3Q1MA

Crystal structure of bmrr dimer bound to dna and the ligand 4-amino-quinaldine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q1mA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q1mA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q1mA03
3E0HA 2JMLA 3UCSA 1Q05A 2DG6A 3IAOA 5D8CA 3B49A 3D70A 4R4MA 5KAXA 3G9RA 5D90A 3Q5PA 3GP4A 3D6YA 1Q08A 3Q1MA 3R8KA 1R8DA 4AYZA 2GOVA 1EXIA 1EXJA 2HVAA 3GK6A 3LURA 4AYZB 2VZ4A 4A1MA 1Q09A 1JYHA 5KATA 3D71A 1JBGA 3R8JA 1Q07A 4R4LA 5E01A 3Q2YA 1Q0AA 4R24B 3Q3DA 3T97B 2BOWA 1R8EA 5KAVA 5KAWA 3GPVA 4R22B 3QAOA 1Q06A 4J2NA 4R4EA 5KAUA 4WLWA 3D6ZA 1DIPA 5KCBA 1D5YA 4B0YA 5I44A 3Q5SA 2OQQA 3HH0A 4WLSA 5I41B 2KCUA 5GQQA 2J5UA 1BOWA 2ZHGA 3Q5RA 2ZHHA
chains in the Genus database with same CATH superfamily
3W67A 3A0BE 3CL3D 1P84H 1SFCD 2OYHC 4UB6E 3CD6P 2O1KA 2J58A 1BGYJ 1SQVG 2BCCE 3AE5C 4DOJA 1OWAA 3VMZA 4N6JA 3TYYA 1HJBA 1UIXA 2GM4A 1PGPA 5APVA 2ITAA 1SQVJ 3M0DA 4KHXA 2KLVA 3C8VA 1FOSE 5AW6B 1SQXG 1KYOH 2ZYGA 1GL2C 3GHGC 5APSA 4PD4H 1M1JC 1BE3E 2MJZA 5BVZA 2WSEJ 3AEGC 2FXPA 3CCMP 3CCQP 1BCCG 1YJNP 2ZT9D 1AA0A 3VP8A 3U1AA 3P8CD 3H1HD 1IFPA 3V6IA 3LIEA 2I1JA 3L70D 2D2CB 2IYOA 1NTZJ 5CCHA 2V7QH 4KT0J 2H8PD 4D6TJ 3CLQA 5K5GB 3H6PA 3PH0A 1KD1Q 2ZVOB 5AVRB 1Y8AA 1SQXE 2XV5A 3SFEC 2WPQA 1JUNA 4GODA 3A0HH 3A5TA 2A06D 3AEBC 2BEQD 1ZLLA 3HD7A 3GP4A 3CX5H 3HE4A 1BCCE 4ASVA 5EFWB 1AV1A 4PJ0E 5AVZB 4JPZB 2BASA 1MV8A 2G3AA 1H89A 1AFOA 3BRTB 1QEXA 1RF1C 2OYHB 3MGNA 4OGQD 1SQBK 4H0LC 4NPEA 2WZ7A 4WVZA 1EXIA 1RF0A 2RMZA 2C9LY 1L0ND 2WT7B 4R22B 2E42A 3EZ7A 1NKZB 4JBZA 1EDJA 2ZXEB 4DT0A 3MP7B 2O01N 3BRVB 1CI6A 4WB4A 1M90Q 1S4XA 4EIJA 5GTHH 3H1JJ 2VZ4A 2JO1A 4PD4D 1GL2B 3HTKA 1ZMEC 3GHGB 2FFDC 1M1JB 1Q06A 1L4AA 3TNUB 3L71J 2MKVA 2N1TA 3E7KA 3SFDC 2W6BA 4WY4C 2OTKE 1SQPJ 1K8AQ 1NU1J 3BVHA 3V5BA 4XFJA 2NZ2A 4R4LA 3TGUD 1S2EA 5KLVG 3H1ID 2WPRA 1FZCC 4HKZH 3B71A 1EZVD 1QVGO 2LXBA 3H1HG 3L70G 2NPSC 3M91A 5KLVJ 4HYTB 1JY3P 5TJHA 4AYZA 2LXCB 1MFTA 1Y47A 4H13B 4I6MC 3Q2YA 1PP9J 3CC4P 3TDKA 5B66H 3H1LD 3CCSP 3SSUA 2A06G 1LTJB 1SS1A 1JTHB 3AEFC 3NXSA 2O3JA 1SLQA 5KAWA 2IDBA 5L8RJ 4IL6X 1RF1B 5KAIH 1Q2NA 3P8CE 3H1HE 4H0LB 3U59A 3L70E 1XTCC 2KUBA 2XNDH 1OXZA 3LIDA 1OX3A 3O6QA 1SFCC 1L0NG 1NTKD 1NH4A 4B86A 1YTZI 1W5CE 1VF5C 2A06E 3RGUA 4LC1A 2C9NY 4R4MA 2FFDB 2GOVA 4EOTA 2JWDA 3L75D 1GW4A 2K37A 4WY4B 1SQQJ 2NPSA 1QL1A 1LTBC 2KK7A 2FYUD 4C7RA 2BEZF 3FXEA 2ZHGA 1PV3A 3CWBD 3Q1MA 1OFCX 1DEEG 1FZCB 2FYUK 3H32A 2OARA 1SVFA 3AE4C 4RO0A 2ZAEB 3TGUG 1L0NE 1VQKP 1X8YA 2ZT9C 3H1IG 1NHLA 1M57D 1EZVG 1M56D 1N86A 4N78E 3L72D 4BXLA 5B5EE 5APUA 3NTNA 4C46A 4I1LA 4PD4E 2WSEH 5KKZC 3JCUH 4EYYQ 2KS1A 1PZQA 1NKNA 4HH2A 3H1LG 4MN4C 1JYHA 3FWLA 1QGKB 4DZOA 4PV1D 3H1LJ 1KB9H 3TGUE 3VP9A 2O01H 3H1IE 1GD2E 2E74D 1EZVE 1TU3F 4N3YB 4TT3H 3TSIA 3S9OA 2KIKA 1FE6A 1KZUB 1AQ5A 2W90A 1NTMD 1SFCB 3MUDA 2OYIC 2Q9IA 4OGQC 1LJ2A 4ASWA 1H0TA 3T97A 3A0HE 2AEFA 1NGMB 2HPCA 2YIUC 1VF5B 1KFNA 1ZW0A 3R4YA 1ZXGA 4U3FD 1NTKG 4JQ0D 3H1LE 1L0LG 2M3EA 4A7PA 3B4SA 1Q0AA 3V2PA 3EFGA 1K04A 3L75G 2PAJA 1LTGC 1L0LJ 3I56P 2K88A 3IF4A 1RQUA 2OQQA 2YO2A 3AE2C 1SP4A 1Q86Q 2R44A 1OIPA 3A7OA 3KZIH 3CWBG 2ZT9B 2KZJA 2VRSA 4WY4D 5APWA 1FZFA 3CXHH 1OZHA 2K9JB 1NTKE 4B0YA 5KJ7A 3RK2D 1FZAA 2JJLA 2Y9YA 3L37A 3L72G 2Q6QA 4A1MA 5KKZB 1DH3A 3L75E 1OVVA 1NWQA 4TLFA 3M0DC 2NPSD 2H43A 5APXA 4C7NB 1Y9BA 2FYUE 3CCLP 3AECC 4O9BA 1X22A 1KB9D 5C39A 3L74J 3CWBE 2E75D 1NAYA 1NTZK 1E5WA 1MKMA 2BCCG 2XKMA 4IOIH 3EZFA 3LW5J 5CHXA 4GDOA 2OYIB 3A2AA 2V4HA 4OGQB 1M7LA 3L72E 1LTIC 5CCHC 2BCCJ 1G2CA 1NTMG 5B66E 1FDIA 2LR2A 2Y9ZA 1AVYA 3IFMA 4WBAA 1GK6A 4U3FG 3SWFA 1HWTC 2DG6A 1A02J 2KZIA 1NYHA 2IPPA 3TK1A 3CC7P 1LP1A 2Y0DA 3HD7C 3V2NA 1BE3J 1T6AA 1VF5D 4WLWA 2QG4A 4L76A 5AW0B 1KMIZ 1JCDA 3CXHD 3HUSA 1OMIA 2R3CA 1NTME 2DW3A 1Q07A 1ZN5A 1LX8A 1M8OB 1RF0C 4ZKPA 1QX8A 4U3FE 2PP6A 5TISH 2WPVB 4IFDK 5AW5B 3MIWA 2AEMA 3R8KA 1SQXJ 1EXJA 3VMXA 3L4FA 5E01A 3WMM0 1HBWA 2AXCA 2QA4P 2KB7P 2JKVA 1SQPK 1ZR2A 1NU1K 5KTBA 1VQ4P 1L4AC 1BCCJ 2JMLA 1JM0A 2N1TC 3D6YA 1G1IA 1LTAC 5CMZA 5AVVB 3R8JA 1U57A 1IFMA 2O1JA 2YXQB 2YNYA 2OG0A 4PV1C 1JY2O 1DD4A 3SWYA 5KJ7D 3Q5RA 3VOPA 2E74C 3B5NA 1EC5A 2QJKC 1LT9A 2XU6A 3MTUE 1Q82Q 4LHFA 3IR9A 1SQBD 1W2EA 3BATA 4UB8H 1P84D 1S72P 2K1AA 3E1IA 2QIWA 2W83C 5AVWB 1KQFB 3UCSA 1FDMA 2WSCJ 2A45G 1KB9E 2IZ1A 5AW7B 1Q90D 3HE4B 4CPGA 4H44C 2KOGA 3N4XA 1QL2A 1OVRA 1YTZT 2WT7A 1T8ZA 2XZRA 3FWNA 1R8EA 1FBMA 1T3UA 1KTMA 1AJYA 4N78D 2J5UA 1PL5A 1URQA 1E79H 3VN0A 3HE5A 2KVVA 1KYOD 3H1KD 2B9BA 1GZLA 3D71A 2JR8A 3Q3DA 2CPSA 3ZDMA 3AEAC 2FBWC 1N73A 1JY2N 4LLHA 2K9YA 3NMDA 3CCVP 1CSBA 1RH6A 1PGJA 1GTWA 5DJUB 1S5LH 1KV4A 2YO3A 1CI6B 1SQQK 3RK2C 2QSIA 3FGAD 1EZVI 1YIJP 1H88A 1K9MQ 1G1JA 1LTSC 2QE7H 3HTKB 1WT6A 1NAFA 2Q3IA 1L4AB 3WUVA 3MD0A 3L73D 3BCCE 1S5LX 4IFMA 3VYIA 1NOHA 3PRJA 2WSSH 3CXHE 1VQLP 2Q5UA 4PV1B 2M5AA 3H1HJ 3L70J 2R32A 4JYBA 2E74B 2E75C 4IL6H 2QJKB 3CX5D 1VQ6P 5I41B 1YBKA 1Q7YQ 1LTJA 3KDPB 4K3AA 1X0TA 4YXDC 4Y99C 4LGDE 4AYCA 2E43A 1X79B 1VQNP 2WPSA 1SQBG 2JWAA 3EQ2A 3EFFK 1JMMA 3C9IA 3AE9C 4L73A 1Q81Q 2N9BA 2OGUA 5CCHD 1NO4A 2C0XA 1IFDA 5KLIC 1EQ7A 4JYCA 1DX7A 2L5GB 3GK6A 2ZXXA 2WSFH 5GTIH 1M1KQ 5DJTB 1LNQA 1R5SA 2RH0A 2M3BA 4YXWH 3B5ND 3SWKA 3HD7D 5AVQB 5BU5A 1L0NJ 3O6QB 1LT1A 3MUDC 1SQBE 2IFMA 1RH5B 3RK2B 2P67A 1P84E 3OW2O 1ZP0C 1X9VA 4EDFA 1OW7A 1VDFA 2Y0CA 4L74A 3CCRP 2CPBA 4HB1A 3V2RA 2NPSB 1LGHB 1DD3A 4DCKA 2XNXA 3WU2H 5CCGA 3L73G 3EZ2A 1URQD 1PPJE 3PJSK 2GUVA 1VQ8P 3TGUJ 2V7QJ 3H32B 4Z1MH 2E75B 3H1IJ 1KYOE 3H1KE 2UWJE 2KNCA 1L4AD 2YKPA 4BRYA 2N1TD 3MZWB 1RE4A 1EDKA 1H8AA 2WQYC 5KJ7C 4Y28J 2KSJA 2YMKA 5KAFH 4RJTA 1N7SA 1FJPA 2KSEA 4PJ0H 2KS1B 5KLIB 3L73E 5AVXB 3P7KA 4YPCA 3EWKA 4L75A 3FX0A 1BSHA 3GW6A 3PLNA 2SPZA 4IFFA 3PHLA 2B87B 3ITKA 1IO4A 1KQGB 1ZRTD 3H25A 3CX5E 4AQRD 1VPCA 4H44D 4GIFA 1XTGB 3C1LA 2IEFA 3G3ZA 2RN0A 1Q09A 4UB8E 1H0TB 1RE3A 1NTKJ 3S1KA 2HPCB 1YJ9P 2HYNA 4WWIA 1QVFO 1L2PA 1BGYD 2WSCH 2LKMA 2FYUG 1VQ9P 2KP8A 1YQ3C 1IK9A 1GU4A 3L75J 1A02F 1FOSF 1KILA 2FYUJ 4ZKUA 3AE8C 1RQVA 2QM7A 1SQVK 5M1BA 1JNMA 5AW4B 5GTHE 3CWBJ 1HUCA 3G6EP 3G4SP 2L91A 3EZ6A 4OH8B 1YI2P 4W7ZA 1JO5A 1LWUA 3GPVA 1HH0A 1MZ9A 3HUSC 5E79H 3L72J 3W68A 3JC22 3TF5A 1NTZD 1R5LA 1VQPP 4K35A 4D6TD 3PP5A 2HODA 3CC2P 5AVSB 2NRGA 4NPDA 1YHQP 5AVTB 3HH0A 5CCGD 1FJKA 2YIUB 1JCCA 2Z5IA 2M8RA 1GW3A 4IL6E 3M0AA 2A45I 2Q1KA 3P8MC 2XDJA 2RKLA 1ZOYC 3OA7A 1NTMJ 3U1CA 1R8DA 3R2PA 5KAIE 1N7SD 3B5NC 1PM6A 1LT9C 4U3FJ 1ZV8A 1J1EC 2HG5D 3P32A 3BCCD 1BGYG 1WRGA 1IC2A 1JY3O 2IBZD 3Q5PA 5GTIE 2E76C 2KI7B 3CCEP 1FZGA 2ZFCA 2R5DA 1LP1B 5AW9B 2WTYA 3H1JD 1GU5A 5H2FH 2PFXA 4QMAA 3QAOA 5KAUA 4M3LA 2P10A 3L71D 1ZRTE 3KQGA 3CMEP 2P7JA 1SQPD 3F5HA 3HUSB 1NU1D 1URQC 2WITA 5B5EH 5BU8B 2GUSA 2Z4EA 5AVYB 3RL0C 5AW2B 1FDOA 4R4EA 3RK3D 2FYNC 1BGYE 1T2KD 1N73C 2JDIH 2ZYAA 3M06A 5D90A 1Y6UA 1FZBA 1NTZG 2C0WA 1GMJA 5KLVD 1Z56A 3WU2E 4NPFX 1FC2C 1SQVE 1KILD 2P1JA 4D6TG 1KQLA 2W6JH 2FXOA 4W80A 1PP9D 2W8ZA 3GMAA 1JY3N 1OW6A 5KLVK 1JEKA 1PGQA 1S3JA 2O01J 2WVRA 5KAXA 3GG2A 2P2UA 3QH9A 5APYA 2H89C 1P84I 3JCUE 1U7MA 1MFZA 1UIIA 4H13C 1IZNB 3CPWO 3M9HA 3CCJP 2OYHA 3RBZA 3E0HA 5KAFE 1RHZB 1YQ4C 2HR3A 3B5NB 3L35A 3HD7B 1N7LA 1LT9B 1NTZE 3II6A 2QJPC 1LTJC 1J1EB 2G8YA 4D6TE 5KAVA 2QEXP 1DEBA 1PFIA 3WUUA 2IX7C 2E76B 2YXRB 3BCCG 1KYOI 3I5CA 3EZ9A 2BOWA 1PPJD 3S4RA 2QRXA 4PD4I 2AXTH 3V4QA 2IBZG 1JBGA 1GL2A 3IN6A 3GHGA 3AEDC 3NFQA 1M1JA 3BCCJ 4GT1A 4GOFA 3H1JG 1QLED 3TNUA 4JF7A 4AUWA 1SQQD 3AE7C 1GDTA 1L0NK 1URQB 3L71G 1KQSO 1YITP 1D7MA 3RL0B 3HE5B 1SQPG 2FYNB 4I2LC 1GK4A 3RL0g 1NU1G 3E1RA 2Q7CA 2E5TA 4RESB 1N73B 2PGDA 2N1TB 2P58A 2JEEA 2M0BA 3CMAP 3KZIE 3VTPC 1PIXA 2H7HA 2IBZE 1MUUA 2FXMA 3CX5I 4R24B 1S9KD 3H1JE 2YMYA 1EDLA 1FU1A 1LTTC 2YKQA 3Q5SA 1PP9G 4ZMDA 3L71E 3QWOC 4GOEA 2JP3A 3D70A 1NVOA 2OTLP 1JTHA 5CCGC 4AYZB 3ABVC 1SQPE 5E79E 2M5AB 1NU1E 5APQA 5AW8B 1AQTA 1RF1A 1JB0J 5KCBA 2D2CD 3RK3E 3B8EB 4ZNCA 3M9BA 2QJPB 4W7YA 4H44B 1CZQA 1RY3A 1HVVA 2OTJP 1RE4C 1SQBJ 3A0BH 2QVAA 5KLVE 3LW5H 1VQMP 1CW5A 4KJMA 1KILE 1PGOA 2IFNA 4UB6H 1N7SC 1PP9E 2KCUA 1OW8A 1EDIA 2I8DA 3KPEA 4GKGA 2FFDA 1PPJG 3BASA 5AVUB 2FY8A 5CJ4A 4WY4A 1WMKA 3O8ZA 3H1KG 1JOCA 1L0LD 1U7JA 1SQQG 5AW3B 5GQQA 1W2BO 1JY2P 2E76D 3I55P 3CCUP 2E5YA 1NTKK 3H1KJ 1FS0E 1FZCA 2Y0EA 1L0LK 1HTLC 2Z5HA 2N9YB 3JSVC 1RE3C 2WMMA 5APTA 4I7ZC 3RK3C 2HFED 3V4WA 5H2FE 3WUTA 1T2KC 4HJGH 2HVAA 2KXPB 3RL0D 1GL2D 1USDA 1IK7A 3L73J 1HJ0A 5TISE 2KYVA 1KILC 3CI9A 1SQQE 1T3JA 2QJYC 3AE6C 4Y99B 4OWFA 1VQ5P 1IFNA 2ZYDA 3RBXA 1KFMA 4XA4A 5CJ0A 3L74D 2ZJSE 2R5BA 2KNCB 3PTZA 5CBNA 1DIPA 4BRYB 1LWUC 3GF7A 1AVOA 3K5BA 1OVUA 3IAOA 5AW1B 1VL2A 1SFCA 2K3RA 1IFJA 3F89A 3L36A 1N7SB 2BCCD 4H13D 2IYPA 2AEJA 2B87A 2IZ0A 4J2NA 1S9KE 3UIAA 1BSNA 3FXDA 4YTPC 3OJAB 4OVNF 3T97B 2J59M 3AE1C 2OYOA 4DCZA 1NTMK 1J1DC 1BE3D 1D5YA 1N2DC 4H0LD 2Q3EA 4EI2A 1HGZA 1BDDA 3B49A 3GLMA 3G9RA 2CK3H 1S1CX 1KORA 2ZVNB 1SQVD 2A45H 1JMBA 1FZEA 1K73Q 4I7ZB 2FKWB 3RK3B 2HLOA 2K9JA 3AEEC 3D6ZA 2AXTE 3OAKA 1HF9A 1BOWA 3USSA 4XE5B 1NJIQ 3G71P 1Q08A 5KATA 1SQXD 3A3YB 1KILB 3VMYA 2QJYB 2KLUA 5CBOA 4C7NA 1S5LE 1KB9I 1VQ7P 4WLSA 1L0LE 1YJWP 3V2QA 4RKUJ 1SQXK 2H88C 1J2JB 1VQOP 2FYZA 2QM8A 1BCCD 3KHUA 2PRRA 1YYCA 1LWUB 3L74G 4DJGA 1KN7A 3M9QA 2POHA 4BWNA 1USEA 3KXDA 2W27A 2WWWA 3MHVA 1FAVA 2OYIA 3VMAA 2GA1A 1Q05A 5D8CA 2B88A 2D2CC 2R3SA 1KC8Q 1ZR4A 2B89A 2I1KA 3HRNA 2HODB 1K05A 4U7JA 1IJDB 2WSFJ 3GF3A 3LURA 1IFIA 1J1DB 1G2CB 3L74E 3N7NA 1BDCA 3AE3C 1HGVA 3KYQA 2IBZI 5I44A 2W6AA 1BE3G 3CXHI 1N8RQ 2YKOA 2ZHHA
chains in the Genus database with same CATH topology
2JMLA 4H44B 1PV3A 3EWKA 3GP4A 3D6YA 1Q08A 3Q1MA 4AYZA 2QSIA 1K04A 3FGAD 5KATA 1JBGA 4H13B 3R8JA 1U57A 1FDIA 3AE4C 3IN6A 3Q2YA 3AEDC 1KILE 3AE5C 2G3AA 2ZT9C 1FDOA 4R4EA 3AE7C 2FYNC 2OG0A 1DIPA 4PV1C 1KQGB 1RQUA 2OQQA 3GF7A 3HH0A 4WLSA 1DD4A 1OW8A 1S5LX 3H25A 2KCUA 3AE2C 4RKUJ 2H88C 1UIXA 3Q5RA 4OGQD 2DG6A 3IAOA 1ZP0C 2E74C 4H44D 4H0LC 5D90A 1Y6UA 1NYHA 1OW7A 2QJKC 1VL2A 2IEFA 1EXIA 1GMJA 3AEFC 2ZT9B 1Q09A 3C8VA 3RL0g 4PV1B 4LHFA 4H13D 1WMKA 5KAWA 2BOWA 2IDBA 5L8RJ 4R22B 4IL6X 4J2NA 1DD3A 1VF5D 3EZ7A 5KKZC 2E74B 4WLWA 2E75C 3GMAA 4H0LB 4B0YA 1OW6A 5I41B 4AYZB 5GQQA 2QIWA 1ZOYC 2E76D 2ZHHA 1KMIZ 3EZ2A 1KQFB 3UCSA 1YQ3C 1Q05A 5D8CA 1PIXA 2O01J 2WSEJ 5KAXA 2D2CC 2WSCJ 3AEGC 2FXPA 4YXDC 1R8DA 4YTPC 1Q90D 2VZ4A 1OMIA 2JO1A 4A1MA 4H44C 3O6QA 1JYHA 2V7QJ 2ZT9D 4Z1MH 2E75B 2H89C 1Q07A 4PV1D 4R24B 4OGQB 1LX8A 3T97B 1ZMEC 1PM6A 1R8EA 1KTMA 3AE1C 1K05A 1Q06A 4DCZA 4U7JA 4H13C 2MKVA 3AE8C 1AJYA 1RQVA 2E74D 3SFDC 2D2CB 1TU3F 2WSFJ 1Y9BA 4H0LD 1D5YA 3Q5SA 4TT3H 3GF3A 5M1BA 1VF5C 3AE9C 2J5UA 4I7ZC 1PL5A 3S9OA 4KT0J 3E0HA 2WPVB 2JP3A 1YQ4C 3AECC 3B49A 3D70A 4R4MA 3GLMA 3G9RA 2WQYC 3Q5PA 5KLIC 3R8KA 3EZ6A 2E76C 2GOVA 2HVAA 1EXJA 1S1CX 4Y28J 2QJPC 2KVVA 1KORA 2YMKA 3GK6A 3LURA 3ABVC 4OGQC 4XFJA 3D71A 2E75D 2G8YA 2NZ2A 4R4LA 5E01A 5KAVA 3Q3DA 1NGMB 3AEAC 2YIUC 2FBWC 3SFEC 1VF5B 3GPVA 3AE3C 3QAOA 1IK7A 4I7ZB 1MKMA 3B71A 3R4YA 1HJ0A 5KAUA 1JB0J 3EZFA 2K9YA 3AEEC 3D6ZA 5KCBA 2BEZF 5I44A 2D2CD 3RK3E 2P10A 3LW5J 2E76B 2QJYC 3AE6C 1HF9A 4GDOA 1BOWA 3AEBC 1RH6A 2BEQD 1ZRTE 2ZHGA 3EZ9A 1Q0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0H A;  2JML A;  3UCS A;  1Q05 A;  2DG6 A;  3IAO A;  5D8C A;  3B49 A;  3D70 A;  4R4M A;  5KAX A;  3G9R A;  5D90 A;  3Q5P A;  3GP4 A;  3D6Y A;  1Q08 A;  3Q1M A;  3R8K A;  1R8D A;  4AYZ A;  2GOV A;  1EXI A;  1EXJ A;  2HVA A;  3GK6 A;  3LUR A;  4AYZ B;  2VZ4 A;  4A1M A;  1Q09 A;  1JYH A;  5KAT A;  3D71 A;  1JBG A;  3R8J A;  1Q07 A;  4R4L A;  5E01 A;  3Q2Y A;  1Q0A A;  4R24 B;  3Q3D A;  3T97 B;  2BOW A;  1R8E A;  5KAV A;  5KAW A;  3GPV A;  4R22 B;  3QAO A;  1Q06 A;  4J2N A;  4R4E A;  5KAU A;  4WLW A;  3D6Z A;  1DIP A;  5KCB A;  1D5Y A;  4B0Y A;  5I44 A;  3Q5S A;  2OQQ A;  3HH0 A;  4WLS A;  5I41 B;  2KCU A;  5GQQ A;  2J5U A;  1BOW A;  2ZHG A;  3Q5R A;  2ZHH A; 
#chains in the Genus database with same CATH topology
 3W67 A;  3A0B E;  3CL3 D;  1P84 H;  1SFC D;  2OYH C;  4UB6 E;  3CD6 P;  2O1K A;  2J58 A;  1BGY J;  1SQV G;  2BCC E;  3AE5 C;  4DOJ A;  1OWA A;  3VMZ A;  4N6J A;  3TYY A;  1HJB A;  1UIX A;  2GM4 A;  1PGP A;  5APV A;  2ITA A;  1SQV J;  3M0D A;  4KHX A;  2KLV A;  3C8V A;  1FOS E;  5AW6 B;  1SQX G;  1KYO H;  2ZYG A;  1GL2 C;  3GHG C;  5APS A;  4PD4 H;  1M1J C;  1BE3 E;  2MJZ A;  5BVZ A;  2WSE J;  3AEG C;  2FXP A;  3CCM P;  3CCQ P;  1BCC G;  1YJN P;  2ZT9 D;  1AA0 A;  3VP8 A;  3U1A A;  3P8C D;  3H1H D;  1IFP A;  3V6I A;  3LIE A;  2I1J A;  3L70 D;  2D2C B;  2IYO A;  1NTZ J;  5CCH A;  2V7Q H;  4KT0 J;  2H8P D;  4D6T J;  3CLQ A;  5K5G B;  3H6P A;  3PH0 A;  1KD1 Q;  2ZVO B;  5AVR B;  1Y8A A;  1SQX E;  2XV5 A;  3SFE C;  2WPQ A;  1JUN A;  4GOD A;  3A0H H;  3A5T A;  2A06 D;  3AEB C;  2BEQ D;  1ZLL A;  3HD7 A;  3GP4 A;  3CX5 H;  3HE4 A;  1BCC E;  4ASV A;  5EFW B;  1AV1 A;  4PJ0 E;  5AVZ B;  4JPZ B;  2BAS A;  1MV8 A;  2G3A A;  1H89 A;  1AFO A;  3BRT B;  1QEX A;  1RF1 C;  2OYH B;  3MGN A;  4OGQ D;  1SQB K;  4H0L C;  4NPE A;  2WZ7 A;  4WVZ A;  1EXI A;  1RF0 A;  2RMZ A;  2C9L Y;  1L0N D;  2WT7 B;  4R22 B;  2E42 A;  3EZ7 A;  1NKZ B;  4JBZ A;  1EDJ A;  2ZXE B;  4DT0 A;  3MP7 B;  2O01 N;  3BRV B;  1CI6 A;  4WB4 A;  1M90 Q;  1S4X A;  4EIJ A;  5GTH H;  3H1J J;  2VZ4 A;  2JO1 A;  4PD4 D;  1GL2 B;  3HTK A;  1ZME C;  3GHG B;  2FFD C;  1M1J B;  1Q06 A;  1L4A A;  3TNU B;  3L71 J;  2MKV A;  2N1T A;  3E7K A;  3SFD C;  2W6B A;  4WY4 C;  2OTK E;  1SQP J;  1K8A Q;  1NU1 J;  3BVH A;  3V5B A;  4XFJ A;  2NZ2 A;  4R4L A;  3TGU D;  1S2E A;  5KLV G;  3H1I D;  2WPR A;  1FZC C;  4HKZ H;  3B71 A;  1EZV D;  1QVG O;  2LXB A;  3H1H G;  3L70 G;  2NPS C;  3M91 A;  5KLV J;  4HYT B;  1JY3 P;  5TJH A;  4AYZ A;  2LXC B;  1MFT A;  1Y47 A;  4H13 B;  4I6M C;  3Q2Y A;  1PP9 J;  3CC4 P;  3TDK A;  5B66 H;  3H1L D;  3CCS P;  3SSU A;  2A06 G;  1LTJ B;  1SS1 A;  1JTH B;  3AEF C;  3NXS A;  2O3J A;  1SLQ A;  5KAW A;  2IDB A;  5L8R J;  4IL6 X;  1RF1 B;  5KAI H;  1Q2N A;  3P8C E;  3H1H E;  4H0L B;  3U59 A;  3L70 E;  1XTC C;  2KUB A;  2XND H;  1OXZ A;  3LID A;  1OX3 A;  3O6Q A;  1SFC C;  1L0N G;  1NTK D;  1NH4 A;  4B86 A;  1YTZ I;  1W5C E;  1VF5 C;  2A06 E;  3RGU A;  4LC1 A;  2C9N Y;  4R4M A;  2FFD B;  2GOV A;  4EOT A;  2JWD A;  3L75 D;  1GW4 A;  2K37 A;  4WY4 B;  1SQQ J;  2NPS A;  1QL1 A;  1LTB C;  2KK7 A;  2FYU D;  4C7R A;  2BEZ F;  3FXE A;  2ZHG A;  1PV3 A;  3CWB D;  3Q1M A;  1OFC X;  1DEE G;  1FZC B;  2FYU K;  3H32 A;  2OAR A;  1SVF A;  3AE4 C;  4RO0 A;  2ZAE B;  3TGU G;  1L0N E;  1VQK P;  1X8Y A;  2ZT9 C;  3H1I G;  1NHL A;  1M57 D;  1EZV G;  1M56 D;  1N86 A;  4N78 E;  3L72 D;  4BXL A;  5B5E E;  5APU A;  3NTN A;  4C46 A;  4I1L A;  4PD4 E;  2WSE H;  5KKZ C;  3JCU H;  4EYY Q;  2KS1 A;  1PZQ A;  1NKN A;  4HH2 A;  3H1L G;  4MN4 C;  1JYH A;  3FWL A;  1QGK B;  4DZO A;  4PV1 D;  3H1L J;  1KB9 H;  3TGU E;  3VP9 A;  2O01 H;  3H1I E;  1GD2 E;  2E74 D;  1EZV E;  1TU3 F;  4N3Y B;  4TT3 H;  3TSI A;  3S9O A;  2KIK A;  1FE6 A;  1KZU B;  1AQ5 A;  2W90 A;  1NTM D;  1SFC B;  3MUD A;  2OYI C;  2Q9I A;  4OGQ C;  1LJ2 A;  4ASW A;  1H0T A;  3T97 A;  3A0H E;  2AEF A;  1NGM B;  2HPC A;  2YIU C;  1VF5 B;  1KFN A;  1ZW0 A;  3R4Y A;  1ZXG A;  4U3F D;  1NTK G;  4JQ0 D;  3H1L E;  1L0L G;  2M3E A;  4A7P A;  3B4S A;  1Q0A A;  3V2P A;  3EFG A;  1K04 A;  3L75 G;  2PAJ A;  1LTG C;  1L0L J;  3I56 P;  2K88 A;  3IF4 A;  1RQU A;  2OQQ A;  2YO2 A;  3AE2 C;  1SP4 A;  1Q86 Q;  2R44 A;  1OIP A;  3A7O A;  3KZI H;  3CWB G;  2ZT9 B;  2KZJ A;  2VRS A;  4WY4 D;  5APW A;  1FZF A;  3CXH H;  1OZH A;  2K9J B;  1NTK E;  4B0Y A;  5KJ7 A;  3RK2 D;  1FZA A;  2JJL A;  2Y9Y A;  3L37 A;  3L72 G;  2Q6Q A;  4A1M A;  5KKZ B;  1DH3 A;  3L75 E;  1OVV A;  1NWQ A;  4TLF A;  3M0D C;  2NPS D;  2H43 A;  5APX A;  4C7N B;  1Y9B A;  2FYU E;  3CCL P;  3AEC C;  4O9B A;  1X22 A;  1KB9 D;  5C39 A;  3L74 J;  3CWB E;  2E75 D;  1NAY A;  1NTZ K;  1E5W A;  1MKM A;  2BCC G;  2XKM A;  4IOI H;  3EZF A;  3LW5 J;  5CHX A;  4GDO A;  2OYI B;  3A2A A;  2V4H A;  4OGQ B;  1M7L A;  3L72 E;  1LTI C;  5CCH C;  2BCC J;  1G2C A;  1NTM G;  5B66 E;  1FDI A;  2LR2 A;  2Y9Z A;  1AVY A;  3IFM A;  4WBA A;  1GK6 A;  4U3F G;  3SWF A;  1HWT C;  2DG6 A;  1A02 J;  2KZI A;  1NYH A;  2IPP A;  3TK1 A;  3CC7 P;  1LP1 A;  2Y0D A;  3HD7 C;  3V2N A;  1BE3 J;  1T6A A;  1VF5 D;  4WLW A;  2QG4 A;  4L76 A;  5AW0 B;  1KMI Z;  1JCD A;  3CXH D;  3HUS A;  1OMI A;  2R3C A;  1NTM E;  2DW3 A;  1Q07 A;  1ZN5 A;  1LX8 A;  1M8O B;  1RF0 C;  4ZKP A;  1QX8 A;  4U3F E;  2PP6 A;  5TIS H;  2WPV B;  4IFD K;  5AW5 B;  3MIW A;  2AEM A;  3R8K A;  1SQX J;  1EXJ A;  3VMX A;  3L4F A;  5E01 A;  3WMM 0;  1HBW A;  2AXC A;  2QA4 P;  2KB7 P;  2JKV A;  1SQP K;  1ZR2 A;  1NU1 K;  5KTB A;  1VQ4 P;  1L4A C;  1BCC J;  2JML A;  1JM0 A;  2N1T C;  3D6Y A;  1G1I A;  1LTA C;  5CMZ A;  5AVV B;  3R8J A;  1U57 A;  1IFM A;  2O1J A;  2YXQ B;  2YNY A;  2OG0 A;  4PV1 C;  1JY2 O;  1DD4 A;  3SWY A;  5KJ7 D;  3Q5R A;  3VOP A;  2E74 C;  3B5N A;  1EC5 A;  2QJK C;  1LT9 A;  2XU6 A;  3MTU E;  1Q82 Q;  4LHF A;  3IR9 A;  1SQB D;  1W2E A;  3BAT A;  4UB8 H;  1P84 D;  1S72 P;  2K1A A;  3E1I A;  2QIW A;  2W83 C;  5AVW B;  1KQF B;  3UCS A;  1FDM A;  2WSC J;  2A45 G;  1KB9 E;  2IZ1 A;  5AW7 B;  1Q90 D;  3HE4 B;  4CPG A;  4H44 C;  2KOG A;  3N4X A;  1QL2 A;  1OVR A;  1YTZ T;  2WT7 A;  1T8Z A;  2XZR A;  3FWN A;  1R8E A;  1FBM A;  1T3U A;  1KTM A;  1AJY A;  4N78 D;  2J5U A;  1PL5 A;  1URQ A;  1E79 H;  3VN0 A;  3HE5 A;  2KVV A;  1KYO D;  3H1K D;  2B9B A;  1GZL A;  3D71 A;  2JR8 A;  3Q3D A;  2CPS A;  3ZDM A;  3AEA C;  2FBW C;  1N73 A;  1JY2 N;  4LLH A;  2K9Y A;  3NMD A;  3CCV P;  1CSB A;  1RH6 A;  1PGJ A;  1GTW A;  5DJU B;  1S5L H;  1KV4 A;  2YO3 A;  1CI6 B;  1SQQ K;  3RK2 C;  2QSI A;  3FGA D;  1EZV I;  1YIJ P;  1H88 A;  1K9M Q;  1G1J A;  1LTS C;  2QE7 H;  3HTK B;  1WT6 A;  1NAF A;  2Q3I A;  1L4A B;  3WUV A;  3MD0 A;  3L73 D;  3BCC E;  1S5L X;  4IFM A;  3VYI A;  1NOH A;  3PRJ A;  2WSS H;  3CXH E;  1VQL P;  2Q5U A;  4PV1 B;  2M5A A;  3H1H J;  3L70 J;  2R32 A;  4JYB A;  2E74 B;  2E75 C;  4IL6 H;  2QJK B;  3CX5 D;  1VQ6 P;  5I41 B;  1YBK A;  1Q7Y Q;  1LTJ A;  3KDP B;  4K3A A;  1X0T A;  4YXD C;  4Y99 C;  4LGD E;  4AYC A;  2E43 A;  1X79 B;  1VQN P;  2WPS A;  1SQB G;  2JWA A;  3EQ2 A;  3EFF K;  1JMM A;  3C9I A;  3AE9 C;  4L73 A;  1Q81 Q;  2N9B A;  2OGU A;  5CCH D;  1NO4 A;  2C0X A;  1IFD A;  5KLI C;  1EQ7 A;  4JYC A;  1DX7 A;  2L5G B;  3GK6 A;  2ZXX A;  2WSF H;  5GTI H;  1M1K Q;  5DJT B;  1LNQ A;  1R5S A;  2RH0 A;  2M3B A;  4YXW H;  3B5N D;  3SWK A;  3HD7 D;  5AVQ B;  5BU5 A;  1L0N J;  3O6Q B;  1LT1 A;  3MUD C;  1SQB E;  2IFM A;  1RH5 B;  3RK2 B;  2P67 A;  1P84 E;  3OW2 O;  1ZP0 C;  1X9V A;  4EDF A;  1OW7 A;  1VDF A;  2Y0C A;  4L74 A;  3CCR P;  2CPB A;  4HB1 A;  3V2R A;  2NPS B;  1LGH B;  1DD3 A;  4DCK A;  2XNX A;  3WU2 H;  5CCG A;  3L73 G;  3EZ2 A;  1URQ D;  1PPJ E;  3PJS K;  2GUV A;  1VQ8 P;  3TGU J;  2V7Q J;  3H32 B;  4Z1M H;  2E75 B;  3H1I J;  1KYO E;  3H1K E;  2UWJ E;  2KNC A;  1L4A D;  2YKP A;  4BRY A;  2N1T D;  3MZW B;  1RE4 A;  1EDK A;  1H8A A;  2WQY C;  5KJ7 C;  4Y28 J;  2KSJ A;  2YMK A;  5KAF H;  4RJT A;  1N7S A;  1FJP A;  2KSE A;  4PJ0 H;  2KS1 B;  5KLI B;  3L73 E;  5AVX B;  3P7K A;  4YPC A;  3EWK A;  4L75 A;  3FX0 A;  1BSH A;  3GW6 A;  3PLN A;  2SPZ A;  4IFF A;  3PHL A;  2B87 B;  3ITK A;  1IO4 A;  1KQG B;  1ZRT D;  3H25 A;  3CX5 E;  4AQR D;  1VPC A;  4H44 D;  4GIF A;  1XTG B;  3C1L A;  2IEF A;  3G3Z A;  2RN0 A;  1Q09 A;  4UB8 E;  1H0T B;  1RE3 A;  1NTK J;  3S1K A;  2HPC B;  1YJ9 P;  2HYN A;  4WWI A;  1QVF O;  1L2P A;  1BGY D;  2WSC H;  2LKM A;  2FYU G;  1VQ9 P;  2KP8 A;  1YQ3 C;  1IK9 A;  1GU4 A;  3L75 J;  1A02 F;  1FOS F;  1KIL A;  2FYU J;  4ZKU A;  3AE8 C;  1RQV A;  2QM7 A;  1SQV K;  5M1B A;  1JNM A;  5AW4 B;  5GTH E;  3CWB J;  1HUC A;  3G6E P;  3G4S P;  2L91 A;  3EZ6 A;  4OH8 B;  1YI2 P;  4W7Z A;  1JO5 A;  1LWU A;  3GPV A;  1HH0 A;  1MZ9 A;  3HUS C;  5E79 H;  3L72 J;  3W68 A;  3JC2 2;  3TF5 A;  1NTZ D;  1R5L A;  1VQP P;  4K35 A;  4D6T D;  3PP5 A;  2HOD A;  3CC2 P;  5AVS B;  2NRG A;  4NPD A;  1YHQ P;  5AVT B;  3HH0 A;  5CCG D;  1FJK A;  2YIU B;  1JCC A;  2Z5I A;  2M8R A;  1GW3 A;  4IL6 E;  3M0A A;  2A45 I;  2Q1K A;  3P8M C;  2XDJ A;  2RKL A;  1ZOY C;  3OA7 A;  1NTM J;  3U1C A;  1R8D A;  3R2P A;  5KAI E;  1N7S D;  3B5N C;  1PM6 A;  1LT9 C;  4U3F J;  1ZV8 A;  1J1E C;  2HG5 D;  3P32 A;  3BCC D;  1BGY G;  1WRG A;  1IC2 A;  1JY3 O;  2IBZ D;  3Q5P A;  5GTI E;  2E76 C;  2KI7 B;  3CCE P;  1FZG A;  2ZFC A;  2R5D A;  1LP1 B;  5AW9 B;  2WTY A;  3H1J D;  1GU5 A;  5H2F H;  2PFX A;  4QMA A;  3QAO A;  5KAU A;  4M3L A;  2P10 A;  3L71 D;  1ZRT E;  3KQG A;  3CME P;  2P7J A;  1SQP D;  3F5H A;  3HUS B;  1NU1 D;  1URQ C;  2WIT A;  5B5E H;  5BU8 B;  2GUS A;  2Z4E A;  5AVY B;  3RL0 C;  5AW2 B;  1FDO A;  4R4E A;  3RK3 D;  2FYN C;  1BGY E;  1T2K D;  1N73 C;  2JDI H;  2ZYA A;  3M06 A;  5D90 A;  1Y6U A;  1FZB A;  1NTZ G;  2C0W A;  1GMJ A;  5KLV D;  1Z56 A;  3WU2 E;  4NPF X;  1FC2 C;  1SQV E;  1KIL D;  2P1J A;  4D6T G;  1KQL A;  2W6J H;  2FXO A;  4W80 A;  1PP9 D;  2W8Z A;  3GMA A;  1JY3 N;  1OW6 A;  5KLV K;  1JEK A;  1PGQ A;  1S3J A;  2O01 J;  2WVR A;  5KAX A;  3GG2 A;  2P2U A;  3QH9 A;  5APY A;  2H89 C;  1P84 I;  3JCU E;  1U7M A;  1MFZ A;  1UII A;  4H13 C;  1IZN B;  3CPW O;  3M9H A;  3CCJ P;  2OYH A;  3RBZ A;  3E0H A;  5KAF E;  1RHZ B;  1YQ4 C;  2HR3 A;  3B5N B;  3L35 A;  3HD7 B;  1N7L A;  1LT9 B;  1NTZ E;  3II6 A;  2QJP C;  1LTJ C;  1J1E B;  2G8Y A;  4D6T E;  5KAV A;  2QEX P;  1DEB A;  1PFI A;  3WUU A;  2IX7 C;  2E76 B;  2YXR B;  3BCC G;  1KYO I;  3I5C A;  3EZ9 A;  2BOW A;  1PPJ D;  3S4R A;  2QRX A;  4PD4 I;  2AXT H;  3V4Q A;  2IBZ G;  1JBG A;  1GL2 A;  3IN6 A;  3GHG A;  3AED C;  3NFQ A;  1M1J A;  3BCC J;  4GT1 A;  4GOF A;  3H1J G;  1QLE D;  3TNU A;  4JF7 A;  4AUW A;  1SQQ D;  3AE7 C;  1GDT A;  1L0N K;  1URQ B;  3L71 G;  1KQS O;  1YIT P;  1D7M A;  3RL0 B;  3HE5 B;  1SQP G;  2FYN B;  4I2L C;  1GK4 A;  3RL0 g;  1NU1 G;  3E1R A;  2Q7C A;  2E5T A;  4RES B;  1N73 B;  2PGD A;  2N1T B;  2P58 A;  2JEE A;  2M0B A;  3CMA P;  3KZI E;  3VTP C;  1PIX A;  2H7H A;  2IBZ E;  1MUU A;  2FXM A;  3CX5 I;  4R24 B;  1S9K D;  3H1J E;  2YMY A;  1EDL A;  1FU1 A;  1LTT C;  2YKQ A;  3Q5S A;  1PP9 G;  4ZMD A;  3L71 E;  3QWO C;  4GOE A;  2JP3 A;  3D70 A;  1NVO A;  2OTL P;  1JTH A;  5CCG C;  4AYZ B;  3ABV C;  1SQP E;  5E79 E;  2M5A B;  1NU1 E;  5APQ A;  5AW8 B;  1AQT A;  1RF1 A;  1JB0 J;  5KCB A;  2D2C D;  3RK3 E;  3B8E B;  4ZNC A;  3M9B A;  2QJP B;  4W7Y A;  4H44 B;  1CZQ A;  1RY3 A;  1HVV A;  2OTJ P;  1RE4 C;  1SQB J;  3A0B H;  2QVA A;  5KLV E;  3LW5 H;  1VQM P;  1CW5 A;  4KJM A;  1KIL E;  1PGO A;  2IFN A;  4UB6 H;  1N7S C;  1PP9 E;  2KCU A;  1OW8 A;  1EDI A;  2I8D A;  3KPE A;  4GKG A;  2FFD A;  1PPJ G;  3BAS A;  5AVU B;  2FY8 A;  5CJ4 A;  4WY4 A;  1WMK A;  3O8Z A;  3H1K G;  1JOC A;  1L0L D;  1U7J A;  1SQQ G;  5AW3 B;  5GQQ A;  1W2B O;  1JY2 P;  2E76 D;  3I55 P;  3CCU P;  2E5Y A;  1NTK K;  3H1K J;  1FS0 E;  1FZC A;  2Y0E A;  1L0L K;  1HTL C;  2Z5H A;  2N9Y B;  3JSV C;  1RE3 C;  2WMM A;  5APT A;  4I7Z C;  3RK3 C;  2HFE D;  3V4W A;  5H2F E;  3WUT A;  1T2K C;  4HJG H;  2HVA A;  2KXP B;  3RL0 D;  1GL2 D;  1USD A;  1IK7 A;  3L73 J;  1HJ0 A;  5TIS E;  2KYV A;  1KIL C;  3CI9 A;  1SQQ E;  1T3J A;  2QJY C;  3AE6 C;  4Y99 B;  4OWF A;  1VQ5 P;  1IFN A;  2ZYD A;  3RBX A;  1KFM A;  4XA4 A;  5CJ0 A;  3L74 D;  2ZJS E;  2R5B A;  2KNC B;  3PTZ A;  5CBN A;  1DIP A;  4BRY B;  1LWU C;  3GF7 A;  1AVO A;  3K5B A;  1OVU A;  3IAO A;  5AW1 B;  1VL2 A;  1SFC A;  2K3R A;  1IFJ A;  3F89 A;  3L36 A;  1N7S B;  2BCC D;  4H13 D;  2IYP A;  2AEJ A;  2B87 A;  2IZ0 A;  4J2N A;  1S9K E;  3UIA A;  1BSN A;  3FXD A;  4YTP C;  3OJA B;  4OVN F;  3T97 B;  2J59 M;  3AE1 C;  2OYO A;  4DCZ A;  1NTM K;  1J1D C;  1BE3 D;  1D5Y A;  1N2D C;  4H0L D;  2Q3E A;  4EI2 A;  1HGZ A;  1BDD A;  3B49 A;  3GLM A;  3G9R A;  2CK3 H;  1S1C X;  1KOR A;  2ZVN B;  1SQV D;  2A45 H;  1JMB A;  1FZE A;  1K73 Q;  4I7Z B;  2FKW B;  3RK3 B;  2HLO A;  2K9J A;  3AEE C;  3D6Z A;  2AXT E;  3OAK A;  1HF9 A;  1BOW A;  3USS A;  4XE5 B;  1NJI Q;  3G71 P;  1Q08 A;  5KAT A;  1SQX D;  3A3Y B;  1KIL B;  3VMY A;  2QJY B;  2KLU A;  5CBO A;  4C7N A;  1S5L E;  1KB9 I;  1VQ7 P;  4WLS A;  1L0L E;  1YJW P;  3V2Q A;  4RKU J;  1SQX K;  2H88 C;  1J2J B;  1VQO P;  2FYZ A;  2QM8 A;  1BCC D;  3KHU A;  2PRR A;  1YYC A;  1LWU B;  3L74 G;  4DJG A;  1KN7 A;  3M9Q A;  2POH A;  4BWN A;  1USE A;  3KXD A;  2W27 A;  2WWW A;  3MHV A;  1FAV A;  2OYI A;  3VMA A;  2GA1 A;  1Q05 A;  5D8C A;  2B88 A;  2D2C C;  2R3S A;  1KC8 Q;  1ZR4 A;  2B89 A;  2I1K A;  3HRN A;  2HOD B;  1K05 A;  4U7J A;  1IJD B;  2WSF J;  3GF3 A;  3LUR A;  1IFI A;  1J1D B;  1G2C B;  3L74 E;  3N7N A;  1BDC A;  3AE3 C;  1HGV A;  3KYQ A;  2IBZ I;  5I44 A;  2W6A A;  1BE3 G;  3CXH I;  1N8R Q;  2YKO A;  2ZHH A; 
#chains in the Genus database with same CATH homology
 2JML A;  4H44 B;  1PV3 A;  3EWK A;  3GP4 A;  3D6Y A;  1Q08 A;  3Q1M A;  4AYZ A;  2QSI A;  1K04 A;  3FGA D;  5KAT A;  1JBG A;  4H13 B;  3R8J A;  1U57 A;  1FDI A;  3AE4 C;  3IN6 A;  3Q2Y A;  3AED C;  1KIL E;  3AE5 C;  2G3A A;  2ZT9 C;  1FDO A;  4R4E A;  3AE7 C;  2FYN C;  2OG0 A;  1DIP A;  4PV1 C;  1KQG B;  1RQU A;  2OQQ A;  3GF7 A;  3HH0 A;  4WLS A;  1DD4 A;  1OW8 A;  1S5L X;  3H25 A;  2KCU A;  3AE2 C;  4RKU J;  2H88 C;  1UIX A;  3Q5R A;  4OGQ D;  2DG6 A;  3IAO A;  1ZP0 C;  2E74 C;  4H44 D;  4H0L C;  5D90 A;  1Y6U A;  1NYH A;  1OW7 A;  2QJK C;  1VL2 A;  2IEF A;  1EXI A;  1GMJ A;  3AEF C;  2ZT9 B;  1Q09 A;  3C8V A;  3RL0 g;  4PV1 B;  4LHF A;  4H13 D;  1WMK A;  5KAW A;  2BOW A;  2IDB A;  5L8R J;  4R22 B;  4IL6 X;  4J2N A;  1DD3 A;  1VF5 D;  3EZ7 A;  5KKZ C;  2E74 B;  4WLW A;  2E75 C;  3GMA A;  4H0L B;  4B0Y A;  1OW6 A;  5I41 B;  4AYZ B;  5GQQ A;  2QIW A;  1ZOY C;  2E76 D;  2ZHH A;  1KMI Z;  3EZ2 A;  1KQF B;  3UCS A;  1YQ3 C;  1Q05 A;  5D8C A;  1PIX A;  2O01 J;  2WSE J;  5KAX A;  2D2C C;  2WSC J;  3AEG C;  2FXP A;  4YXD C;  1R8D A;  4YTP C;  1Q90 D;  2VZ4 A;  1OMI A;  2JO1 A;  4A1M A;  4H44 C;  3O6Q A;  1JYH A;  2V7Q J;  2ZT9 D;  4Z1M H;  2E75 B;  2H89 C;  1Q07 A;  4PV1 D;  4R24 B;  4OGQ B;  1LX8 A;  3T97 B;  1ZME C;  1PM6 A;  1R8E A;  1KTM A;  3AE1 C;  1K05 A;  1Q06 A;  4DCZ A;  4U7J A;  4H13 C;  2MKV A;  3AE8 C;  1AJY A;  1RQV A;  2E74 D;  3SFD C;  2D2C B;  1TU3 F;  2WSF J;  1Y9B A;  4H0L D;  1D5Y A;  3Q5S A;  4TT3 H;  3GF3 A;  5M1B A;  1VF5 C;  3AE9 C;  2J5U A;  4I7Z C;  1PL5 A;  3S9O A;  4KT0 J;  3E0H A;  2WPV B;  2JP3 A;  1YQ4 C;  3AEC C;  3B49 A;  3D70 A;  4R4M A;  3GLM A;  3G9R A;  2WQY C;  3Q5P A;  5KLI C;  3R8K A;  3EZ6 A;  2E76 C;  2GOV A;  2HVA A;  1EXJ A;  1S1C X;  4Y28 J;  2QJP C;  2KVV A;  1KOR A;  2YMK A;  3GK6 A;  3LUR A;  3ABV C;  4OGQ C;  4XFJ A;  3D71 A;  2E75 D;  2G8Y A;  2NZ2 A;  4R4L A;  5E01 A;  5KAV A;  3Q3D A;  1NGM B;  3AEA C;  2YIU C;  2FBW C;  3SFE C;  1VF5 B;  3GPV A;  3AE3 C;  3QAO A;  1IK7 A;  4I7Z B;  1MKM A;  3B71 A;  3R4Y A;  1HJ0 A;  5KAU A;  1JB0 J;  3EZF A;  2K9Y A;  3AEE C;  3D6Z A;  5KCB A;  2BEZ F;  5I44 A;  2D2C D;  3RK3 E;  2P10 A;  3LW5 J;  2E76 B;  2QJY C;  3AE6 C;  1HF9 A;  4GDO A;  1BOW A;  3AEB C;  1RH6 A;  2BEQ D;  1ZRT E;  2ZHG A;  3EZ9 A;  1Q0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...