A 3VYIA 5CCGC 1OVUA 1M1KQ 5BVZA 3ITKA 2Y0EA 1NTZJ 3B4SA 1H88A 1DX7A 4PD4E 4ASWA 2QE7H 5D8CA 3JCUH 1SFCD 2PRRA 5AVXB 3AEEC 1EC5A 3AE2C 3OJAB 2JR8A 1RF1C 1Q0AA 3LIEA 2WSFJ 3HTKA 1LTJC 4L76A 1IFMA 5APWA 2N1TD 2ZHGA 3TNUA 1KZUB 4DZOA 2WT7A 2C9LY 3PRJA 2WVRA 3CX5H 4H0LB 1QGKB 2D2CD 1QL2A 3H1IJ 3JCUE 1NGMB 3L71G 3CXHI 1T3UA 1ZN5A 5I41B 3S1KA 4H13D 5B5EH 1BDDA 1EZVD 3WU2H 1OWAA 1PP9J 1KILC 3HD7A 5EFWB 3H1LJ 3Q5SA 3HUSB 1FZBA 1IFDA 3CX5E 1G1IA 1YJNP 3L71J 1SQPE 1MFTA 1USEA 3H32A 4PV1D 4HJGH 1QX8A 4PD4D 1EZVG 5KAXA 1EXJA 1KYOH 1S5LH 2KYVA 2BEQD 1KQFB 1S1CX 3AEAC 1RE4C 2QSIA 2WWWA 1N7SB 5K5GB 2Q3EA 3CD6P 5B5EE 1VQKP 2WSEJ 1ZP0C 3F5HA 3VP8A 3WU2E 2OYHC 1Y6UA 4A7PA 2IZ0A 1Q06A 2IDBA 1KQLA 1M1JC 1N73C 1W2EA 1N7LA 2XNDH 2FY8A 2HVAA 2B89A 1KYOE 1S5LE 3G4SP 3RL0B 1SVFA 3A5TA 3A3YB 1YITP 1SQQJ 4U3FG 4YPCA 3CCJP 1ZRTE 4BWNA 2OTJP 1GU4A 5KLVG 5GTHE 2HODB 2K37A 1JY3P 4WY4C 1YHQP 4GODA 2M5AB 4ASVA 4H44C 1PL5A 3CX5D 3TF5A 2H8PD 3BRVB 1SQPD 5AVRB 3V2RA 1SQBE 2K9JB 2O01H 3MUDA 1M7LA 2IYOA 1FU1A 2HFED 3LW5H 2C0XA 1KB9H 4I7ZB 3CLQA 5M1BA 3WUTA 1Q7YQ 1NTKE 1PIXA 1LTTC 1GL2A 3H1JJ 1IFIA 1XTGB 2K9YA 4JQ0D 3A0BH 4TT3H 2BCCG 2E76D 1KQGB 5DJUB 2PAJA 2ZVOB 2YO3A 2KNCB 1KB9E 1ZRTD 3MHVA 1Q09A 2CPSA 4ZKPA 1VL2A 2FBWC 5CJ4A 1RF0A 1J1DC 4TLFA 3A0BE 2W8ZA 2LXBA 2LR2A 3FX0A 2RN0A 1GL2B 1SQXG 3MD0A 2R32A 1SQBD 2Q5UA 1KTMA 2ZHHA 1T2KD 1HVVA 4XFJA 2KS1B 1NTKD 1L4AB 5I44A 3L36A 1SQBG 3BCCG 2ZXXA 2ZYGA 3E7KA 3G9RA 5E79E 1KFNA 5D90A 4GOFA 1FS0E 1SP4A 2FXPA 2FYUD 3VMZA 3EFFK 2GA1A 3EZ7A 3L72E 2R3CA 1YIJP 1SLQA 5BU8B 3Q5RA 4J2NA 2KCUA 4XA4A 1VQMP 5C39A 1FDOA 1MZ9A 2FYUG 2M3BA 3NTNA 2KSJA 4O9BA 1YQ3C 4GOEA 2KZIA 5AVWB 3L75J 3CC4P 3U1CA 2QIWA 1BGYG 1GMJA 4PD4I 1NHLA 4LGDE 1RF1B 2V4HA 1AFOA 2HPCA 2FXMA 1LTJB 1U7JA 2H88C 1YYCA 1FAVA 3KQGA 3TDKA 2A06G 3CL3D 4IFMA 1RE4A 1NTMG 2I1KA 1BCCJ 2RH0A 3RBXA 1T3JA 3H25A 1VQ8P 1UIIA 3KHUA 2OYHA 3B8EB 3L74J 5CBOA 1M1JA 2WSSH 1KILB 1P84H 3WMM0 2JO1A 3G71P 2HPCB 3L73E 1JB0J 1LTGC 3CX5I 1BE3G 3D6ZA 2E75D 1JMBA 3KYQA 1IC2A 2JDIH 1FJKA 5KLIC 1SQVJ 2M8RA 1JYHA 3ZDMA 1J2JB 2H43A 3IAOA 1G2CA 3G3ZA 1NH4A 2OYHB 2A45H 4MN4C 5KLVK 1U57A 1P84E 1GW3A 4BXLA 5KJ7C 3EQ2A 3H1HG 3NMDA 2W6BA 1M1JB 1N73B 1E5WA 3V2PA 2ZYDA 3H1KJ 1H0TA 2JMLA 1URQA 2H89C 2E43A 2Y0DA 2JWAA 1KYOI 2N9YB 5CCHD 2D2CC 3BATA 5GQQA 3CWBE 1PPJE 2Q3IA 4EIJA 1Q2NA 1NU1J 2ZAEB 1EDIA 2HYNA 4WY4B 3A7OA 1VPCA 4H44B 2WPVB 4OVNF 3RK2B 3V4QA 1UIXA 5TJHA 1T8ZA 4EDFA 3I5CA 1E79H 1JCDA 2JEEA 4N78E 4D6TJ 1JCCA 3RK3E 1L0LD 5APVA 1DD3A 3GHGA 2W6JH 1URQB 1OW6A 3O8ZA 1KV4A 1P84D 2GUSA 2XKMA 1L0NG 5CBNA 1X22A 2YKQA 1OX3A 5H2FH 3M0DA 5CMZA 4GDOA 1L0LG 2NZ2A 2E5YA 1SQXK 2XU6A 1RH5B 2KK7A 2QG4A 3L71E 3Q5PA 1VQOP 2G8YA 1NTZD 1DH3A 1KB9I 1W5CE 4L73A 2WITA 1J1DB 4I2LC 2AXTH 2CK3H 4Y99C 5H2FE 1Q07A 2JJLA 2IFNA 3GP4A 1NTZG 2O1KA 4R24B 1Y47A 3L70J 1EZVE 1WT6A 3TGUJ 1FZAA 3VMAA 3HD7D 3HE5B 1S2EA 4EI2A 4N78D 3RK3D 3TYYA 3H1ID 2PGDA 5DJTB 2YIUC 2AXTE 1OMIA 1FOSF 3I55P 4GIFA 1IFNA 1QVGO 3A2AA 2OTLP 2FFDC 1OVVA 2FYUK 4GKGA 1TU3F 3HUSA 2Z5IA 5AW5B 3H1IG 4GT1A 3TSIA 1N86A 1YJWP 1GU5A 3E1IA 4HB1A 4U3FE 3L71D 2QJYC 2R44A 1IK7A 5AVUB 4C7RA 3OA7A 2E76C 2C9NY 2IBZG 2V7QJ 5B66H 5KLVE 1PP9G 2K3RA 3H1LG 5AVVB 2O01N 2WMMA 1N7SA 3AEFC 3MTUE 4IL6H 3GPVA 3JSVC 1FOSE 3HH0A 3VTPC 1JY2N 2I1JA 2Y9ZA 5AVZB 1NTMK 4AQRD 4JYBA 1ZMEC 3CC7P 5B66E 4ZKUA 2O3JA 1HH0A 1M90Q 1CI6B 1SQQD 2KB7P 2W27A 3B71A 2G3AA 4IL6E 5KKZC 4HYTB 1VF5B 1T2KC 1J1EC 4W80A 1YTZI 2BCCE 2HODA 4LHFA 2OYIC 1S9KD 1QL1A 1MKMA 2M5AA 2MKVA 1JY3N 3SWKA 1SQQG 2WSCJ 1BDCA 1GL2D 5GTHH 3PP5A 4U3FD 1JY2P 2K9JA 1LJ2A 1DEEG 3KPEA 5KLVD 3P8CE 1AJYA 3VP9A 1RY3A 1L4AD 2P1JA 2Y9YA 3H1JD 1G1JA 1LTAC 1SQXE 5APSA 2WTYA 2AEFA 2W6AA 5KAIH 5KLIB 5KCBA 2M0BA 2ZT9C 1FJPA 3H1JG 1GDTA 1XTCC 3L37A 4R4EA 3M0AA 2IEFA 1H8AA 1DEBA 2KNCA 4W7ZA 1K9MQ 1N8RQ 1Q86Q 3BCCE 3FXDA 1M57D 4YXWH 2BCCD 1A02J 1P84I 1FDIA 3VMXA 2PP6A 3D6YA 5AW0B 4RJTA 1RHZB 2E5TA 5KAIE 2WQYC 4C7NA 1DD4A 3T97B 3SFDC 2QJKC 1MUUA 3M9HA 3CCVP 2BASA 4QMAA 2D2CB 4AUWA 1OZHA 3CCRP 3P8CD 2J5UA 1S72P 2FYUE 5E01A 2KS1A 1FC2C 1L4AA 4BRYA 2A45I 1YTZT 1SQXD 1L0NK 4JPZB 1K73Q 4KT0J 1PGPA 3SWYA 1FZGA 1L0LK 3QWOC 2WPRA 3H6PA 1LNQA 2YNYA 1BGYE 2IYPA 2PFXA 4HKZH 3RBZA 3B5NC 1SQPJ 3FGAD 1OIPA 4C7NB 2NPSC 4NPDA 2ZVNB 5E79H 1GK4A 3BCCD 1NO4A 3Q2YA 1WRGA 3BASA 3VN0A 1WMKA 5APTA 2A06E 1NOHA 1YQ4C 3KZIH 3EZ6A 2XDJA 1T6AA 1NTME 2E74C 2GM4A 2QM7A 1NTZK 5CCGA 4BRYB 3NXSA 5APYA 1JM0A 1RH6A 2FYNC 1YBKA 2BOWA 3SWFA 1Q81Q 3V2NA 1EDLA 3CMAP 2K88A 4Y99B 2POHA 1RF1A 3GW6A 4WLSA 1LTJA 1PFIA 3KZIE 3L75G 4DCKA 1BE3E 1L2PA 3PLNA 4NPFX 1VDFA 3MIWA 1AA0A 5AW8B 1X79B 1BGYD 3N4XA 1EZVI 3OW2O 1MV8A 3V6IA 4EYYQ 2KZJA 3UIAA 4LLHA 1JNMA 4ZNCA 3JC22 2YIUB 2K1AA 2W90A 2OYOA 1PM6A 3H1HE 3KDPB 3B49A 1Q82Q 4Y28J 2FFDB 2A06D 1KILA 1NTKJ 1BCCG 5APUA 1NTMD 4K35A 1ZR2A 3R8KA 5AW6B 5AW9B 1ZXGA 3CCEP 2UWJE 4AYCA 3RK2D 2Q6QA 3L74G 1JO5A 1MFZA 2QJYB 2E76B 2O01J 2L91A 1W2BO 3VOPA 2KIKA 3U1AA 1BOWA 3TK1A 3LW5J 3R8JA 1URQD 4IFDK 1IFPA 3I56P 4R4MA 5AVTB 1BE3D 1SQVG 1N73A 1JOCA 1D5YA 3HRNA 1SQQK 1RQVA 3H1KD 3K5BA 3GF3A 4OGQC 3CCQP 1GTWA 1LT9C 2IZ1A 1FZFA 2Z4EA 2B87A 1VQ4P 1LWUC 4Z1MH 3HD7C 5KKZB 3IF4A 1L0NE 3H1HD 1KN7A 1J1EB 3UCSA 1VQNP 1KC8Q 3RK3C 4WY4A 2OYIB 1GW4A 3H1KG 1L0LE 3AEDC 3D70A 1Q90D 1RE3C 2WPQA 1BSNA 4N6JA 3EWKA 1SFCC 2IFMA 2WSFH 1NU1G 2Z5HA 5APQA 1R5LA 1JBGA 2CPBA 2XV5A 2N1TC 2B88A 3L72J 2VZ4A 1NAFA 2B87B 1NTZE 3HE4A 1QEXA 1R8DA 2WZ7A 2P58A 4D6TG 4KHXA 3MP7B 2ZT9B 2P10A 4H13C 1VQLP 4NPEA 1K05A 2N9BA 1L0ND 4RO0A 4H0LD 2Q7CA 3BRTB 5GTIH 3H1IE 1AVOA 3MUDC 4PV1C 5KAWA 3B5NA 1LP1B 3HE4B 2NPSA 2J58A 2QJKB 2L5GB 2IX7C 2WSEH 2IBZE 1OVRA 1PP9E 3TGUD 2XNXA 2ZYAA 3H1LE 3HE5A 4I1LA 1IJDB 3PTZA 2GOVA 1GL2C 1LT1A 1X0TA 2AEMA 3R2PA 2P67A 2ZXEB 3L70G 5GTIE 4JBZA 1VF5D 1CZQA 3M91A 1HWTC 3TGUG 3QAOA 3GG2A 2KOGA 4RKUJ 2QEXP 3KXDA 1N7SD 3S9OA 4CPGA 1K04A 3CCMP 3FXEA 3EZ2A 3L73J 3B5NB 2NPSB 2YMYA 2NRGA 1M56D 1DIPA 2KUBA 4N3YB 2QA4P 1SS1A 1A02F 3CMEP 1ZW0A 3RL0D 4RESB 1SQQE 2E74B 3EZFA 1JTHB 4DJGA 1OW7A 1EQ7A 2FYNB 1GZLA 2B9BA 4UB6H 5AVSB 2M3EA 3P32A 2IBZD 1PP9D 1S9KE 3H1LD 1GD2E 1LTBC 1LTIC 4WWIA 1QLED 1CI6A 2YKPA 1S3JA 3AE9C 2P2UA 3L4FA 4ZMDA 3CWBJ 5KJ7D 3AEGC 3CCSP 1HGVA 2JWDA 3IN6A 4WVZA 1OFCX 4UB6E 3GF7A 4M3LA 3LIDA 4K3AA 2W83C 3H1JE 3V4WA 1JY2O 3AEBC 1NKNA 2HG5D 2IPPA 1ZOYC 1HBWA 1LTSC 2YXQB 2KLUA 1LT9A 4HH2A 1SQVK 1LWUA 2P7JA 1JY3O 1HUCA 2Q1KA 1EXIA 2J59M 3HTKB 4IOIH 3C9IA 1X8YA 5AW7B 3GLMA 5AW4B 3TNUB 2WT7B 1RE3A 4JYCA 2OG0A 5KJ7A 1SFCA 5AW2B 1HTLC 1VQ7P 1IK9A 3FWNA 5KAFH 1U7MA 4KJMA 3L35A 1FBMA 3PH0A 2N1TA 4OGQB 1PGOA 1PGJA 4R4LA 1LT9B 1PV3A 4OWFA 3T97A 4IL6X 3M9BA 1NU1K 1LWUB 3U59A 2KVVA 2ITAA 3HD7B 2JP3A 3RK3B 3RGUA 1AVYA 3H32B 5CHXA 1N2DC 3C1LA 5KAFE 2SPZA 2E42A 1SFCB 3M9QA 1R5SA 3IFMA 1M8OB 1KILE 3D71A 1S5LX 2HR3A 4U3FJ 5CCGD 3RK2C 2N1TB 2KP8A 2FXOA 1OW8A 1VQPP 1GK6A 3L75E 4B86A 2YMKA 5KLVJ 2AXCA 2RKLA 3N7NA 1NKZB 2YKOA 3WUVA 1URQC 3II6A 1SQPG 5AW1B 3EZ9A 3VMYA 3Q1MA 3AE1C 1CSBA 2OQQA 4AYZA 3BVHA 4H13B 2RMZA 3USSA 1AQ5A 2HLOA 3C8VA 1KYOD 4XE5B 4R22B 2ZJSE 1BCCE 5AW3B 4YTPC 5BU5A 2LXCB 4PV1B 2E75C 4I6MC 3EFGA 3CPWO 2BCCJ 3L74E 1NVOA 1HJ0A 1HF9A 3GHGC 1KILD 2QJPC 4A1MA 2IBZI 2YXRB 1AV1A 4AYZB 3M0DC 2Y0CA 3L75D 2C0WA 1FZCC 1LGHB 1SQVE 1YI2P 1RQUA 2FFDA 1KD1Q 2XZRA 4WB4A 1SQXJ 3CXHH 5CCHC 2KLVA 2KXPB 3AE7C 1HJBA 3P8MC 1QVFO 1ZR4A 4UB8H 2OGUA 4L75A 1AQTA 1NTKG 4B0YA 1Z56A 3H1KE 1BCCD 1CW5A 1SQBJ 1KB9D 1ZV8A 4L74A 3BCCJ 1IZNB 3AE6C 1HGZA 4H0LC 3L74D 2O1JA 3CXHE 1NU1E 3NFQA 4WY4D 1EDKA 1KQSO 4UB8E 2JKVA 3O6QA 2ZT9D 4H44D 3A0HH 2QRXA 2ZFCA 2KI7B 3HUSC 2OARA 1USDA 3LURA 1SQVD 1JEKA 1R8EA 2OYIA 4D6TE 1NAYA 2FYUJ 4PJ0H 2MJZA 1VF5C 5AVYB 3OAKA 3CI9A 4DCZA 1FDMA 3A0HE 3WUUA 1N7SC 1PZQA 3AE8C 1BGYJ 4YXDC 3FWLA 3O6QB 3L72D 3G6EP 1X9VA 1K8AQ 2R5DA 4PJ0E 5APXA 3M06A 2R5BA 3PJSK 3SFEC 3CXHD 5L8RJ 1NU1D 2OTKE 3W67A 3RL0C 4JF7A 1NTMJ 4DOJA 1IFJA 1OXZA 3L72G 1VQ5P 3B5ND 2I8DA 4DT0A 2NPSD 1S4XA 3L70E 3MGNA 4OH8B 3R4YA 5AVQB 2KSEA 3TGUE 1NJIQ 3SSUA 1Q05A 4WLWA 3Q3DA 3V2QA 4D6TD 4EOTA 3MZWB 3GK6A 1H89A 3IR9A 2V7QH 2E74D 3GMAA 3AECC 1LP1A 4C46A 1JUNA 1BE3J 1VQ9P 3PHLA 1Y8AA 2H7HA 4I7ZC 5KAVA 4LC1A 1KORA 2LKMA 3AE4C 3AE5C 1Y9BA 3H1HJ 3ABVC 2QVAA 1SQPK 1JMMA 3E0HA 1G2CB 3W68A 3L73D 1YJ9P 2FKWB 5CJ0A 2YO2A 2VRSA 1KMIZ 1FZEA 1EDJA 3AE3C 3L70D 2Q9IA 4W7YA 3P7KA 2WSCH 3RL0g 2AEJA 1KFMA 1H0TB 3L73G 1JTHA 3CC2P 1PGQA 3V5BA 2WPSA 1ZLLA 1BSHA 5TISH 3S4RA 1LX8A 1Q08A 1FZCA 5KAUA 1D7MA 1L4AC 2R3SA 2GUVA 4U7JA 2DG6A 5CCHA 2E75B 1L0NJ 1RF0C 2BEZF 3E1RA 2DW3A 5KTBA 1IO4A 3CWBD 1PPJD 3QH9A 4WBAA 1L0LJ 3CCLP 4PD4H 3F89A 3GHGB 1SQBK 5TISE 5KATA 2QJPB 4IFFA 3CCUP 4OGQD 1NWQA 1NYHA 3CWBG 1PPJG 2QM8A 2A45G 1FZCB
chains in the Genus database with same CATH topology
2WSEJ 1ZP0C 4Z1MH 1ZMEC 3GF7A 4AYZB 4DCZA 2WQYC 3UCSA 1DD4A 1Y6UA 1Q09A 2GOVA 3T97B 1Q07A 3AE8C 3SFDC 2QJKC 3E0HA 1Q06A 1VL2A 2IDBA 1GMJA 2FBWC 2QIWA 3B71A 2G3AA 3GP4A 3AEBC 5KKZC 2D2CB 1VF5B 3AEDC 4R24B 3D70A 2JMLA 1RQUA 2H89C 4YXDC 1Q90D 2HVAA 5D8CA 2J5UA 1KILE 1VF5D 1ZOYC 4LHFA 1KMIZ 3D71A 3EWKA 3AE3C 1MKMA 5E01A 2D2CC 3QAOA 2H88C 2MKVA 3AEEC 1S5LX 4RKUJ 5GQQA 3AE2C 5KAWA 3IN6A 2WSCJ 3AE7C 1Q0AA 3S9OA 2WSFJ 1PM6A 3SFEC 1OW8A 3RL0g 4KT0J 1ZRTE 5L8RJ 1JBGA 1K04A 1KTMA 2ZHHA 3EZ2A 2YMKA 2ZHGA 3B49A 2YIUC 4Y28J 4H44B 1OMIA 2WPVB 4B0YA 2VZ4A 1EXIA 4H0LB 1UIXA 3R8KA 4XFJA 2D2CD 3H25A 1DIPA 1AJYA 5I44A 4H44C 1PL5A 3FGAD 1LX8A 3EZ9A 1R8DA 1TU3F 3Q1MA 1Q08A 3AE6C 3AE1C 3R4YA 4H0LC 1NGMB 2OQQA 5KAUA 4AYZA 2E76B 2O01J 3GLMA 4H13B 3RK3E 3Q2YA 1DD3A 1Q05A 5I41B 4WLWA 3Q3DA 3EZFA 2E74B 3G9RA 1WMKA 1OW7A 2QJYC 1BOWA 1IK7A 1OW6A 4H13D 2JO1A 2ZT9B 2OG0A 3GK6A 1YQ4C 2E76C 5D90A 3C8VA 3LW5J 2P10A 2E74D 4U7JA 2DG6A 4H13C 3R8JA 2V7QJ 3EZ6A 2E75B 2FXPA 3GMAA 3AECC 1JB0J 2BEZF 4R22B 2ZT9D 3O6QA 4H44D 2E74C 4I7ZB 5M1BA 5KCBA 3Q5SA 4R4MA 3EZ7A 1K05A 1PIXA 3D6ZA 2ZT9C 2E75D 1RH6A 2FYNC 3AEFC 4H0LD 4YTPC 4R4EA 4GDOA 2IEFA 4PV1B 3GPVA 2BOWA 2E75C 3Q5RA 4J2NA 4OGQB 4I7ZC 2KCUA 5KLIC 2K9YA 1JYHA 2NZ2A 5KATA 4R4LA 4TT3H 1D5YA 5KAVA 4PV1D 1KORA 3LURA 1PV3A 4OGQD 1RQVA 4IL6X 5KAXA 1EXJA 3HH0A 3Q5PA 4PV1C 1HJ0A 3IAOA 1R8EA 1FDOA 2E76D 3AE9C 1HF9A 2BEQD 3ABVC 4OGQC 2KVVA 3AE4C 3GF3A 2G8YA 1S1CX 1KQFB 1NYHA 3AEAC 1KQGB 2QJPC 3AE5C 1FDIA 3AEGC 4A1MA 2QSIA 1Y9BA 3D6YA 2JP3A 1U57A 1YQ3C 1VF5C 4WLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8D A;  3Q1M A;  1Q08 A;  4R4E A;  2BOW A;  3GPV A;  4AYZ B;  1Q0A A;  3Q5R A;  4J2N A;  3UCS A;  2OQQ A;  2KCU A;  5KAU A;  4AYZ A;  1Q09 A;  2GOV A;  1JYH A;  1JBG A;  3T97 B;  1Q07 A;  4R4L A;  3E0H A;  2ZHH A;  5GQQ A;  5KAV A;  5KAT A;  1Q06 A;  3Q2Y A;  1D5Y A;  1Q05 A;  5I41 B;  4WLW A;  3LUR A;  2ZHG A;  3Q3D A;  3G9R A;  3B49 A;  3GP4 A;  5KAX A;  1EXJ A;  3HH0 A;  3Q5P A;  1BOW A;  3IAO A;  1R8E A;  5KAW A;  4R24 B;  3D70 A;  3GK6 A;  2JML A;  5D90 A;  4B0Y A;  2DG6 A;  3R8J A;  2HVA A;  5D8C A;  2J5U A;  2VZ4 A;  1EXI A;  4A1M A;  3R8K A;  4R22 B;  3D6Y A;  1DIP A;  5KCB A;  3D71 A;  3Q5S A;  5I44 A;  4R4M A;  5E01 A;  4WLS A;  3QAO A;  3D6Z A; 
#chains in the Genus database with same CATH topology
 1VQ6 P;  2FYZ A;  1NTK K;  1FE6 A;  3VYI A;  5CCG C;  1OVU A;  1M1K Q;  5BVZ A;  3ITK A;  2Y0E A;  1NTZ J;  3B4S A;  1H88 A;  1DX7 A;  4PD4 E;  4ASW A;  2QE7 H;  5D8C A;  3JCU H;  1SFC D;  2PRR A;  5AVX B;  3AEE C;  1EC5 A;  3AE2 C;  3OJA B;  2JR8 A;  1RF1 C;  1Q0A A;  3LIE A;  2WSF J;  3HTK A;  1LTJ C;  4L76 A;  1IFM A;  5APW A;  2N1T D;  2ZHG A;  3TNU A;  1KZU B;  4DZO A;  2WT7 A;  2C9L Y;  3PRJ A;  2WVR A;  3CX5 H;  4H0L B;  1QGK B;  2D2C D;  1QL2 A;  3H1I J;  3JCU E;  1NGM B;  3L71 G;  3CXH I;  1T3U A;  1ZN5 A;  5I41 B;  3S1K A;  4H13 D;  5B5E H;  1BDD A;  1EZV D;  3WU2 H;  1OWA A;  1PP9 J;  1KIL C;  3HD7 A;  5EFW B;  3H1L J;  3Q5S A;  3HUS B;  1FZB A;  1IFD A;  3CX5 E;  1G1I A;  1YJN P;  3L71 J;  1SQP E;  1MFT A;  1USE A;  3H32 A;  4PV1 D;  4HJG H;  1QX8 A;  4PD4 D;  1EZV G;  5KAX A;  1EXJ A;  1KYO H;  1S5L H;  2KYV A;  2BEQ D;  1KQF B;  1S1C X;  3AEA C;  1RE4 C;  2QSI A;  2WWW A;  1N7S B;  5K5G B;  2Q3E A;  3CD6 P;  5B5E E;  1VQK P;  2WSE J;  1ZP0 C;  3F5H A;  3VP8 A;  3WU2 E;  2OYH C;  1Y6U A;  4A7P A;  2IZ0 A;  1Q06 A;  2IDB A;  1KQL A;  1M1J C;  1N73 C;  1W2E A;  1N7L A;  2XND H;  2FY8 A;  2HVA A;  2B89 A;  1KYO E;  1S5L E;  3G4S P;  3RL0 B;  1SVF A;  3A5T A;  3A3Y B;  1YIT P;  1SQQ J;  4U3F G;  4YPC A;  3CCJ P;  1ZRT E;  4BWN A;  2OTJ P;  1GU4 A;  5KLV G;  5GTH E;  2HOD B;  2K37 A;  1JY3 P;  4WY4 C;  1YHQ P;  4GOD A;  2M5A B;  4ASV A;  4H44 C;  1PL5 A;  3CX5 D;  3TF5 A;  2H8P D;  3BRV B;  1SQP D;  5AVR B;  3V2R A;  1SQB E;  2K9J B;  2O01 H;  3MUD A;  1M7L A;  2IYO A;  1FU1 A;  2HFE D;  3LW5 H;  2C0X A;  1KB9 H;  4I7Z B;  3CLQ A;  5M1B A;  3WUT A;  1Q7Y Q;  1NTK E;  1PIX A;  1LTT C;  1GL2 A;  3H1J J;  1IFI A;  1XTG B;  2K9Y A;  4JQ0 D;  3A0B H;  4TT3 H;  2BCC G;  2E76 D;  1KQG B;  5DJU B;  2PAJ A;  2ZVO B;  2YO3 A;  2KNC B;  1KB9 E;  1ZRT D;  3MHV A;  1Q09 A;  2CPS A;  4ZKP A;  1VL2 A;  2FBW C;  5CJ4 A;  1RF0 A;  1J1D C;  4TLF A;  3A0B E;  2W8Z A;  2LXB A;  2LR2 A;  3FX0 A;  2RN0 A;  1GL2 B;  1SQX G;  3MD0 A;  2R32 A;  1SQB D;  2Q5U A;  1KTM A;  2ZHH A;  1T2K D;  1HVV A;  4XFJ A;  2KS1 B;  1NTK D;  1L4A B;  5I44 A;  3L36 A;  1SQB G;  3BCC G;  2ZXX A;  2ZYG A;  3E7K A;  3G9R A;  5E79 E;  1KFN A;  5D90 A;  4GOF A;  1FS0 E;  1SP4 A;  2FXP A;  2FYU D;  3VMZ A;  3EFF K;  2GA1 A;  3EZ7 A;  3L72 E;  2R3C A;  1YIJ P;  1SLQ A;  5BU8 B;  3Q5R A;  4J2N A;  2KCU A;  4XA4 A;  1VQM P;  5C39 A;  1FDO A;  1MZ9 A;  2FYU G;  2M3B A;  3NTN A;  2KSJ A;  4O9B A;  1YQ3 C;  4GOE A;  2KZI A;  5AVW B;  3L75 J;  3CC4 P;  3U1C A;  2QIW A;  1BGY G;  1GMJ A;  4PD4 I;  1NHL A;  4LGD E;  1RF1 B;  2V4H A;  1AFO A;  2HPC A;  2FXM A;  1LTJ B;  1U7J A;  2H88 C;  1YYC A;  1FAV A;  3KQG A;  3TDK A;  2A06 G;  3CL3 D;  4IFM A;  1RE4 A;  1NTM G;  2I1K A;  1BCC J;  2RH0 A;  3RBX A;  1T3J A;  3H25 A;  1VQ8 P;  1UII A;  3KHU A;  2OYH A;  3B8E B;  3L74 J;  5CBO A;  1M1J A;  2WSS H;  1KIL B;  1P84 H;  3WMM 0;  2JO1 A;  3G71 P;  2HPC B;  3L73 E;  1JB0 J;  1LTG C;  3CX5 I;  1BE3 G;  3D6Z A;  2E75 D;  1JMB A;  3KYQ A;  1IC2 A;  2JDI H;  1FJK A;  5KLI C;  1SQV J;  2M8R A;  1JYH A;  3ZDM A;  1J2J B;  2H43 A;  3IAO A;  1G2C A;  3G3Z A;  1NH4 A;  2OYH B;  2A45 H;  4MN4 C;  5KLV K;  1U57 A;  1P84 E;  1GW3 A;  4BXL A;  5KJ7 C;  3EQ2 A;  3H1H G;  3NMD A;  2W6B A;  1M1J B;  1N73 B;  1E5W A;  3V2P A;  2ZYD A;  3H1K J;  1H0T A;  2JML A;  1URQ A;  2H89 C;  2E43 A;  2Y0D A;  2JWA A;  1KYO I;  2N9Y B;  5CCH D;  2D2C C;  3BAT A;  5GQQ A;  3CWB E;  1PPJ E;  2Q3I A;  4EIJ A;  1Q2N A;  1NU1 J;  2ZAE B;  1EDI A;  2HYN A;  4WY4 B;  3A7O A;  1VPC A;  4H44 B;  2WPV B;  4OVN F;  3RK2 B;  3V4Q A;  1UIX A;  5TJH A;  1T8Z A;  4EDF A;  3I5C A;  1E79 H;  1JCD A;  2JEE A;  4N78 E;  4D6T J;  1JCC A;  3RK3 E;  1L0L D;  5APV A;  1DD3 A;  3GHG A;  2W6J H;  1URQ B;  1OW6 A;  3O8Z A;  1KV4 A;  1P84 D;  2GUS A;  2XKM A;  1L0N G;  5CBN A;  1X22 A;  2YKQ A;  1OX3 A;  5H2F H;  3M0D A;  5CMZ A;  4GDO A;  1L0L G;  2NZ2 A;  2E5Y A;  1SQX K;  2XU6 A;  1RH5 B;  2KK7 A;  2QG4 A;  3L71 E;  3Q5P A;  1VQO P;  2G8Y A;  1NTZ D;  1DH3 A;  1KB9 I;  1W5C E;  4L73 A;  2WIT A;  1J1D B;  4I2L C;  2AXT H;  2CK3 H;  4Y99 C;  5H2F E;  1Q07 A;  2JJL A;  2IFN A;  3GP4 A;  1NTZ G;  2O1K A;  4R24 B;  1Y47 A;  3L70 J;  1EZV E;  1WT6 A;  3TGU J;  1FZA A;  3VMA A;  3HD7 D;  3HE5 B;  1S2E A;  4EI2 A;  4N78 D;  3RK3 D;  3TYY A;  3H1I D;  2PGD A;  5DJT B;  2YIU C;  2AXT E;  1OMI A;  1FOS F;  3I55 P;  4GIF A;  1IFN A;  1QVG O;  3A2A A;  2OTL P;  2FFD C;  1OVV A;  2FYU K;  4GKG A;  1TU3 F;  3HUS A;  2Z5I A;  5AW5 B;  3H1I G;  4GT1 A;  3TSI A;  1N86 A;  1YJW P;  1GU5 A;  3E1I A;  4HB1 A;  4U3F E;  3L71 D;  2QJY C;  2R44 A;  1IK7 A;  5AVU B;  4C7R A;  3OA7 A;  2E76 C;  2C9N Y;  2IBZ G;  2V7Q J;  5B66 H;  5KLV E;  1PP9 G;  2K3R A;  3H1L G;  5AVV B;  2O01 N;  2WMM A;  1N7S A;  3AEF C;  3MTU E;  4IL6 H;  3GPV A;  3JSV C;  1FOS E;  3HH0 A;  3VTP C;  1JY2 N;  2I1J A;  2Y9Z A;  5AVZ B;  1NTM K;  4AQR D;  4JYB A;  1ZME C;  3CC7 P;  5B66 E;  4ZKU A;  2O3J A;  1HH0 A;  1M90 Q;  1CI6 B;  1SQQ D;  2KB7 P;  2W27 A;  3B71 A;  2G3A A;  4IL6 E;  5KKZ C;  4HYT B;  1VF5 B;  1T2K C;  1J1E C;  4W80 A;  1YTZ I;  2BCC E;  2HOD A;  4LHF A;  2OYI C;  1S9K D;  1QL1 A;  1MKM A;  2M5A A;  2MKV A;  1JY3 N;  3SWK A;  1SQQ G;  2WSC J;  1BDC A;  1GL2 D;  5GTH H;  3PP5 A;  4U3F D;  1JY2 P;  2K9J A;  1LJ2 A;  1DEE G;  3KPE A;  5KLV D;  3P8C E;  1AJY A;  3VP9 A;  1RY3 A;  1L4A D;  2P1J A;  2Y9Y A;  3H1J D;  1G1J A;  1LTA C;  1SQX E;  5APS A;  2WTY A;  2AEF A;  2W6A A;  5KAI H;  5KLI B;  5KCB A;  2M0B A;  2ZT9 C;  1FJP A;  3H1J G;  1GDT A;  1XTC C;  3L37 A;  4R4E A;  3M0A A;  2IEF A;  1H8A A;  1DEB A;  2KNC A;  4W7Z A;  1K9M Q;  1N8R Q;  1Q86 Q;  3BCC E;  3FXD A;  1M57 D;  4YXW H;  2BCC D;  1A02 J;  1P84 I;  1FDI A;  3VMX A;  2PP6 A;  3D6Y A;  5AW0 B;  4RJT A;  1RHZ B;  2E5T A;  5KAI E;  2WQY C;  4C7N A;  1DD4 A;  3T97 B;  3SFD C;  2QJK C;  1MUU A;  3M9H A;  3CCV P;  2BAS A;  4QMA A;  2D2C B;  4AUW A;  1OZH A;  3CCR P;  3P8C D;  2J5U A;  1S72 P;  2FYU E;  5E01 A;  2KS1 A;  1FC2 C;  1L4A A;  4BRY A;  2A45 I;  1YTZ T;  1SQX D;  1L0N K;  4JPZ B;  1K73 Q;  4KT0 J;  1PGP A;  3SWY A;  1FZG A;  1L0L K;  3QWO C;  2WPR A;  3H6P A;  1LNQ A;  2YNY A;  1BGY E;  2IYP A;  2PFX A;  4HKZ H;  3RBZ A;  3B5N C;  1SQP J;  3FGA D;  1OIP A;  4C7N B;  2NPS C;  4NPD A;  2ZVN B;  5E79 H;  1GK4 A;  3BCC D;  1NO4 A;  3Q2Y A;  1WRG A;  3BAS A;  3VN0 A;  1WMK A;  5APT A;  2A06 E;  1NOH A;  1YQ4 C;  3KZI H;  3EZ6 A;  2XDJ A;  1T6A A;  1NTM E;  2E74 C;  2GM4 A;  2QM7 A;  1NTZ K;  5CCG A;  4BRY B;  3NXS A;  5APY A;  1JM0 A;  1RH6 A;  2FYN C;  1YBK A;  2BOW A;  3SWF A;  1Q81 Q;  3V2N A;  1EDL A;  3CMA P;  2K88 A;  4Y99 B;  2POH A;  1RF1 A;  3GW6 A;  4WLS A;  1LTJ A;  1PFI A;  3KZI E;  3L75 G;  4DCK A;  1BE3 E;  1L2P A;  3PLN A;  4NPF X;  1VDF A;  3MIW A;  1AA0 A;  5AW8 B;  1X79 B;  1BGY D;  3N4X A;  1EZV I;  3OW2 O;  1MV8 A;  3V6I A;  4EYY Q;  2KZJ A;  3UIA A;  4LLH A;  1JNM A;  4ZNC A;  3JC2 2;  2YIU B;  2K1A A;  2W90 A;  2OYO A;  1PM6 A;  3H1H E;  3KDP B;  3B49 A;  1Q82 Q;  4Y28 J;  2FFD B;  2A06 D;  1KIL A;  1NTK J;  1BCC G;  5APU A;  1NTM D;  4K35 A;  1ZR2 A;  3R8K A;  5AW6 B;  5AW9 B;  1ZXG A;  3CCE P;  2UWJ E;  4AYC A;  3RK2 D;  2Q6Q A;  3L74 G;  1JO5 A;  1MFZ A;  2QJY B;  2E76 B;  2O01 J;  2L91 A;  1W2B O;  3VOP A;  2KIK A;  3U1A A;  1BOW A;  3TK1 A;  3LW5 J;  3R8J A;  1URQ D;  4IFD K;  1IFP A;  3I56 P;  4R4M A;  5AVT B;  1BE3 D;  1SQV G;  1N73 A;  1JOC A;  1D5Y A;  3HRN A;  1SQQ K;  1RQV A;  3H1K D;  3K5B A;  3GF3 A;  4OGQ C;  3CCQ P;  1GTW A;  1LT9 C;  2IZ1 A;  1FZF A;  2Z4E A;  2B87 A;  1VQ4 P;  1LWU C;  4Z1M H;  3HD7 C;  5KKZ B;  3IF4 A;  1L0N E;  3H1H D;  1KN7 A;  1J1E B;  3UCS A;  1VQN P;  1KC8 Q;  3RK3 C;  4WY4 A;  2OYI B;  1GW4 A;  3H1K G;  1L0L E;  3AED C;  3D70 A;  1Q90 D;  1RE3 C;  2WPQ A;  1BSN A;  4N6J A;  3EWK A;  1SFC C;  2IFM A;  2WSF H;  1NU1 G;  2Z5H A;  5APQ A;  1R5L A;  1JBG A;  2CPB A;  2XV5 A;  2N1T C;  2B88 A;  3L72 J;  2VZ4 A;  1NAF A;  2B87 B;  1NTZ E;  3HE4 A;  1QEX A;  1R8D A;  2WZ7 A;  2P58 A;  4D6T G;  4KHX A;  3MP7 B;  2ZT9 B;  2P10 A;  4H13 C;  1VQL P;  4NPE A;  1K05 A;  2N9B A;  1L0N D;  4RO0 A;  4H0L D;  2Q7C A;  3BRT B;  5GTI H;  3H1I E;  1AVO A;  3MUD C;  4PV1 C;  5KAW A;  3B5N A;  1LP1 B;  3HE4 B;  2NPS A;  2J58 A;  2QJK B;  2L5G B;  2IX7 C;  2WSE H;  2IBZ E;  1OVR A;  1PP9 E;  3TGU D;  2XNX A;  2ZYA A;  3H1L E;  3HE5 A;  4I1L A;  1IJD B;  3PTZ A;  2GOV A;  1GL2 C;  1LT1 A;  1X0T A;  2AEM A;  3R2P A;  2P67 A;  2ZXE B;  3L70 G;  5GTI E;  4JBZ A;  1VF5 D;  1CZQ A;  3M91 A;  1HWT C;  3TGU G;  3QAO A;  3GG2 A;  2KOG A;  4RKU J;  2QEX P;  3KXD A;  1N7S D;  3S9O A;  4CPG A;  1K04 A;  3CCM P;  3FXE A;  3EZ2 A;  3L73 J;  3B5N B;  2NPS B;  2YMY A;  2NRG A;  1M56 D;  1DIP A;  2KUB A;  4N3Y B;  2QA4 P;  1SS1 A;  1A02 F;  3CME P;  1ZW0 A;  3RL0 D;  4RES B;  1SQQ E;  2E74 B;  3EZF A;  1JTH B;  4DJG A;  1OW7 A;  1EQ7 A;  2FYN B;  1GZL A;  2B9B A;  4UB6 H;  5AVS B;  2M3E A;  3P32 A;  2IBZ D;  1PP9 D;  1S9K E;  3H1L D;  1GD2 E;  1LTB C;  1LTI C;  4WWI A;  1QLE D;  1CI6 A;  2YKP A;  1S3J A;  3AE9 C;  2P2U A;  3L4F A;  4ZMD A;  3CWB J;  5KJ7 D;  3AEG C;  3CCS P;  1HGV A;  2JWD A;  3IN6 A;  4WVZ A;  1OFC X;  4UB6 E;  3GF7 A;  4M3L A;  3LID A;  4K3A A;  2W83 C;  3H1J E;  3V4W A;  1JY2 O;  3AEB C;  1NKN A;  2HG5 D;  2IPP A;  1ZOY C;  1HBW A;  1LTS C;  2YXQ B;  2KLU A;  1LT9 A;  4HH2 A;  1SQV K;  1LWU A;  2P7J A;  1JY3 O;  1HUC A;  2Q1K A;  1EXI A;  2J59 M;  3HTK B;  4IOI H;  3C9I A;  1X8Y A;  5AW7 B;  3GLM A;  5AW4 B;  3TNU B;  2WT7 B;  1RE3 A;  4JYC A;  2OG0 A;  5KJ7 A;  1SFC A;  5AW2 B;  1HTL C;  1VQ7 P;  1IK9 A;  3FWN A;  5KAF H;  1U7M A;  4KJM A;  3L35 A;  1FBM A;  3PH0 A;  2N1T A;  4OGQ B;  1PGO A;  1PGJ A;  4R4L A;  1LT9 B;  1PV3 A;  4OWF A;  3T97 A;  4IL6 X;  3M9B A;  1NU1 K;  1LWU B;  3U59 A;  2KVV A;  2ITA A;  3HD7 B;  2JP3 A;  3RK3 B;  3RGU A;  1AVY A;  3H32 B;  5CHX A;  1N2D C;  3C1L A;  5KAF E;  2SPZ A;  2E42 A;  1SFC B;  3M9Q A;  1R5S A;  3IFM A;  1M8O B;  1KIL E;  3D71 A;  1S5L X;  2HR3 A;  4U3F J;  5CCG D;  3RK2 C;  2N1T B;  2KP8 A;  2FXO A;  1OW8 A;  1VQP P;  1GK6 A;  3L75 E;  4B86 A;  2YMK A;  5KLV J;  2AXC A;  2RKL A;  3N7N A;  1NKZ B;  2YKO A;  3WUV A;  1URQ C;  3II6 A;  1SQP G;  5AW1 B;  3EZ9 A;  3VMY A;  3Q1M A;  3AE1 C;  1CSB A;  2OQQ A;  4AYZ A;  3BVH A;  4H13 B;  2RMZ A;  3USS A;  1AQ5 A;  2HLO A;  3C8V A;  1KYO D;  4XE5 B;  4R22 B;  2ZJS E;  1BCC E;  5AW3 B;  4YTP C;  5BU5 A;  2LXC B;  4PV1 B;  2E75 C;  4I6M C;  3EFG A;  3CPW O;  2BCC J;  3L74 E;  1NVO A;  1HJ0 A;  1HF9 A;  3GHG C;  1KIL D;  2QJP C;  4A1M A;  2IBZ I;  2YXR B;  1AV1 A;  4AYZ B;  3M0D C;  2Y0C A;  3L75 D;  2C0W A;  1FZC C;  1LGH B;  1SQV E;  1YI2 P;  1RQU A;  2FFD A;  1KD1 Q;  2XZR A;  4WB4 A;  1SQX J;  3CXH H;  5CCH C;  2KLV A;  2KXP B;  3AE7 C;  1HJB A;  3P8M C;  1QVF O;  1ZR4 A;  4UB8 H;  2OGU A;  4L75 A;  1AQT A;  1NTK G;  4B0Y A;  1Z56 A;  3H1K E;  1BCC D;  1CW5 A;  1SQB J;  1KB9 D;  1ZV8 A;  4L74 A;  3BCC J;  1IZN B;  3AE6 C;  1HGZ A;  4H0L C;  3L74 D;  2O1J A;  3CXH E;  1NU1 E;  3NFQ A;  4WY4 D;  1EDK A;  1KQS O;  4UB8 E;  2JKV A;  3O6Q A;  2ZT9 D;  4H44 D;  3A0H H;  2QRX A;  2ZFC A;  2KI7 B;  3HUS C;  2OAR A;  1USD A;  3LUR A;  1SQV D;  1JEK A;  1R8E A;  2OYI A;  4D6T E;  1NAY A;  2FYU J;  4PJ0 H;  2MJZ A;  1VF5 C;  5AVY B;  3OAK A;  3CI9 A;  4DCZ A;  1FDM A;  3A0H E;  3WUU A;  1N7S C;  1PZQ A;  3AE8 C;  1BGY J;  4YXD C;  3FWL A;  3O6Q B;  3L72 D;  3G6E P;  1X9V A;  1K8A Q;  2R5D A;  4PJ0 E;  5APX A;  3M06 A;  2R5B A;  3PJS K;  3SFE C;  3CXH D;  5L8R J;  1NU1 D;  2OTK E;  3W67 A;  3RL0 C;  4JF7 A;  1NTM J;  4DOJ A;  1IFJ A;  1OXZ A;  3L72 G;  1VQ5 P;  3B5N D;  2I8D A;  4DT0 A;  2NPS D;  1S4X A;  3L70 E;  3MGN A;  4OH8 B;  3R4Y A;  5AVQ B;  2KSE A;  3TGU E;  1NJI Q;  3SSU A;  1Q05 A;  4WLW A;  3Q3D A;  3V2Q A;  4D6T D;  4EOT A;  3MZW B;  3GK6 A;  1H89 A;  3IR9 A;  2V7Q H;  2E74 D;  3GMA A;  3AEC C;  1LP1 A;  4C46 A;  1JUN A;  1BE3 J;  1VQ9 P;  3PHL A;  1Y8A A;  2H7H A;  4I7Z C;  5KAV A;  4LC1 A;  1KOR A;  2LKM A;  3AE4 C;  3AE5 C;  1Y9B A;  3H1H J;  3ABV C;  2QVA A;  1SQP K;  1JMM A;  3E0H A;  1G2C B;  3W68 A;  3L73 D;  1YJ9 P;  2FKW B;  5CJ0 A;  2YO2 A;  2VRS A;  1KMI Z;  1FZE A;  1EDJ A;  3AE3 C;  3L70 D;  2Q9I A;  4W7Y A;  3P7K A;  2WSC H;  3RL0 g;  2AEJ A;  1KFM A;  1H0T B;  3L73 G;  1JTH A;  3CC2 P;  1PGQ A;  3V5B A;  2WPS A;  1ZLL A;  1BSH A;  5TIS H;  3S4R A;  1LX8 A;  1Q08 A;  1FZC A;  5KAU A;  1D7M A;  1L4A C;  2R3S A;  2GUV A;  4U7J A;  2DG6 A;  5CCH A;  2E75 B;  1L0N J;  1RF0 C;  2BEZ F;  3E1R A;  2DW3 A;  5KTB A;  1IO4 A;  3CWB D;  1PPJ D;  3QH9 A;  4WBA A;  1L0L J;  3CCL P;  4PD4 H;  3F89 A;  3GHG B;  1SQB K;  5TIS E;  5KAT A;  2QJP B;  4IFF A;  3CCU P;  4OGQ D;  1NWQ A;  1NYH A;  3CWB G;  1PPJ G;  2QM8 A;  2A45 G;  1FZC B; 
#chains in the Genus database with same CATH homology
 2WSE J;  1ZP0 C;  4Z1M H;  1ZME C;  3GF7 A;  4AYZ B;  4DCZ A;  2WQY C;  3UCS A;  1DD4 A;  1Y6U A;  1Q09 A;  2GOV A;  3T97 B;  1Q07 A;  3AE8 C;  3SFD C;  2QJK C;  3E0H A;  1Q06 A;  1VL2 A;  2IDB A;  1GMJ A;  2FBW C;  2QIW A;  3B71 A;  2G3A A;  3GP4 A;  3AEB C;  5KKZ C;  2D2C B;  1VF5 B;  3AED C;  4R24 B;  3D70 A;  2JML A;  1RQU A;  2H89 C;  4YXD C;  1Q90 D;  2HVA A;  5D8C A;  2J5U A;  1KIL E;  1VF5 D;  1ZOY C;  4LHF A;  1KMI Z;  3D71 A;  3EWK A;  3AE3 C;  1MKM A;  5E01 A;  2D2C C;  3QAO A;  2H88 C;  2MKV A;  3AEE C;  1S5L X;  4RKU J;  5GQQ A;  3AE2 C;  5KAW A;  3IN6 A;  2WSC J;  3AE7 C;  1Q0A A;  3S9O A;  2WSF J;  1PM6 A;  3SFE C;  1OW8 A;  3RL0 g;  4KT0 J;  1ZRT E;  5L8R J;  1JBG A;  1K04 A;  1KTM A;  2ZHH A;  3EZ2 A;  2YMK A;  2ZHG A;  3B49 A;  2YIU C;  4Y28 J;  4H44 B;  1OMI A;  2WPV B;  4B0Y A;  2VZ4 A;  1EXI A;  4H0L B;  1UIX A;  3R8K A;  4XFJ A;  2D2C D;  3H25 A;  1DIP A;  1AJY A;  5I44 A;  4H44 C;  1PL5 A;  3FGA D;  1LX8 A;  3EZ9 A;  1R8D A;  1TU3 F;  3Q1M A;  1Q08 A;  3AE6 C;  3AE1 C;  3R4Y A;  4H0L C;  1NGM B;  2OQQ A;  5KAU A;  4AYZ A;  2E76 B;  2O01 J;  3GLM A;  4H13 B;  3RK3 E;  3Q2Y A;  1DD3 A;  1Q05 A;  5I41 B;  4WLW A;  3Q3D A;  3EZF A;  2E74 B;  3G9R A;  1WMK A;  1OW7 A;  2QJY C;  1BOW A;  1IK7 A;  1OW6 A;  4H13 D;  2JO1 A;  2ZT9 B;  2OG0 A;  3GK6 A;  1YQ4 C;  2E76 C;  5D90 A;  3C8V A;  3LW5 J;  2P10 A;  2E74 D;  4U7J A;  2DG6 A;  4H13 C;  3R8J A;  2V7Q J;  3EZ6 A;  2E75 B;  2FXP A;  3GMA A;  3AEC C;  1JB0 J;  2BEZ F;  4R22 B;  2ZT9 D;  3O6Q A;  4H44 D;  2E74 C;  4I7Z B;  5M1B A;  5KCB A;  3Q5S A;  4R4M A;  3EZ7 A;  1K05 A;  1PIX A;  3D6Z A;  2ZT9 C;  2E75 D;  1RH6 A;  2FYN C;  3AEF C;  4H0L D;  4YTP C;  4R4E A;  4GDO A;  2IEF A;  4PV1 B;  3GPV A;  2BOW A;  2E75 C;  3Q5R A;  4J2N A;  4OGQ B;  4I7Z C;  2KCU A;  5KLI C;  2K9Y A;  1JYH A;  2NZ2 A;  5KAT A;  4R4L A;  4TT3 H;  1D5Y A;  5KAV A;  4PV1 D;  1KOR A;  3LUR A;  1PV3 A;  4OGQ D;  1RQV A;  4IL6 X;  5KAX A;  1EXJ A;  3HH0 A;  3Q5P A;  4PV1 C;  1HJ0 A;  3IAO A;  1R8E A;  1FDO A;  2E76 D;  3AE9 C;  1HF9 A;  2BEQ D;  3ABV C;  4OGQ C;  2KVV A;  3AE4 C;  3GF3 A;  2G8Y A;  1S1C X;  1KQF B;  1NYH A;  3AEA C;  1KQG B;  2QJP C;  3AE5 C;  1FDI A;  3AEG C;  4A1M A;  2QSI A;  1Y9B A;  3D6Y A;  2JP3 A;  1U57 A;  1YQ3 C;  1VF5 C;  4WLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...