3Q1MA

Crystal structure of bmrr dimer bound to dna and the ligand 4-amino-quinaldine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q1mA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q1mA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q1mA03
1BOWA 1JBGA 1Q05A 4AYZB 5GQQA 1Q08A 2DG6A 2ZHGA 3D6YA 3GK6A 4R22B 3GPVA 3D71A 1EXIA 3G9RA 3R8KA 3D70A 3B49A 3Q5RA 3QAOA 1R8EA 3Q5SA 3GP4A 3UCSA 4WLSA 4R4EA 3Q1MA 3HH0A 4A1MA 2VZ4A 1D5YA 2OQQA 1Q06A 3Q2YA 5KAWA 2JMLA 1JYHA 5KAUA 5KAXA 4R4MA 2BOWA 5KCBA 4R24B 4J2NA 3E0HA 2HVAA 4AYZA 3Q5PA 4B0YA 3T97B 1Q0AA 1DIPA 3Q3DA 2ZHHA 5I41B 5D90A 4R4LA 5I44A 1Q09A 2J5UA 5KAVA 5KATA 5E01A 3IAOA 5D8CA 1R8DA 2KCUA 3LURA 3R8JA 4WLWA 1EXJA 3D6ZA 2GOVA 1Q07A
chains in the Genus database with same CATH superfamily
1YYCA 2K88A 2E75D 1HGZA 3K5BA 4H13C 2W6JH 3GW6A 4EDFA 2E43A 2QJKB 1KYOH 1SQBJ 2J5UA 5CMZA 1E5WA 1VQ4P 2QJPB 3AE3C 2IZ1A 1L2PA 1IFDA 3L37A 3U59A 4R22B 1L0NG 3QAOA 2PFXA 2FYUE 3CXHH 2GUSA 5AVXB 5APQA 2J58A 2OTLP 3KXDA 1SQQD 1SVFA 3PP5A 2IBZI 3L73E 3BCCD 3L72G 3MIWA 3AE2C 1WRGA 1RQVA 2JMLA 1EZVD 1SQXK 1HF9A 4UB8H 2A45G 5AW4B 3L75J 1EZVE 1LT9B 3U1CA 3V2RA 1KTMA 2DG6A 1W5CE 1EXIA 1URQA 1NTKK 3VTPC 2QJKC 1UIXA 5AVUB 2ZYDA 1WMKA 2KB7P 1KQLA 1IFIA 3AEAC 1EZVI 4D6TG 4J2NA 1VF5C 2I8DA 3RL0C 3H1LG 5B66H 1N7SD 3AECC 1KYOE 3SSUA 1FZBA 2ZJSE 3L70G 2QA4P 5KAFH 5CCHA 1KYOI 1ZMEC 3CCQP 1NTKE 3RK2D 2WPRA 4WY4C 3M0DA 5B5EH 1NU1J 3GG2A 2FY8A 3TF5A 3TGUE 1IJDB 5H2FE 5D8CA 3LURA 1W2BO 2BEZF 3HD7A 2E74D 1SQBD 1HTLC 1YBKA 4HB1A 2QEXP 3B49A 2WSEJ 2KP8A 3FXEA 3HE5A 1LNQA 1MZ9A 5TISH 1NAYA 4GODA 4H0LC 2R3CA 1SQPJ 1RE3A 1S5LH 4AYZA 3VMXA 2RMZA 1LTBC 2YIUC 1DH3A 2R5DA 3RL0g 3CXHI 1JBGA 2NPSC 2KK7A 2WSCJ 3L70D 2OYOA 1XTCC 1P84I 3C8VA 1JY3P 2JO1A 2W6BA 1FC2C 1GU5A 2FYUG 1JYHA 3GHGC 4W7ZA 4JBZA 4M3LA 3OJAB 2W90A 1FZCC 4GKGA 2H88C 2ZVNB 3H1KG 4WBAA 3F5HA 3SWKA 2CK3H 3L74E 2N9YB 3OA7A 1DEBA 1NVOA 1AFOA 1FU1A 1NKNA 1BCCE 1Q07A 1FDIA 1USDA 5BU5A 1KN7A 1N7LA 2YMYA 1QL1A 4DOJA 3USSA 2C0WA 2IFNA 1VQKP 1LT9A 2HYNA 2N1TB 4H13B 3VMZA 1ZRTD 1HUCA 2P7JA 2OGUA 4O9BA 3A0BE 4WY4A 1R5LA 3FGAD 1H8AA 4TLFA 1QGKB 2L5GB 3EFFK 3TYYA 4ZKUA 3L72E 1NWQA 2KI7B 3H1ID 2BASA 1JMMA 2WSFH 2E76D 1FZFA 3ZDMA 2Y0DA 3KHUA 2KZJA 1PZQA 2FYUD 3L36A 5KAUA 2PRRA 1KQFB 1FS0E 4PD4D 2AXTH 2AEJA 2B87B 1Y8AA 5B5EE 3ABVC 4ZKPA 4C7NA 1S5LX 1YJ9P 1SQVJ 1OIPA 3L70J 2HPCA 1GU4A 1S1CX 2PP6A 2BOWA 3AEGC 2KNCA 1JTHA 2D2CB 1Q09A 3H1JG 3C1LA 2XKMA 2K9YA 2V4HA 1VQPP 1OWAA 1RH5B 4DT0A 3TNUA 2ZYGA 4A1MA 2N1TC 1QEXA 1CSBA 5AVYB 4R24B 1MFTA 1VQ9P 3MUDA 1RF0A 1QX8A 3E7KA 1OVUA 3RK3C 2P58A 1M90Q 2H7HA 1PGOA 1Y9BA 1VPCA 3H1JE 3RBZA 3O8ZA 1AVOA 3RGUA 3IF4A 3HE5B 1N73B 2Q6QA 3SFDC 1Q81Q 1AA0A 2WPVB 3CC4P 3A0HH 3S4RA 3NMDA 3H1JD 4GOFA 3IFMA 1IFPA 1YQ4C 4K3AA 3JC22 1FJKA 1VQOP 5KAIE 1FJPA 1N73C 5CBOA 1EDJA 3MD0A 3L75E 2OYIC 1MFZA 3H1HE 1PPJD 2GM4A 4LC1A 3F89A 1PP9E 2YKOA 3WU2E 2KVVA 1G2CA 1NOHA 3JCUH 2KLUA 2QM7A 1ZLLA 1NTMK 4LLHA 3AE1C 3H1KD 1PGQA 2AXTE 4AYCA 4U3FJ 1L0NJ 4AUWA 4QMAA 2YXQB 3I5CA 3CL3D 1VQLP 3CX5E 2ZXEB 1NTZE 1KILE 2M0BA 3CLQA 3A3YB 1BGYD 5CCGA 1HJ0A 1KD1Q 1LJ2A 4DZOA 3HTKB 1Y47A 3RK3E 5CBNA 3WMM0 4HH2A 2WITA 1FDOA 2O01J 1KV4A 3PLNA 4PV1C 2B88A 4N78D 1NTMJ 5AVWB 1SQPE 2FFDB 1EDIA 2YMKA 3UIAA 1CI6B 3P8MC 3EZ9A 4N78E 2OYIB 2FYUK 3M9BA 4I2LC 5GTHE 1SFCC 4Z1MH 1XTGB 2YNYA 4HJGH 4EI2A 3CCLP 1VL2A 4IFFA 1H89A 2Z5HA 1GMJA 3H1LD 3L74D 2BCCJ 1JY3N 4L75A 1JEKA 1NU1D 2FYZA 1L4AC 2FXMA 3CCEP 1PFIA 1RF1C 2KNCB 2QJYB 4H44D 3I55P 4XA4A 2H8PD 1X8YA 2P10A 2M3EA 2WPSA 2FBWC 2OTJP 4W80A 5M1BA 1KILC 1MUUA 2VZ4A 1S5LE 5KAWA 1HVVA 2IYPA 3CCSP 4R4LA 5E79H 1OW6A 1Q82Q 2IPPA 1RH6A 1PGJA 1LGHB 1HWTC 1BDCA 2O1JA 3RK2B 4L76A 3EZ2A 3B4SA 3FWLA 1T2KD 3VOPA 2A06D 1RF1A 3AE5C 1BE3J 2HG5D 2FXPA 4ZNCA 2KCUA 2QJPC 1EXJA 1RY3A 4DJGA 2KS1B 5AW7B 1OVVA 3LW5H 2R44A 3CWBG 1Q7YQ 1LTSC 5H2FH 1J1EB 3BASA 1VQNP 2K3RA 4JQ0D 3B5ND 1LP1A 1VDFA 2FFDA 1J1DB 2KS1A 4OGQD 1Y6UA 2KOGA 1SQQE 5APWA 2XV5A 1HH0A 3II6A 2K1AA 2IBZE 1NTMD 1ZRTE 4RKUJ 1J1DC 2JWAA 4JYCA 3L73J 1HBWA 3TGUD 3H32A 5KAVA 3MHVA 1AQTA 1A02J 3GPVA 3GHGA 4I7ZC 1L0NK 1NTKG 1Q90D 2YKPA 2IYOA 2W8ZA 1QLED 2KYVA 5AVRB 3T97B 2IBZG 2I1KA 2G8YA 2A06G 3H1KJ 4PD4I 2JR8A 5TISE 2LXCB 5AVQB 3H1IJ 4JF7A 3KQGA 1YITP 2IEFA 3L70E 1KYOD 3L71G 1S2EA 2C0XA 5KCBA 2W83C 2IDBA 1GDTA 1PL5A 3HE4A 2QG4A 3Q3DA 2H89C 3CWBE 5I44A 1YJWP 2E5YA 2OTKE 2Q3IA 1OW7A 1JUNA 4GDOA 3Q5SA 3PRJA 1JB0J 1BSNA 3P7KA 1L4AB 2NPSD 5CCGC 1GK4A 1GW4A 3W68A 1BOWA 2V7QJ 5KLVE 1K04A 1X9VA 5GTHH 1EDLA 1JY3O 3L75G 3B8EB 1G1IA 4D6TE 3FX0A 5KLVG 2MKVA 3SFEC 1ZXGA 3CX5D 1OW8A 2WWWA 3L35A 4BWNA 2JJLA 3B5NB 1EQ7A 4WY4D 1ZR2A 3V2NA 3GP4A 1PP9D 3Q1MA 3VMYA 3R4YA 2E74B 3EFGA 3P32A 4PJ0H 3SWFA 2Y0CA 1AV1A 1KB9H 2IBZD 3H1HJ 2A45H 3VP9A 3PHLA 3L71E 1S72P 1T2KC 2XU6A 3AE9C 2FYUJ 5EFWB 5AW8B 3L75D 1S9KE 3H1LE 1NH4A 4EYYQ 1IFJA 2O3JA 1NJIQ 1J2JB 2WT7B 3RK2C 5KJ7C 2NRGA 2R32A 1M56D 4EOTA 4IL6H 1RHZB 4CPGA 5KLVD 4LHFA 4PJ0E 3AE8C 2P67A 1ZOYC 2MJZA 5CCHD 2BCCD 3VP8A 5B66E 2I1JA 3BATA 3JCUE 2M3BA 1U57A 1M1KQ 5CHXA 2XNDH 4WLSA 2WSCH 1MV8A 1KB9E 1OZHA 3CX5H 2WSSH 1SQXJ 3CC7P 2ZHGA 3GK6A 2DW3A 2L91A 1L4AD 3NFQA 3OW2O 1PP9G 2HODA 3V5BA 1FBMA 2G3AA 3Q2YA 3M0DC 3QH9A 3MGNA 1GZLA 2XDJA 3RBXA 1LTAC 1FZGA 1VQ6P 5AW2B 1K9MQ 3A7OA 3CXHD 2BCCG 2V7QH 1FE6A 1KB9I 5CCHC 1KILA 3EWKA 1LTJA 4GIFA 1BGYG 1S4XA 1PPJG 1OX3A 2J59M 3KDPB 3KPEA 1ZP0C 3MUDC 2JEEA 5CJ0A 5KLIB 2AXCA 1SQVG 1IZNB 2YKQA 2C9NY 4IFDK 1QL2A 2OYIA 1IK9A 1CI6A 1X0TA 3M06A 4IOIH 2E75B 2HVAA 3HUSC 1NTZJ 1SQXE 1NTZG 3R8JA 5KAIH 1IK7A 1JY2O 1Q05A 4HYTB 3AEFC 5AVVB 1KILD 1M7LA 3V4WA 2KZIA 4I7ZB 4B86A 2KSEA 3RK3D 2ITAA 3E1IA 1PM6A 1N7SA 3CX5I 5AW9B 2A06E 2RH0A 1GD2E 1AVYA 2WTYA 1RQUA 2A45I 3GF7A 3SWYA 5KJ7A 3B71A 5KJ7D 2ZXXA 3G3ZA 3Q5PA 4B0YA 3WUTA 3B5NA 2P1JA 1T8ZA 2Y0EA 1PIXA 2GOVA 5BU8B 1PPJE 1BE3G 1N7SB 3H1HD 3L74G 3D6YA 1P84E 4PV1B 5AW0B 4U3FG 3EZFA 1URQB 4PV1D 1QVFO 1GTWA 3P8CD 2GA1A 2Q7CA 4IFMA 3V2QA 1JCCA 3IAOA 3L73D 5K5GB 1JNMA 2SPZA 3TGUJ 3U1AA 2D2CD 2JKVA 3C9IA 3O6QB 4RESB 2CPBA 2R3SA 1DD4A 2O1KA 1VF5B 5KLVJ 1KQSO 1PGPA 3H1IG 3HUSA 2Q9IA 3CWBJ 2YO2A 3HE4B 1LTGC 2QJYC 4U3FE 1DX7A 5GQQA 4H13D 3M0AA 1L0LE 2ZT9B 3CXHE 3RK3B 3EZ6A 1KILB 1BGYE 3AEEC 1OVRA 1L0LK 1J1EC 2KUBA 3PJSK 2QE7H 1ZV8A 3H1HG 1NAFA 3V2PA 1SQQK 3BRTB 2KLVA 1DEEG 3L74J 2HPCB 3Q5RA 3L73G 4IL6X 4JPZB 3GHGB 4LGDE 2IFMA 2OYHC 1NTME 3H6PA 1GL2C 1DIPA 2B87A 2WVRA 2WPQA 1R8DA 1ZN5A 3NTNA 1K8AQ 2N1TD 4OVNF 1SP4A 1JM0A 1M57D 3S1KA 1N2DC 1R8EA 4BRYA 1YTZT 5APXA 1FZEA 5KAXA 3HRNA 1LT1A 1VQ7P 1VQ8P 5APUA 2K37A 4C7RA 3L71J 2XNXA 3NXSA 1L0LD 3G71P 3LIDA 5APVA 2UWJE 3CCVP 3H25A 3KZIE 1FZAA 4R4MA 1GK6A 1PP9J 4XFJA 3W67A 2OYHA 3GMAA 2N1TA 3B5NC 4WB4A 1EZVG 2WT7A 1UIIA 4YPCA 1VQMP 1M8OB 3RL0D 3V6IA 1LTJB 1JY2N 1N86A 4BRYB 1SQQG 2HR3A 5KKZB 3CC2P 4U7JA 2HLOA 3CD6P 2ZHHA 1SFCB 2O01N 1TU3F 4XE5B 3TSIA 3G4SP 1W2EA 2M5AB 5DJTB 3BRVB 3G6EP 3G9RA 4DCZA 2R5BA 1KQGB 5AW3B 3AE7C 4Y99C 2FYNC 4IL6E 3AE6C 2HODB 2RN0A 5APTA 4RO0A 3FWNA 1Q0AA 5AW1B 2VRSA 3MTUE 2ZT9D 4HKZH 1SQVE 3VYIA 4DCKA 4OGQC 3BCCG 3L72D 4H0LB 1N8RQ 2O01H 3BCCJ 2W6AA 3JSVC 3S9OA 2B9BA 1LWUA 3IR9A 5D90A 4AQRD 4D6TD 1T3JA 2PGDA 2ZAEB 3AEDC 4AYZB 3TGUG 3H1LJ 1LTJC 1U7MA 3CCMP 2Q5UA 1IFMA 2E42A 4GOEA 3HD7B 1URQD 2IZ0A 5E01A 1SQPD 3OAKA 2WMMA 1NTMG 4I1LA 2YXRB 1CZQA 1DD3A 4WWIA 3D71A 5CCGD 3VMAA 1LTTC 3RL0B 3L71D 3LIEA 1L0LJ 2WQYC 1YHQP 3GLMA 3FXDA 3P8CE 2M8RA 2LXBA 3AEBC 5KAFE 2D2CC 3KZIH 1CW5A 1GL2B 1P84D 5CJ4A 1P84H 1USEA 1GW3A 5KLIC 2Y9YA 1GL2A 1Q2NA 1SLQA 3CMEP 3WU2H 1LTIC 3IN6A 2OARA 4N6JA 1OXZA 1G1JA 2Z4EA 4YXDC 2Q1KA 1FOSF 1BCCG 1SQXD 1EC5A 1KZUB 1RE3C 1SQPG 2FXOA 5TJHA 2N9BA 3ITKA 3M9QA 3LW5J 1M1JA 1QVGO 2Q3EA 2IX7C 1L4AA 2PAJA 2KIKA 3CWBD 1N73A 4MN4C 4ASVA 1SQPK 3R2PA 3M9HA 4JYBA 5GTIE 5KKZC 3N7NA 1NTZK 5AW5B 4C46A 2JDIH 4ASWA 4ZMDA 1Q08A 1K05A 1NTKD 3UCSA 5AVSB 3GF3A 1BCCD 1SS1A 1YTZI 1RE4C 4W7YA 2CPSA 1S9KD 1ZR4A 1AJYA 2RKLA 1MKMA 3MP7B 5AVTB 2WSEH 1T3UA 3HD7D 2JP3A 4OGQB 3M91A 4L73A 1KORA 2KSJA 2E76C 1NTZD 2AEMA 3CCJP 1HJBA 3CCUP 1FDMA 1R5SA 3E0HA 3E1RA 4YXWH 1SQXG 2HFED 4N3YB 2NPSA 2Z5IA 1A02F 3PTZA 3H32B 5GTIH 3WUUA 3A0HE 2ZFCA 2Y9ZA 3A5TA 2C9LY 3A2AA 1YI2P 2LKMA 1JOCA 4U3FD 5KLVK 2OYHB 1RE4A 1NYHA 3VN0A 4A7PA 1LP1B 2QVAA 1YJNP 4NPDA 1LX8A 1NU1K 1URQC 4UB6E 4KHXA 2ZYAA 3CMAP 1OFCX 1SQBG 4H44B 3TDKA 2QIWA 2XZRA 1SQQJ 1FZCB 2ZT9C 1YIJP 1M1JB 3A0BH 4EIJA 5DJUB 1RF1B 4OWFA 2P2UA 1SQVK 2YIUB 2WSFJ 2B89A 4NPFX 2BEQD 2POHA 1M1JC 2K9JB 1SQVD 5KTBA 1NU1G 1E79H 5AW6B 1D7MA 1RF0C 3H1KE 5BVZA 4OH8B 2LR2A 1LWUC 1LT9C 1FAVA 2QSIA 1NU1E 2ZVOB 2YO3A 1G2CB 1NTKJ 3N4XA 3PH0A 1NHLA 3TK1A 2QRXA 1X22A 4KJMA 1L0ND 1JMBA 5AVZB 2FKWB 3CI9A 2FFDC 1U7JA 4UB6H 1BGYJ 2AEFA 4YTPC 1N7SC 4WVZA 4TT3H 3I56P 3CCRP 4K35A 1IFNA 3HUSB 1NO4A 1SQBE 1BE3E 1JO5A 1H0TB 3BCCE 2W27A 1L0LG 1H0TA 3O6QA 2E5TA 4KT0J 5KATA 1ZW0A 1JCDA 2FYNB 3AE4C 1KMIZ 1BE3D 1HGVA 1L0NE 1BDDA 1FOSE 2GUVA 1VQ5P 5L8RJ 4UB8E 1WT6A 3TNUB 3HTKA 1IO4A 1BSHA 1JY2P 4PD4H 1BCCJ 1IC2A 2JWDA 4NPEA 2H43A 3T97A 1NKZB 3WUVA 4D6TJ 1VF5D 4I6MC 1GL2D 4C7NB 3HH0A 1D5YA 1Q06A 1EDKA 5APSA 3KYQA 5APYA 3V4QA 2M5AA 1Z56A 2KXPB 1YQ3C 1SFCA 2K9JA 3D70A 1NGMB 1SFCD 1KC8Q 4GT1A 1KB9D 4R4EA 4H44C 1K73Q 2OQQA 3BVHA 1KFNA 3H1JJ 2OG0A 4PD4E 1T6AA 1AQ5A 4L74A 1H88A 1FZCA 2NZ2A 3R8KA 2BCCE 3CPWO 4WY4B 1X79B 3H1IE 3EQ2A 3QWOC 5I41B 5C39A 4H0LD 1LWUB 3L72J 1SQBK 1OMIA 1KFMA 4RJTA 4Y28J 2E74C 2WZ7A 4Y99B 2QM8A 1Q86Q 1S3JA 5E79E 2E76B 3EZ7A 1PV3A 2E75C 4BXLA 2NPSB 3MZWB 3HD7C 4WLWA 3D6ZA 1JTHB 3L4FA
chains in the Genus database with same CATH topology
3ABVC 3AECC 4H44D 1MKMA 2ZHGA 3GK6A 3GPVA 4DCZA 3G9RA 1RQUA 2JP3A 4OGQB 3GF7A 2KVVA 3Q5RA 1KQGB 2E75D 4IL6X 2P10A 2QSIA 1KORA 1VF5D 3GP4A 4I7ZC 2FBWC 3AE7C 3Q1MA 5M1BA 2E76C 3HH0A 1S5LX 2VZ4A 1Q90D 2FYNC 3AE6C 3B71A 3AE1C 1Q06A 3R4YA 2E74B 2G3AA 3Q2YA 5KLIC 5KAWA 1S1CX 2BOWA 3AEGC 3E0HA 3Q5PA 4B0YA 3T97B 1Q0AA 2D2CB 2G8YA 4R4LA 1DIPA 1Q09A 2J5UA 1YQ3C 1R8DA 2K9YA 1KILE 1OW6A 3AE3C 1ZMEC 1PIXA 1Q07A 1FDIA 2GOVA 3IN6A 1HJ0A 2ZT9D 3AE9C 1RH6A 3D6YA 4R22B 3D70A 3QAOA 2IEFA 1NGMB 1R8EA 3EWKA 4PV1B 4YXDC 4OGQC 4R4EA 3EZ2A 4H44C 4A1MA 4YTPC 2OQQA 4H0LB 3RK3E 3EZFA 2OG0A 4TT3H 4PV1D 3S9OA 5KAXA 3AE5C 4R24B 5KCBA 2IDBA 1PL5A 2FXPA 3Q3DA 2H89C 1FDOA 5D90A 2O01J 1ZP0C 5I44A 3LW5J 5D8CA 3IAOA 2KCUA 3LURA 4H13B 2QJPC 1EXJA 4H13C 4PV1C 2BEZF 1NYHA 2NZ2A 3AEDC 4AYZB 2E74D 1OW7A 2D2CD 3R8KA 1Y9BA 2YMKA 4GDOA 1LX8A 3B49A 2WSEJ 1DD4A 3AE2C 3Q5SA 1RQVA 3EZ9A 3FGAD 4LHFA 3SFDC 3H25A 3AE8C 4H0LC 4H44B 3O6QA 2JMLA 1JB0J 4R4MA 1VF5B 1HF9A 2QIWA 2E75B 2HVAA 4AYZA 4OGQD 4KT0J 2WPVB 1ZOYC 4XFJA 1Y6UA 5I41B 3GMAA 2YIUC 2ZT9C 5KATA 5E01A 3R8JA 3AE4C 4Z1MH 5KKZC 1IK7A 1KMIZ 4H0LD 3RL0g 1BOWA 1JBGA 1KTMA 1Q05A 2E76D 1K04A 1DD3A 2V7QJ 3AEFC 2QJYC 1Q08A 2DG6A 1K05A 5GQQA 3D71A 1EXIA 4H13D 1OMIA 2QJKC 2WSCJ 1UIXA 1VL2A 4Y28J 1U57A 3C8VA 1WMKA 5L8RJ 2ZT9B 3UCSA 2E74C 2WSFJ 4WLSA 1YQ4C 3EZ6A 3GF3A 1GMJA 1ZRTE 3AEAC 4I7ZB 2JO1A 4RKUJ 2E76B 2WQYC 3AEEC 5KAUA 1JYHA 3EZ7A 2MKVA 2BEQD 3SFEC 1KQFB 4J2NA 3GLMA 1PM6A 1OW8A 4U7JA 1VF5C 1PV3A 2E75C 2ZHHA 3AEBC 5KAVA 1D5YA 2D2CC 4WLWA 1TU3F 2H88C 3D6ZA 1AJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOW A;  1JBG A;  1Q05 A;  4AYZ B;  5GQQ A;  1Q08 A;  2DG6 A;  2ZHG A;  3D6Y A;  3GK6 A;  4R22 B;  3GPV A;  3D71 A;  1EXI A;  3G9R A;  3R8K A;  3D70 A;  3B49 A;  3Q5R A;  3QAO A;  1R8E A;  3Q5S A;  3GP4 A;  3UCS A;  4WLS A;  4R4E A;  3Q1M A;  3HH0 A;  4A1M A;  2VZ4 A;  1D5Y A;  2OQQ A;  1Q06 A;  3Q2Y A;  5KAW A;  2JML A;  1JYH A;  5KAU A;  5KAX A;  4R4M A;  2BOW A;  5KCB A;  4R24 B;  4J2N A;  3E0H A;  2HVA A;  4AYZ A;  3Q5P A;  4B0Y A;  3T97 B;  1Q0A A;  1DIP A;  3Q3D A;  2ZHH A;  5I41 B;  5D90 A;  4R4L A;  5I44 A;  1Q09 A;  2J5U A;  5KAV A;  5KAT A;  5E01 A;  3IAO A;  5D8C A;  1R8D A;  2KCU A;  3LUR A;  3R8J A;  4WLW A;  1EXJ A;  3D6Z A;  2GOV A;  1Q07 A; 
#chains in the Genus database with same CATH topology
 1YYC A;  2K88 A;  2E75 D;  1HGZ A;  3K5B A;  4H13 C;  2W6J H;  3GW6 A;  4EDF A;  2E43 A;  2QJK B;  1KYO H;  1SQB J;  2J5U A;  5CMZ A;  1E5W A;  1VQ4 P;  2QJP B;  3AE3 C;  2IZ1 A;  1L2P A;  1IFD A;  3L37 A;  3U59 A;  4R22 B;  1L0N G;  3QAO A;  2PFX A;  2FYU E;  3CXH H;  2GUS A;  5AVX B;  5APQ A;  2J58 A;  2OTL P;  3KXD A;  1SQQ D;  1SVF A;  3PP5 A;  2IBZ I;  3L73 E;  3BCC D;  3L72 G;  3MIW A;  3AE2 C;  1WRG A;  1RQV A;  2JML A;  1EZV D;  1SQX K;  1HF9 A;  4UB8 H;  2A45 G;  5AW4 B;  3L75 J;  1EZV E;  1LT9 B;  3U1C A;  3V2R A;  1KTM A;  2DG6 A;  1W5C E;  1EXI A;  1URQ A;  1NTK K;  3VTP C;  2QJK C;  1UIX A;  5AVU B;  2ZYD A;  1WMK A;  2KB7 P;  1KQL A;  1IFI A;  3AEA C;  1EZV I;  4D6T G;  4J2N A;  1VF5 C;  2I8D A;  3RL0 C;  3H1L G;  5B66 H;  1N7S D;  3AEC C;  1KYO E;  3SSU A;  1FZB A;  2ZJS E;  3L70 G;  2QA4 P;  5KAF H;  5CCH A;  1KYO I;  1ZME C;  3CCQ P;  1NTK E;  3RK2 D;  2WPR A;  4WY4 C;  3M0D A;  5B5E H;  1NU1 J;  3GG2 A;  2FY8 A;  3TF5 A;  3TGU E;  1IJD B;  5H2F E;  5D8C A;  3LUR A;  1W2B O;  2BEZ F;  3HD7 A;  2E74 D;  1SQB D;  1HTL C;  1YBK A;  4HB1 A;  2QEX P;  3B49 A;  2WSE J;  2KP8 A;  3FXE A;  3HE5 A;  1LNQ A;  1MZ9 A;  5TIS H;  1NAY A;  4GOD A;  4H0L C;  2R3C A;  1SQP J;  1RE3 A;  1S5L H;  4AYZ A;  3VMX A;  2RMZ A;  1LTB C;  2YIU C;  1DH3 A;  2R5D A;  3RL0 g;  3CXH I;  1JBG A;  2NPS C;  2KK7 A;  2WSC J;  3L70 D;  2OYO A;  1XTC C;  1P84 I;  3C8V A;  1JY3 P;  2JO1 A;  2W6B A;  1FC2 C;  1GU5 A;  2FYU G;  1JYH A;  3GHG C;  4W7Z A;  4JBZ A;  4M3L A;  3OJA B;  2W90 A;  1FZC C;  4GKG A;  2H88 C;  2ZVN B;  3H1K G;  4WBA A;  3F5H A;  3SWK A;  2CK3 H;  3L74 E;  2N9Y B;  3OA7 A;  1DEB A;  1NVO A;  1AFO A;  1FU1 A;  1NKN A;  1BCC E;  1Q07 A;  1FDI A;  1USD A;  5BU5 A;  1KN7 A;  1N7L A;  2YMY A;  1QL1 A;  4DOJ A;  3USS A;  2C0W A;  2IFN A;  1VQK P;  1LT9 A;  2HYN A;  2N1T B;  4H13 B;  3VMZ A;  1ZRT D;  1HUC A;  2P7J A;  2OGU A;  4O9B A;  3A0B E;  4WY4 A;  1R5L A;  3FGA D;  1H8A A;  4TLF A;  1QGK B;  2L5G B;  3EFF K;  3TYY A;  4ZKU A;  3L72 E;  1NWQ A;  2KI7 B;  3H1I D;  2BAS A;  1JMM A;  2WSF H;  2E76 D;  1FZF A;  3ZDM A;  2Y0D A;  3KHU A;  2KZJ A;  1PZQ A;  2FYU D;  3L36 A;  5KAU A;  2PRR A;  1KQF B;  1FS0 E;  4PD4 D;  2AXT H;  2AEJ A;  2B87 B;  1Y8A A;  5B5E E;  3ABV C;  4ZKP A;  4C7N A;  1S5L X;  1YJ9 P;  1SQV J;  1OIP A;  3L70 J;  2HPC A;  1GU4 A;  1S1C X;  2PP6 A;  2BOW A;  3AEG C;  2KNC A;  1JTH A;  2D2C B;  1Q09 A;  3H1J G;  3C1L A;  2XKM A;  2K9Y A;  2V4H A;  1VQP P;  1OWA A;  1RH5 B;  4DT0 A;  3TNU A;  2ZYG A;  4A1M A;  2N1T C;  1QEX A;  1CSB A;  5AVY B;  4R24 B;  1MFT A;  1VQ9 P;  3MUD A;  1RF0 A;  1QX8 A;  3E7K A;  1OVU A;  3RK3 C;  2P58 A;  1M90 Q;  2H7H A;  1PGO A;  1Y9B A;  1VPC A;  3H1J E;  3RBZ A;  3O8Z A;  1AVO A;  3RGU A;  3IF4 A;  3HE5 B;  1N73 B;  2Q6Q A;  3SFD C;  1Q81 Q;  1AA0 A;  2WPV B;  3CC4 P;  3A0H H;  3S4R A;  3NMD A;  3H1J D;  4GOF A;  3IFM A;  1IFP A;  1YQ4 C;  4K3A A;  3JC2 2;  1FJK A;  1VQO P;  5KAI E;  1FJP A;  1N73 C;  5CBO A;  1EDJ A;  3MD0 A;  3L75 E;  2OYI C;  1MFZ A;  3H1H E;  1PPJ D;  2GM4 A;  4LC1 A;  3F89 A;  1PP9 E;  2YKO A;  3WU2 E;  2KVV A;  1G2C A;  1NOH A;  3JCU H;  2KLU A;  2QM7 A;  1ZLL A;  1NTM K;  4LLH A;  3AE1 C;  3H1K D;  1PGQ A;  2AXT E;  4AYC A;  4U3F J;  1L0N J;  4AUW A;  4QMA A;  2YXQ B;  3I5C A;  3CL3 D;  1VQL P;  3CX5 E;  2ZXE B;  1NTZ E;  1KIL E;  2M0B A;  3CLQ A;  3A3Y B;  1BGY D;  5CCG A;  1HJ0 A;  1KD1 Q;  1LJ2 A;  4DZO A;  3HTK B;  1Y47 A;  3RK3 E;  5CBN A;  3WMM 0;  4HH2 A;  2WIT A;  1FDO A;  2O01 J;  1KV4 A;  3PLN A;  4PV1 C;  2B88 A;  4N78 D;  1NTM J;  5AVW B;  1SQP E;  2FFD B;  1EDI A;  2YMK A;  3UIA A;  1CI6 B;  3P8M C;  3EZ9 A;  4N78 E;  2OYI B;  2FYU K;  3M9B A;  4I2L C;  5GTH E;  1SFC C;  4Z1M H;  1XTG B;  2YNY A;  4HJG H;  4EI2 A;  3CCL P;  1VL2 A;  4IFF A;  1H89 A;  2Z5H A;  1GMJ A;  3H1L D;  3L74 D;  2BCC J;  1JY3 N;  4L75 A;  1JEK A;  1NU1 D;  2FYZ A;  1L4A C;  2FXM A;  3CCE P;  1PFI A;  1RF1 C;  2KNC B;  2QJY B;  4H44 D;  3I55 P;  4XA4 A;  2H8P D;  1X8Y A;  2P10 A;  2M3E A;  2WPS A;  2FBW C;  2OTJ P;  4W80 A;  5M1B A;  1KIL C;  1MUU A;  2VZ4 A;  1S5L E;  5KAW A;  1HVV A;  2IYP A;  3CCS P;  4R4L A;  5E79 H;  1OW6 A;  1Q82 Q;  2IPP A;  1RH6 A;  1PGJ A;  1LGH B;  1HWT C;  1BDC A;  2O1J A;  3RK2 B;  4L76 A;  3EZ2 A;  3B4S A;  3FWL A;  1T2K D;  3VOP A;  2A06 D;  1RF1 A;  3AE5 C;  1BE3 J;  2HG5 D;  2FXP A;  4ZNC A;  2KCU A;  2QJP C;  1EXJ A;  1RY3 A;  4DJG A;  2KS1 B;  5AW7 B;  1OVV A;  3LW5 H;  2R44 A;  3CWB G;  1Q7Y Q;  1LTS C;  5H2F H;  1J1E B;  3BAS A;  1VQN P;  2K3R A;  4JQ0 D;  3B5N D;  1LP1 A;  1VDF A;  2FFD A;  1J1D B;  2KS1 A;  4OGQ D;  1Y6U A;  2KOG A;  1SQQ E;  5APW A;  2XV5 A;  1HH0 A;  3II6 A;  2K1A A;  2IBZ E;  1NTM D;  1ZRT E;  4RKU J;  1J1D C;  2JWA A;  4JYC A;  3L73 J;  1HBW A;  3TGU D;  3H32 A;  5KAV A;  3MHV A;  1AQT A;  1A02 J;  3GPV A;  3GHG A;  4I7Z C;  1L0N K;  1NTK G;  1Q90 D;  2YKP A;  2IYO A;  2W8Z A;  1QLE D;  2KYV A;  5AVR B;  3T97 B;  2IBZ G;  2I1K A;  2G8Y A;  2A06 G;  3H1K J;  4PD4 I;  2JR8 A;  5TIS E;  2LXC B;  5AVQ B;  3H1I J;  4JF7 A;  3KQG A;  1YIT P;  2IEF A;  3L70 E;  1KYO D;  3L71 G;  1S2E A;  2C0X A;  5KCB A;  2W83 C;  2IDB A;  1GDT A;  1PL5 A;  3HE4 A;  2QG4 A;  3Q3D A;  2H89 C;  3CWB E;  5I44 A;  1YJW P;  2E5Y A;  2OTK E;  2Q3I A;  1OW7 A;  1JUN A;  4GDO A;  3Q5S A;  3PRJ A;  1JB0 J;  1BSN A;  3P7K A;  1L4A B;  2NPS D;  5CCG C;  1GK4 A;  1GW4 A;  3W68 A;  1BOW A;  2V7Q J;  5KLV E;  1K04 A;  1X9V A;  5GTH H;  1EDL A;  1JY3 O;  3L75 G;  3B8E B;  1G1I A;  4D6T E;  3FX0 A;  5KLV G;  2MKV A;  3SFE C;  1ZXG A;  3CX5 D;  1OW8 A;  2WWW A;  3L35 A;  4BWN A;  2JJL A;  3B5N B;  1EQ7 A;  4WY4 D;  1ZR2 A;  3V2N A;  3GP4 A;  1PP9 D;  3Q1M A;  3VMY A;  3R4Y A;  2E74 B;  3EFG A;  3P32 A;  4PJ0 H;  3SWF A;  2Y0C A;  1AV1 A;  1KB9 H;  2IBZ D;  3H1H J;  2A45 H;  3VP9 A;  3PHL A;  3L71 E;  1S72 P;  1T2K C;  2XU6 A;  3AE9 C;  2FYU J;  5EFW B;  5AW8 B;  3L75 D;  1S9K E;  3H1L E;  1NH4 A;  4EYY Q;  1IFJ A;  2O3J A;  1NJI Q;  1J2J B;  2WT7 B;  3RK2 C;  5KJ7 C;  2NRG A;  2R32 A;  1M56 D;  4EOT A;  4IL6 H;  1RHZ B;  4CPG A;  5KLV D;  4LHF A;  4PJ0 E;  3AE8 C;  2P67 A;  1ZOY C;  2MJZ A;  5CCH D;  2BCC D;  3VP8 A;  5B66 E;  2I1J A;  3BAT A;  3JCU E;  2M3B A;  1U57 A;  1M1K Q;  5CHX A;  2XND H;  4WLS A;  2WSC H;  1MV8 A;  1KB9 E;  1OZH A;  3CX5 H;  2WSS H;  1SQX J;  3CC7 P;  2ZHG A;  3GK6 A;  2DW3 A;  2L91 A;  1L4A D;  3NFQ A;  3OW2 O;  1PP9 G;  2HOD A;  3V5B A;  1FBM A;  2G3A A;  3Q2Y A;  3M0D C;  3QH9 A;  3MGN A;  1GZL A;  2XDJ A;  3RBX A;  1LTA C;  1FZG A;  1VQ6 P;  5AW2 B;  1K9M Q;  3A7O A;  3CXH D;  2BCC G;  2V7Q H;  1FE6 A;  1KB9 I;  5CCH C;  1KIL A;  3EWK A;  1LTJ A;  4GIF A;  1BGY G;  1S4X A;  1PPJ G;  1OX3 A;  2J59 M;  3KDP B;  3KPE A;  1ZP0 C;  3MUD C;  2JEE A;  5CJ0 A;  5KLI B;  2AXC A;  1SQV G;  1IZN B;  2YKQ A;  2C9N Y;  4IFD K;  1QL2 A;  2OYI A;  1IK9 A;  1CI6 A;  1X0T A;  3M06 A;  4IOI H;  2E75 B;  2HVA A;  3HUS C;  1NTZ J;  1SQX E;  1NTZ G;  3R8J A;  5KAI H;  1IK7 A;  1JY2 O;  1Q05 A;  4HYT B;  3AEF C;  5AVV B;  1KIL D;  1M7L A;  3V4W A;  2KZI A;  4I7Z B;  4B86 A;  2KSE A;  3RK3 D;  2ITA A;  3E1I A;  1PM6 A;  1N7S A;  3CX5 I;  5AW9 B;  2A06 E;  2RH0 A;  1GD2 E;  1AVY A;  2WTY A;  1RQU A;  2A45 I;  3GF7 A;  3SWY A;  5KJ7 A;  3B71 A;  5KJ7 D;  2ZXX A;  3G3Z A;  3Q5P A;  4B0Y A;  3WUT A;  3B5N A;  2P1J A;  1T8Z A;  2Y0E A;  1PIX A;  2GOV A;  5BU8 B;  1PPJ E;  1BE3 G;  1N7S B;  3H1H D;  3L74 G;  3D6Y A;  1P84 E;  4PV1 B;  5AW0 B;  4U3F G;  3EZF A;  1URQ B;  4PV1 D;  1QVF O;  1GTW A;  3P8C D;  2GA1 A;  2Q7C A;  4IFM A;  3V2Q A;  1JCC A;  3IAO A;  3L73 D;  5K5G B;  1JNM A;  2SPZ A;  3TGU J;  3U1A A;  2D2C D;  2JKV A;  3C9I A;  3O6Q B;  4RES B;  2CPB A;  2R3S A;  1DD4 A;  2O1K A;  1VF5 B;  5KLV J;  1KQS O;  1PGP A;  3H1I G;  3HUS A;  2Q9I A;  3CWB J;  2YO2 A;  3HE4 B;  1LTG C;  2QJY C;  4U3F E;  1DX7 A;  5GQQ A;  4H13 D;  3M0A A;  1L0L E;  2ZT9 B;  3CXH E;  3RK3 B;  3EZ6 A;  1KIL B;  1BGY E;  3AEE C;  1OVR A;  1L0L K;  1J1E C;  2KUB A;  3PJS K;  2QE7 H;  1ZV8 A;  3H1H G;  1NAF A;  3V2P A;  1SQQ K;  3BRT B;  2KLV A;  1DEE G;  3L74 J;  2HPC B;  3Q5R A;  3L73 G;  4IL6 X;  4JPZ B;  3GHG B;  4LGD E;  2IFM A;  2OYH C;  1NTM E;  3H6P A;  1GL2 C;  1DIP A;  2B87 A;  2WVR A;  2WPQ A;  1R8D A;  1ZN5 A;  3NTN A;  1K8A Q;  2N1T D;  4OVN F;  1SP4 A;  1JM0 A;  1M57 D;  3S1K A;  1N2D C;  1R8E A;  4BRY A;  1YTZ T;  5APX A;  1FZE A;  5KAX A;  3HRN A;  1LT1 A;  1VQ7 P;  1VQ8 P;  5APU A;  2K37 A;  4C7R A;  3L71 J;  2XNX A;  3NXS A;  1L0L D;  3G71 P;  3LID A;  5APV A;  2UWJ E;  3CCV P;  3H25 A;  3KZI E;  1FZA A;  4R4M A;  1GK6 A;  1PP9 J;  4XFJ A;  3W67 A;  2OYH A;  3GMA A;  2N1T A;  3B5N C;  4WB4 A;  1EZV G;  2WT7 A;  1UII A;  4YPC A;  1VQM P;  1M8O B;  3RL0 D;  3V6I A;  1LTJ B;  1JY2 N;  1N86 A;  4BRY B;  1SQQ G;  2HR3 A;  5KKZ B;  3CC2 P;  4U7J A;  2HLO A;  3CD6 P;  2ZHH A;  1SFC B;  2O01 N;  1TU3 F;  4XE5 B;  3TSI A;  3G4S P;  1W2E A;  2M5A B;  5DJT B;  3BRV B;  3G6E P;  3G9R A;  4DCZ A;  2R5B A;  1KQG B;  5AW3 B;  3AE7 C;  4Y99 C;  2FYN C;  4IL6 E;  3AE6 C;  2HOD B;  2RN0 A;  5APT A;  4RO0 A;  3FWN A;  1Q0A A;  5AW1 B;  2VRS A;  3MTU E;  2ZT9 D;  4HKZ H;  1SQV E;  3VYI A;  4DCK A;  4OGQ C;  3BCC G;  3L72 D;  4H0L B;  1N8R Q;  2O01 H;  3BCC J;  2W6A A;  3JSV C;  3S9O A;  2B9B A;  1LWU A;  3IR9 A;  5D90 A;  4AQR D;  4D6T D;  1T3J A;  2PGD A;  2ZAE B;  3AED C;  4AYZ B;  3TGU G;  3H1L J;  1LTJ C;  1U7M A;  3CCM P;  2Q5U A;  1IFM A;  2E42 A;  4GOE A;  3HD7 B;  1URQ D;  2IZ0 A;  5E01 A;  1SQP D;  3OAK A;  2WMM A;  1NTM G;  4I1L A;  2YXR B;  1CZQ A;  1DD3 A;  4WWI A;  3D71 A;  5CCG D;  3VMA A;  1LTT C;  3RL0 B;  3L71 D;  3LIE A;  1L0L J;  2WQY C;  1YHQ P;  3GLM A;  3FXD A;  3P8C E;  2M8R A;  2LXB A;  3AEB C;  5KAF E;  2D2C C;  3KZI H;  1CW5 A;  1GL2 B;  1P84 D;  5CJ4 A;  1P84 H;  1USE A;  1GW3 A;  5KLI C;  2Y9Y A;  1GL2 A;  1Q2N A;  1SLQ A;  3CME P;  3WU2 H;  1LTI C;  3IN6 A;  2OAR A;  4N6J A;  1OXZ A;  1G1J A;  2Z4E A;  4YXD C;  2Q1K A;  1FOS F;  1BCC G;  1SQX D;  1EC5 A;  1KZU B;  1RE3 C;  1SQP G;  2FXO A;  5TJH A;  2N9B A;  3ITK A;  3M9Q A;  3LW5 J;  1M1J A;  1QVG O;  2Q3E A;  2IX7 C;  1L4A A;  2PAJ A;  2KIK A;  3CWB D;  1N73 A;  4MN4 C;  4ASV A;  1SQP K;  3R2P A;  3M9H A;  4JYB A;  5GTI E;  5KKZ C;  3N7N A;  1NTZ K;  5AW5 B;  4C46 A;  2JDI H;  4ASW A;  4ZMD A;  1Q08 A;  1K05 A;  1NTK D;  3UCS A;  5AVS B;  3GF3 A;  1BCC D;  1SS1 A;  1YTZ I;  1RE4 C;  4W7Y A;  2CPS A;  1S9K D;  1ZR4 A;  1AJY A;  2RKL A;  1MKM A;  3MP7 B;  5AVT B;  2WSE H;  1T3U A;  3HD7 D;  2JP3 A;  4OGQ B;  3M91 A;  4L73 A;  1KOR A;  2KSJ A;  2E76 C;  1NTZ D;  2AEM A;  3CCJ P;  1HJB A;  3CCU P;  1FDM A;  1R5S A;  3E0H A;  3E1R A;  4YXW H;  1SQX G;  2HFE D;  4N3Y B;  2NPS A;  2Z5I A;  1A02 F;  3PTZ A;  3H32 B;  5GTI H;  3WUU A;  3A0H E;  2ZFC A;  2Y9Z A;  3A5T A;  2C9L Y;  3A2A A;  1YI2 P;  2LKM A;  1JOC A;  4U3F D;  5KLV K;  2OYH B;  1RE4 A;  1NYH A;  3VN0 A;  4A7P A;  1LP1 B;  2QVA A;  1YJN P;  4NPD A;  1LX8 A;  1NU1 K;  1URQ C;  4UB6 E;  4KHX A;  2ZYA A;  3CMA P;  1OFC X;  1SQB G;  4H44 B;  3TDK A;  2QIW A;  2XZR A;  1SQQ J;  1FZC B;  2ZT9 C;  1YIJ P;  1M1J B;  3A0B H;  4EIJ A;  5DJU B;  1RF1 B;  4OWF A;  2P2U A;  1SQV K;  2YIU B;  2WSF J;  2B89 A;  4NPF X;  2BEQ D;  2POH A;  1M1J C;  2K9J B;  1SQV D;  5KTB A;  1NU1 G;  1E79 H;  5AW6 B;  1D7M A;  1RF0 C;  3H1K E;  5BVZ A;  4OH8 B;  2LR2 A;  1LWU C;  1LT9 C;  1FAV A;  2QSI A;  1NU1 E;  2ZVO B;  2YO3 A;  1G2C B;  1NTK J;  3N4X A;  3PH0 A;  1NHL A;  3TK1 A;  2QRX A;  1X22 A;  4KJM A;  1L0N D;  1JMB A;  5AVZ B;  2FKW B;  3CI9 A;  2FFD C;  1U7J A;  4UB6 H;  1BGY J;  2AEF A;  4YTP C;  1N7S C;  4WVZ A;  4TT3 H;  3I56 P;  3CCR P;  4K35 A;  1IFN A;  3HUS B;  1NO4 A;  1SQB E;  1BE3 E;  1JO5 A;  1H0T B;  3BCC E;  2W27 A;  1L0L G;  1H0T A;  3O6Q A;  2E5T A;  4KT0 J;  5KAT A;  1ZW0 A;  1JCD A;  2FYN B;  3AE4 C;  1KMI Z;  1BE3 D;  1HGV A;  1L0N E;  1BDD A;  1FOS E;  2GUV A;  1VQ5 P;  5L8R J;  4UB8 E;  1WT6 A;  3TNU B;  3HTK A;  1IO4 A;  1BSH A;  1JY2 P;  4PD4 H;  1BCC J;  1IC2 A;  2JWD A;  4NPE A;  2H43 A;  3T97 A;  1NKZ B;  3WUV A;  4D6T J;  1VF5 D;  4I6M C;  1GL2 D;  4C7N B;  3HH0 A;  1D5Y A;  1Q06 A;  1EDK A;  5APS A;  3KYQ A;  5APY A;  3V4Q A;  2M5A A;  1Z56 A;  2KXP B;  1YQ3 C;  1SFC A;  2K9J A;  3D70 A;  1NGM B;  1SFC D;  1KC8 Q;  4GT1 A;  1KB9 D;  4R4E A;  4H44 C;  1K73 Q;  2OQQ A;  3BVH A;  1KFN A;  3H1J J;  2OG0 A;  4PD4 E;  1T6A A;  1AQ5 A;  4L74 A;  1H88 A;  1FZC A;  2NZ2 A;  3R8K A;  2BCC E;  3CPW O;  4WY4 B;  1X79 B;  3H1I E;  3EQ2 A;  3QWO C;  5I41 B;  5C39 A;  4H0L D;  1LWU B;  3L72 J;  1SQB K;  1OMI A;  1KFM A;  4RJT A;  4Y28 J;  2E74 C;  2WZ7 A;  4Y99 B;  2QM8 A;  1Q86 Q;  1S3J A;  5E79 E;  2E76 B;  3EZ7 A;  1PV3 A;  2E75 C;  4BXL A;  2NPS B;  3MZW B;  3HD7 C;  4WLW A;  3D6Z A;  1JTH B;  3L4F A; 
#chains in the Genus database with same CATH homology
 3ABV C;  3AEC C;  4H44 D;  1MKM A;  2ZHG A;  3GK6 A;  3GPV A;  4DCZ A;  3G9R A;  1RQU A;  2JP3 A;  4OGQ B;  3GF7 A;  2KVV A;  3Q5R A;  1KQG B;  2E75 D;  4IL6 X;  2P10 A;  2QSI A;  1KOR A;  1VF5 D;  3GP4 A;  4I7Z C;  2FBW C;  3AE7 C;  3Q1M A;  5M1B A;  2E76 C;  3HH0 A;  1S5L X;  2VZ4 A;  1Q90 D;  2FYN C;  3AE6 C;  3B71 A;  3AE1 C;  1Q06 A;  3R4Y A;  2E74 B;  2G3A A;  3Q2Y A;  5KLI C;  5KAW A;  1S1C X;  2BOW A;  3AEG C;  3E0H A;  3Q5P A;  4B0Y A;  3T97 B;  1Q0A A;  2D2C B;  2G8Y A;  4R4L A;  1DIP A;  1Q09 A;  2J5U A;  1YQ3 C;  1R8D A;  2K9Y A;  1KIL E;  1OW6 A;  3AE3 C;  1ZME C;  1PIX A;  1Q07 A;  1FDI A;  2GOV A;  3IN6 A;  1HJ0 A;  2ZT9 D;  3AE9 C;  1RH6 A;  3D6Y A;  4R22 B;  3D70 A;  3QAO A;  2IEF A;  1NGM B;  1R8E A;  3EWK A;  4PV1 B;  4YXD C;  4OGQ C;  4R4E A;  3EZ2 A;  4H44 C;  4A1M A;  4YTP C;  2OQQ A;  4H0L B;  3RK3 E;  3EZF A;  2OG0 A;  4TT3 H;  4PV1 D;  3S9O A;  5KAX A;  3AE5 C;  4R24 B;  5KCB A;  2IDB A;  1PL5 A;  2FXP A;  3Q3D A;  2H89 C;  1FDO A;  5D90 A;  2O01 J;  1ZP0 C;  5I44 A;  3LW5 J;  5D8C A;  3IAO A;  2KCU A;  3LUR A;  4H13 B;  2QJP C;  1EXJ A;  4H13 C;  4PV1 C;  2BEZ F;  1NYH A;  2NZ2 A;  3AED C;  4AYZ B;  2E74 D;  1OW7 A;  2D2C D;  3R8K A;  1Y9B A;  2YMK A;  4GDO A;  1LX8 A;  3B49 A;  2WSE J;  1DD4 A;  3AE2 C;  3Q5S A;  1RQV A;  3EZ9 A;  3FGA D;  4LHF A;  3SFD C;  3H25 A;  3AE8 C;  4H0L C;  4H44 B;  3O6Q A;  2JML A;  1JB0 J;  4R4M A;  1VF5 B;  1HF9 A;  2QIW A;  2E75 B;  2HVA A;  4AYZ A;  4OGQ D;  4KT0 J;  2WPV B;  1ZOY C;  4XFJ A;  1Y6U A;  5I41 B;  3GMA A;  2YIU C;  2ZT9 C;  5KAT A;  5E01 A;  3R8J A;  3AE4 C;  4Z1M H;  5KKZ C;  1IK7 A;  1KMI Z;  4H0L D;  3RL0 g;  1BOW A;  1JBG A;  1KTM A;  1Q05 A;  2E76 D;  1K04 A;  1DD3 A;  2V7Q J;  3AEF C;  2QJY C;  1Q08 A;  2DG6 A;  1K05 A;  5GQQ A;  3D71 A;  1EXI A;  4H13 D;  1OMI A;  2QJK C;  2WSC J;  1UIX A;  1VL2 A;  4Y28 J;  1U57 A;  3C8V A;  1WMK A;  5L8R J;  2ZT9 B;  3UCS A;  2E74 C;  2WSF J;  4WLS A;  1YQ4 C;  3EZ6 A;  3GF3 A;  1GMJ A;  1ZRT E;  3AEA C;  4I7Z B;  2JO1 A;  4RKU J;  2E76 B;  2WQY C;  3AEE C;  5KAU A;  1JYH A;  3EZ7 A;  2MKV A;  2BEQ D;  3SFE C;  1KQF B;  4J2N A;  3GLM A;  1PM6 A;  1OW8 A;  4U7J A;  1VF5 C;  1PV3 A;  2E75 C;  2ZHH A;  3AEB C;  5KAV A;  1D5Y A;  2D2C C;  4WLW A;  1TU3 F;  2H88 C;  3D6Z A;  1AJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...