3IAOA

Conformational plasticity of the coiled coil domain of bmrr is required for bmr promoter binding-the unliganded structure of bmrr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
273
Chain Sequence
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTSSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Conformational plasticity of the coiled-coil domain of BmrR is required for bmr operator binding: the structure of unliganded BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 73
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3iaoA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3iaoA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3iaoA03
3Q5RA 1Q09A 2VZ4A 5GQQA 1Q08A 4R24B 3B49A 3LURA 1JBGA 1R8EA 2BOWA 5D8CA 3GK6A 1EXJA 1EXIA 3UCSA 3D6ZA 3Q5PA 3G9RA 1Q05A 5KATA 4J2NA 3T97B 3GP4A 1R8DA 2DG6A 1JYHA 3D71A 2ZHGA 3D70A 5KAWA 5E01A 5I41B 3IAOA 4WLWA 5KCBA 4AYZB 1D5YA 3E0HA 4WLSA 4R4LA 3Q5SA 4A1MA 2JMLA 3QAOA 3GPVA 1BOWA 5KAUA 2ZHHA 1Q06A 1Q07A 1Q0AA 3Q3DA 3D6YA 2J5UA 3R8KA 4B0YA 2OQQA 4R4MA 2KCUA 3R8JA 3Q1MA 1DIPA 5I44A 4AYZA 5KAXA 2GOVA 3HH0A 5D90A 3Q2YA 4R4EA 4R22B 2HVAA 5KAVA
chains in the Genus database with same CATH superfamily
3VMXA 1RF0A 3HUSC 1SQBK 5AW6B 1LT1A 2K9JA 1SQXE 5B5EE 4AYZB 2KIKA 1SQXD 3R4YA 4N6JA 3HD7B 3AEBC 1OW8A 5TISH 3ABVC 1PIXA 3H1IJ 5KJ7A 5AVRB 5TJHA 4JF7A 3IN6A 3F5HA 1SQPG 2G8YA 2WSEJ 1N7SA 1OVVA 2PAJA 4JYCA 1NOHA 4W7ZA 1KYOE 4U7JA 1GU4A 4AUWA 3GF7A 4R22B 1KYOD 1VQPP 2E74D 2C0XA 4U3FE 5KAIH 4IFMA 3TGUG 2H43A 1JB0J 1KILA 1LTGC 4C7NA 3E7KA 3CMEP 2A45G 4UB6E 1FAVA 1KFNA 3I56P 4DJGA 3BVHA 4BRYB 3E1RA 1JCCA 3H32A 1RF1C 3ITKA 2QM8A 1EC5A 1ZR4A 2XU6A 3UIAA 4H13C 1YTZI 3L74G 4JQ0D 1FZCC 4NPEA 4HH2A 1LJ2A 1M8OB 3CXHH 1K9MQ 4YPCA 2CPSA 1PGJA 3NTNA 4UB8E 2FYNC 1SQXJ 3EZ2A 1EZVI 2KK7A 1RE3C 2N9YB 1GMJA 3EWKA 2P58A 2CPBA 1BGYG 1AV1A 3TF5A 3CX5H 1FZFA 3USSA 5AVTB 3L73J 5APVA 2OYIA 2R32A 5GTIE 3LURA 1XTGB 1VQ6P 1PP9G 1N86A 2JWAA 2K9JB 2QE7H 1H88A 3CX5I 3WU2H 2QJPB 1Y6UA 1FU1A 1LT9A 1BDDA 5AVSB 3EZ7A 1HJBA 4ZMDA 1Q0AA 3T97A 1PM6A 3KDPB 3MUDA 1GL2B 1L0LG 4WY4B 2KSEA 4ZNCA 2POHA 3A7OA 3SWYA 1X8YA 2E74C 1FJPA 5KLIB 2YMYA 2UWJE 1LTJC 2WQYC 2XV5A 1LWUC 5B5EH 1N7SD 1VQNP 1E5WA 1NH4A 3JC22 2OTLP 2B89A 1YQ3C 4IL6X 3AE7C 3K5BA 2A06G 1PL5A 2PGDA 1IZNB 3FWNA 1KILE 2HG5D 2GM4A 4RKUJ 3VP8A 1KILD 2BEZF 2M0BA 1RH6A 2RKLA 3MTUE 4L76A 2WITA 3C1LA 2WSCH 2K9YA 4EIJA 5B66E 3PJSK 1JY3P 2W6BA 3R8JA 1KYOH 3M0AA 3PP5A 1DD4A 2AXCA 1Y9BA 5CCHA 5CCGD 1KYOI 4UB6H 2E76B 1QVFO 3HTKA 1NO4A 1NTKE 1NTKD 2O1KA 1LNQA 1GW4A 2XNXA 1MV8A 3MIWA 3TSIA 2H88C 1J2JB 1RF0C 2AEMA 1DX7A 3F89A 1MZ9A 1WT6A 3P8CD 2B88A 1NTMG 2N1TA 4UB8H 3Q2YA 1Q7YQ 1KQLA 2HFED 1JTHB 1CW5A 2B87A 2SPZA 2WT7B 2M3BA 1GK6A 3L75J 5KJ7C 1HTLC 4XE5B 1JOCA 1YJ9P 4WY4C 2WPQA 1ZP0C 4IFDK 2W6JH 1N7SC 3LW5H 1RQUA 1SQQG 5I44A 2W8ZA 4WVZA 3OA7A 4GOFA 1LTTC 2FYUG 1KILC 1L0NJ 4U3FG 2L5GB 1ZMEC 2JJLA 3GHGB 2Q7CA 2KUBA 4I2LC 5KKZC 1USEA 1QX8A 2P1JA 1T8ZA 1S3JA 2KNCB 4I6MC 2Y0CA 1NU1G 4LGDE 1YTZT 1KD1Q 2Y0DA 2QJYB 3N7NA 2J5UA 4DCKA 2ZJSE 1ZXGA 2M5AB 3H1KG 3H1LE 3H1LD 4DOJA 3L72E 3L72D 5CCHD 3QH9A 1JNMA 3PTZA 1HJ0A 1NTZE 1KMIZ 1NTZD 3H1JG 4DT0A 4ZKPA 1LP1B 3AE1C 5APQA 1PV3A 3KHUA 3M0DA 2W27A 1N73B 1SQBE 4HYTB 2OYIC 4H0LB 1SQBD 3KYQA 1SQVJ 2IZ0A 3RK3B 3V4WA 1ZRTE 1ZRTD 5CBOA 1D5YA 3M91A 2BASA 2ZYAA 1N7LA 2N1TD 3OJAB 1L0NK 3B5NA 2ZVNB 3CC4P 3MUDC 2NPSA 2FXPA 2YO2A 1HVVA 1JMBA 3A0HE 3VOPA 1AQ5A 1K05A 3S4RA 2FKWB 2AXTE 1NAYA 1QEXA 2I8DA 3M06A 1M1JA 2OYHB 4QMAA 4IOIH 3D6ZA 1URQB 3MP7B 2Z5IA 3KQGA 3FGAD 1JY3O 2AEJA 2DW3A 4B86A 1ZN5A 4WLSA 2KP8A 3Q3DA 2W90A 1G2CB 4YXWH 2XZRA 3HD7A 4I7ZC 4R24B 1U7JA 1AQTA 3AE8C 4IL6E 3MGNA 3O6QA 5KATA 2FXMA 3CCLP 1IC2A 2C0WA 5DJUB 3U59A 5CCHC 1SQVK 2QSIA 1SQBJ 1MUUA 4EYYQ 2LR2A 2WVRA 4Y28J 3CCJP 3VTPC 1MKMA 1NTKG 1EXIA 3TGUJ 3H1IE 2V7QH 3H1ID 2KYVA 3M9BA 4OGQC 3IR9A 2N1TC 4DZOA 1FS0E 1M90Q 2L91A 2LXCB 1LX8A 5KLVG 3S1KA 4ASVA 1X79B 1ZR2A 1H89A 1H0TB 1RH5B 2OG0A 2QIWA 2R5BA 3FXDA 3I5CA 3Q5RA 1BE3G 1N8RQ 2D2CD 2K88A 1OXZA 3B5ND 1MFZA 5D8CA 4H13D 2NPSD 3OW2O 5KAFE 1FOSF 2KS1B 2R3CA 1K04A 3CI9A 3L71G 2IYOA 4R4LA 3GLMA 3BCCG 3PHLA 1FOSE 2K1AA 2JDIH 3TYYA 5EFWB 1OIPA 3L70G 1BCCG 1K73Q 1ZV8A 3A0HH 3AEFC 1IFPA 3SWKA 5CHXA 1S5LX 1FE6A 3C8VA 2AXTH 2H89C 1U7MA 5CBNA 3O6QB 1N2DC 1OFCX 4OH8B 1GL2A 2P10A 3L73E 1IFJA 3MZWB 4WY4A 3G9RA 3L73D 2HLOA 1E79H 2O01J 1VF5B 1DD3A 2IYPA 3V2QA 2IPPA 1VQOP 3L72G 2VZ4A 1JBGA 3KZIH 3M0DC 3CCQP 2YKPA 2WPRA 1R8DA 4PV1B 1PFIA 2BCCE 2BCCD 2J59M 5E79H 2OQQA 1A02F 1KQGB 3W67A 1LGHB 1LTSC 1VQ7P 1BSHA 3AE2C 2D2CC 1KB9E 3B5NC 1CI6B 1KB9D 3WUVA 2WSFH 2NPSC 3VMZA 1NJIQ 3WUTA 4WLWA 1UIIA 1R5LA 4O9BA 4LHFA 4LC1A 5KAWA 1KTMA 1Y47A 3RL0g 4D6TG 1M1JC 1OVRA 3CXHI 4PJ0E 1K8AQ 2OTJP 1L0LK 3HE4A 1NGMB 3IAOA 3QWOC 3CWBG 4OWFA 1PPJE 4HKZH 1PPJD 3CMAP 1YHQP 3B49A 3H1HG 2MJZA 3HD7C 2Q3EA 5AVWB 5AW5B 1GDTA 1JTHA 2WT7A 4H44B 4BWNA 3C9IA 1Q07A 4EOTA 3M9HA 5KAXA 3N4XA 1SQQJ 3ZDMA 1TU3F 4GIFA 2BCCJ 3V2PA 5KJ7D 1S2EA 2E75B 2OARA 3A3YB 3AE4C 3GG2A 4WY4D 3A2AA 3HRNA 2E5YA 2M8RA 4ASWA 2FYUJ 3L75E 3L75D 1G1JA 2KCUA 1A02J 2KI7B 4R4EA 4PV1C 4EI2A 3GHGA 1DEBA 1EZVG 2PP6A 1YJWP 3IF4A 3TDKA 2NRGA 1NU1J 3RK2B 4MN4C 1UIXA 2YIUB 2KNCA 2ZT9B 3V2RA 1Q06A 1BSNA 3A5TA 2E5TA 1GD2E 3CC2P 3W68A 1L0NE 1L0ND 2WPVB 3CCRP 4L74A 2LKMA 2J58A 1W5CE 4PD4E 2M5AA 4PD4D 1KV4A 1JY3N 1JM0A 1WMKA 1AA0A 1QL1A 1Q09A 2QJKB 2E76D 4IFFA 2HPCA 1KB9H 1LP1A 3HE4B 1N73A 1SQQK 3P7KA 2I1JA 3CC7P 3P8CE 2FBWC 1KB9I 1T3UA 2KOGA 2QJPC 3BATA 3IFMA 1SQXG 5AVYB 1GK4A 2FYUK 4H44C 2BOWA 3GK6A 4K3AA 1LTBC 1KZUB 1GL2C 3TK1A 1VQLP 2RH0A 1SQVE 3RL0B 3G6EP 1SQVD 4Z1MH 3PLNA 5KLIC 1S5LE 1NU1K 5GTIH 3B4SA 4M3LA 1YI2P 4J2NA 1R5SA 2OYHA 5BU5A 1J1DB 1URQA 5AW4B 1QL2A 2G3AA 3GF3A 3AE6C 4W7YA 3JSVC 1PGPA 2PFXA 3RK2C 1WRGA 4GDOA 3HE5B 1G2CA 1RQVA 5AVUB 1PZQA 2Y9YA 1J1EB 5APXA 3TNUB 3VMAA 3A0BE 2IZ1A 4XFJA 3PH0A 2OYOA 3G71P 5L8RJ 2E76C 1USDA 1AVOA 2DG6A 2GUSA 5E01A 4BXLA 3AEDC 5B66H 2O1JA 5AVZB 2HPCB 1SQPE 3HH0A 1VQ8P 1SQPD 4A7PA 1FZEA 2JKVA 2KLUA 5KLVJ 1IK9A 4H0LD 3RK3E 1KQSO 1OX3A 3RK3D 4OGQD 3B8EB 3G3ZA 3TGUE 1PGOA 3TGUD 1H0TA 3CPWO 2ZXEB 5AW8B 1BE3J 4RO0A 5AW2B 1JO5A 5APWA 2K37A 1Q90D 1YBKA 4JYBA 2IBZE 1FZBA 4A1MA 2IBZD 4N3YB 1BOWA 2KS1A 3BCCJ 1SFCB 2HVAA 3L74D 1J1DC 1EXJA 3NXSA 4XA4A 2W6AA 3GHGC 1NHLA 1BCCJ 3SFEC 5KTBA 1QLED 3SWFA 5KAUA 1URQD 2HODA 3Q1MA 3FWLA 2KLVA 2V7QJ 3M9QA 1DH3A 5APSA 1ZLLA 1GZLA 2QJYC 1L0NG 1IFMA 2P67A 3OAKA 2GUVA 3AEEC 4GT1A 1SQPJ 3HUSB 2PRRA 2QEXP 1PP9E 1IFNA 1AJYA 5BVZA 1PP9D 2HR3A 2GOVA 4WB4A 1VDFA 5KLVK 2IEFA 3R2PA 2Q3IA 2QA4P 1HH0A 1NVOA 2KZIA 3RGUA 1JEKA 1L0LE 3EZ6A 1L0LD 2KSJA 1N73C 3A0BH 4H0LC 3RK3C 3BRVB 2MKVA 1XTCC 3I55P 2OGUA 2E42A 3CLQA 3GP4A 4HJGH 3GMAA 1L4AB 4TT3H 1CI6A 3L74J 2QM7A 2FY8A 2H7HA 2A06D 1VQ5P 1Q86Q 3WUUA 1AFOA 3II6A 5APYA 1SQVG 4KHXA 1LTAC 1FZGA 1T6AA 3UCSA 1RF1B 5AVXB 1Y8AA 4D6TJ 3CX5E 1PGQA 3CX5D 2OYHC 2C9LY 1BGYJ 5AVQB 1URQC 3S9OA 1FZCB 5AW7B 1SQPK 1QVGO 3RBXA 1IO4A 2HYNA 3WU2E 3O8ZA 3H1HJ 1PP9J 2FXOA 2HODB 3BRTB 2YKQA 2IFMA 1SLQA 2FFDB 3JCUE 3VP9A 3L37A 4R4MA 4I1LA 3AECC 2YXRB 1L0LJ 2WZ7A 3HD7D 2IBZI 2H8PD 1NTME 1NTMD 4Y99B 4RJTA 1HBWA 3LIDA 3H1LG 1M57D 3FXEA 2RN0A 5CJ4A 2WSFJ 1D7MA 3AE3C 1M56D 1VF5D 2YMKA 1EDJA 1S1CX 1NTZG 3G4SP 1HUCA 1IK7A 4IL6H 3EZ9A 1P84E 1SQQE 1P84D 1SQQD 2Z5HA 1SQBG 4L73A 2E74B 2CK3H 3QAOA 2V4HA 1LTJB 4AYCA 1LWUB 4PV1D 2Q1KA 3P32A 2FYUE 1L4AC 3MD0A 2FYUD 4U3FD 2P7JA 2B9BA 2WMMA 1SP4A 2Y0EA 1FDMA 2WWWA 2JMLA 2VRSA 1VQ4P 2OTKE 1NU1E 1T3JA 3V6IA 2WSEH 1DIPA 2O01H 1NU1D 2IBZG 1GU5A 1EDLA 3NMDA 2Z4EA 5CCGA 5KCBA 3KXDA 4LLHA 2WTYA 3L4FA 3H1KE 4B0YA 4GKGA 3H1KD 1NTMJ 4NPFX 4EDFA 1AVYA 3P8MC 3FX0A 3LIEA 1M1KQ 2FFDC 3H1JE 4WBAA 5KAFH 3H1JD 2XDJA 3WMM0 2KZJA 3MHVA 4HB1A 2JR8A 1YYCA 4Y99C 4H44D 2IX7C 1VF5C 2WSCJ 3Q5PA 2JEEA 2R44A 1NYHA 1GL2D 1W2BO 1JY2P 2E75D 3AEGC 3GPVA 3JCUH 2IDBA 2R3SA 4U3FJ 1L2PA 2I1KA 1HGZA 3H1IG 1ZW0A 1NWQA 5H2FE 3CCEP 4CPGA 1N7SB 2YO3A 2YKOA 1KC8Q 5DJTB 3HE5A 3EZFA 1JY2N 2Q9IA 2JWDA 1EDKA 1JCDA 3GW6A 3RK2D 1KILB 3TNUA 4C7NB 5BU8B 2ZT9D 5AW1B 2QRXA 5KKZB 3H1KJ 1P84H 1KORA 1LTIC 2O3JA 1X0TA 1NTMK 1KN7A 1SQXK 3H32B 1S9KE 1S9KD 2JP3A 5KAVA 1P84I 3H1JJ 2WSSH 4OVNF 1HGVA 3LW5J 4K35A 1T2KD 1KFMA 1RY3A 2RMZA 1OWAA 1FC2C 3SSUA 5GTHE 1KQFB 2O01N 4N78E 4N78D 5D90A 5AVVB 3NFQA 2Q5UA 2E43A 2XNDH 2ZXXA 4PJ0H 2OYIB 1OW7A 3V5BA 2N9BA 3L73G 1DEEG 3R8KA 2E75C 2YXQB 5KLVE 5KLVD 3RL0D 1FZAA 1MFTA 4YXDC 1LT9B 1SFCA 2WPSA 1S4XA 3T97B 3CCMP 2ITAA 2ZFCA 1BE3E 3V4QA 1BE3D 4KJMA 2ZHHA 2M3EA 4KT0J 3H6PA 2BCCG 1RE4A 1BDCA 3L35A 3VMYA 2YIUC 3L71E 2ZT9C 3BCCE 3L71D 3BCCD 4DCZA 1HWTC 2ZVOB 5AW0B 2K3RA 2NZ2A 4ZKUA 3Q5SA 3U1AA 5K5GB 1OVUA 3L70E 1H8AA 1X22A 1BCCE 3L70D 4C7RA 1BCCD 3HUSA 2ZAEB 5H2FH 1R8EA 3EFFK 1NTKJ 1OZHA 4I7ZB 1SVFA 3EFGA 1T2KC 3KPEA 5CCGC 2QJKC 3D6YA 2YNYA 3EQ2A 1SS1A 5APTA 3H25A 1FJKA 1PPJG 3HTKB 3AE5C 4PD4H 1S72P 3L36A 1VQKP 3PRJA 3CCUP 2JO1A 1VPCA 1L4AA 4TLFA 1RHZB 5GQQA 4PD4I 1JY2O 4OGQB 2AEFA 3RL0C 2N1TB 3V2NA 2KVVA 1JMMA 5GTHH 3E1IA 1NKZB 1LT9C 1OW6A 1RF1A 2B87B 3B71A 3L71J 4W80A 1CSBA 3L74E 3L75G 1FZCA 1IFDA 3L70J 1SFCD 5APUA 1Q2NA 1EDIA 1M7LA 1NTKK 1IJDB 4D6TE 5TISE 1IFIA 1S5LH 4L75A 4D6TD 2FFDA 5CMZA 1J1EC 1RE3A 1GTWA 1BGYE 1W2EA 5M1BA 1BGYD 3CWBE 1Q05A 3CWBD 1QGKB 2ZYGA 4RESB 1VQMP 3AEAC 1G1IA 3H1HE 1VQ9P 2P2UA 1EQ7A 3H1HD 1U57A 4AYZA 3H1LJ 2BEQD 3BASA 3L72J 1Q81Q 3AE9C 3KZIE 5KAIE 1FBMA 1YJNP 1FDIA 1Q82Q 1NTZJ 2QG4A 4GOEA 1JYHA 3D71A 1FDOA 1YQ4C 2ZYDA 5I41B 3SFDC 5E79E 4JPZB 2QVAA 5C39A 1GW3A 3CD6P 1NAFA 5CJ0A 1LTJA 2KXPB 2R5DA 1LWUA 4AQRD 1JUNA 5AW3B 2ZHGA 1VL2A 1EZVE 2A06E 1EZVD 3CXHE 3VYIA 3CXHD 2W83C 2GA1A 2C9NY 1OMIA 1ZOYC 4NPDA 1L4AD 4BRYA 5AW9B 2LXBA 4JBZA 4YTPC 4C46A 3D70A 4GODA 1SFCC 2D2CB 3E0HA 2Y9ZA 3B5NB 1CZQA 4H13B 2NPSB 1NKNA 2Q6QA 1Z56A 3CWBJ 3RBZA 3VN0A 1YIJP 1Q08A 2A45H 1YITP 2XKMA 1RE4C 2FYZA 2IFNA 4WWIA 2KB7P 3U1CA 2FYNB 3CL3D 1M1JB 1NTZK 2A45I 1HF9A 1X9VA 3CCVP 3CCSP
chains in the Genus database with same CATH topology
3Q5RA 3H25A 2FYNC 2D2CD 3AE9C 3AE2C 4H44D 1S1CX 1VF5C 5D8CA 2D2CC 1DD4A 2WSCJ 1IK7A 1FDIA 3D6ZA 3Q5PA 4H13D 3EZ2A 1Q90D 1NYHA 3EZ9A 3FGAD 4J2NA 1Y9BA 3GP4A 3AE5C 1JYHA 1GMJA 3D71A 1FDOA 1YQ4C 3GMAA 1UIXA 1K04A 5I41B 3EWKA 4WLWA 4TT3H 3SFDC 1OW7A 2E76B 4WLSA 2ZT9B 2E75D 2E74B 3GLMA 3R4YA 3QAOA 3AEGC 3GPVA 4R4LA 4LHFA 2IDBA 1BOWA 1Q06A 3Q3DA 2G3AA 3R8KA 2J5UA 2E75C 3AEBC 1OW8A 2JO1A 3AE6C 3GF3A 4PV1D 3ABVC 5KAWA 2HVAA 1PIXA 4AYZB 1KTMA 4GDOA 5GQQA 4I7ZC 4R24B 2WPVB 3LURA 3IN6A 1EXJA 4OGQB 4YXDC 3UCSA 2H88C 2YMKA 3AE8C 1RQVA 3RL0g 3AEFC 3O6QA 5KATA 1Y6UA 2G8YA 3SFEC 2WSEJ 3T97B 2ZHGA 1S5LX 3EZFA 1NGMB 3IAOA 3C8VA 2KVVA 1VL2A 3EZ7A 2JMLA 1HJ0A 5KAUA 2ZHHA 1KMIZ 2QSIA 1Q0AA 1OW6A 4KT0J 3B71A 1PM6A 2H89C 3Q1MA 1DIPA 3AE1C 1WMKA 4U7JA 3S9OA 4XFJA 1OMIA 3Q2YA 1PV3A 4R22B 1ZOYC 3GF7A 4Y28J 2V7QJ 1Q09A 1MKMA 2E76D 2ZT9D 2E74D 2YIUC 3B49A 4H0LB 5L8RJ 1EXIA 2E76C 2ZT9C 2E74C 2P10A 1JB0J 4DCZA 2QJYC 3G9RA 1ZRTE 4YTPC 1KORA 2WQYC 2DG6A 3D70A 4A1MA 3AEEC 5E01A 1VF5B 2O01J 1ZP0C 2NZ2A 5KCBA 2D2CB 1DD3A 3AEDC 4H44B 3E0HA 3Q5SA 1D5YA 1Q07A 4H13B 1AJYA 4B0YA 4OGQC 1RQUA 2FBWC 2JP3A 4R4MA 5I44A 1YQ3C 4IL6X 3AECC 5KAXA 3HH0A 2GOVA 3AE7C 2QJPC 5KAVA 2VZ4A 1Q08A 2IEFA 1TU3F 1PL5A 3AE3C 4H44C 1JBGA 1R8EA 2BOWA 2FXPA 3GK6A 2E75B 5M1BA 4H13C 1KILE 1LX8A 3LW5J 1Q05A 3AE4C 4RKUJ 1R8DA 2BEZF 1K05A 4I7ZB 4PV1B 1RH6A 3EZ6A 1ZMEC 4H0LD 2K9YA 2QJKC 3RK3E 1KQFB 3AEAC 4OGQD 2OG0A 3D6YA 2QIWA 4H0LC 4Z1MH 2OQQA 2KCUA 1HF9A 3R8JA 1U57A 5KKZC 4AYZA 2WSFJ 5KLIC 2BEQD 5D90A 1KQGB 4R4EA 2MKVA 1VF5D 4PV1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5R A;  1Q09 A;  2VZ4 A;  5GQQ A;  1Q08 A;  4R24 B;  3B49 A;  3LUR A;  1JBG A;  1R8E A;  2BOW A;  5D8C A;  3GK6 A;  1EXJ A;  1EXI A;  3UCS A;  3D6Z A;  3Q5P A;  3G9R A;  1Q05 A;  5KAT A;  4J2N A;  3T97 B;  3GP4 A;  1R8D A;  2DG6 A;  1JYH A;  3D71 A;  2ZHG A;  3D70 A;  5KAW A;  5E01 A;  5I41 B;  3IAO A;  4WLW A;  5KCB A;  4AYZ B;  1D5Y A;  3E0H A;  4WLS A;  4R4L A;  3Q5S A;  4A1M A;  2JML A;  3QAO A;  3GPV A;  1BOW A;  5KAU A;  2ZHH A;  1Q06 A;  1Q07 A;  1Q0A A;  3Q3D A;  3D6Y A;  2J5U A;  3R8K A;  4B0Y A;  2OQQ A;  4R4M A;  2KCU A;  3R8J A;  3Q1M A;  1DIP A;  5I44 A;  4AYZ A;  5KAX A;  2GOV A;  3HH0 A;  5D90 A;  3Q2Y A;  4R4E A;  4R22 B;  2HVA A;  5KAV A; 
#chains in the Genus database with same CATH topology
 3VMX A;  1RF0 A;  3HUS C;  1SQB K;  5AW6 B;  1LT1 A;  2K9J A;  1SQX E;  5B5E E;  4AYZ B;  2KIK A;  1SQX D;  3R4Y A;  4N6J A;  3HD7 B;  3AEB C;  1OW8 A;  5TIS H;  3ABV C;  1PIX A;  3H1I J;  5KJ7 A;  5AVR B;  5TJH A;  4JF7 A;  3IN6 A;  3F5H A;  1SQP G;  2G8Y A;  2WSE J;  1N7S A;  1OVV A;  2PAJ A;  4JYC A;  1NOH A;  4W7Z A;  1KYO E;  4U7J A;  1GU4 A;  4AUW A;  3GF7 A;  4R22 B;  1KYO D;  1VQP P;  2E74 D;  2C0X A;  4U3F E;  5KAI H;  4IFM A;  3TGU G;  2H43 A;  1JB0 J;  1KIL A;  1LTG C;  4C7N A;  3E7K A;  3CME P;  2A45 G;  4UB6 E;  1FAV A;  1KFN A;  3I56 P;  4DJG A;  3BVH A;  4BRY B;  3E1R A;  1JCC A;  3H32 A;  1RF1 C;  3ITK A;  2QM8 A;  1EC5 A;  1ZR4 A;  2XU6 A;  3UIA A;  4H13 C;  1YTZ I;  3L74 G;  4JQ0 D;  1FZC C;  4NPE A;  4HH2 A;  1LJ2 A;  1M8O B;  3CXH H;  1K9M Q;  4YPC A;  2CPS A;  1PGJ A;  3NTN A;  4UB8 E;  2FYN C;  1SQX J;  3EZ2 A;  1EZV I;  2KK7 A;  1RE3 C;  2N9Y B;  1GMJ A;  3EWK A;  2P58 A;  2CPB A;  1BGY G;  1AV1 A;  3TF5 A;  3CX5 H;  1FZF A;  3USS A;  5AVT B;  3L73 J;  5APV A;  2OYI A;  2R32 A;  5GTI E;  3LUR A;  1XTG B;  1VQ6 P;  1PP9 G;  1N86 A;  2JWA A;  2K9J B;  2QE7 H;  1H88 A;  3CX5 I;  3WU2 H;  2QJP B;  1Y6U A;  1FU1 A;  1LT9 A;  1BDD A;  5AVS B;  3EZ7 A;  1HJB A;  4ZMD A;  1Q0A A;  3T97 A;  1PM6 A;  3KDP B;  3MUD A;  1GL2 B;  1L0L G;  4WY4 B;  2KSE A;  4ZNC A;  2POH A;  3A7O A;  3SWY A;  1X8Y A;  2E74 C;  1FJP A;  5KLI B;  2YMY A;  2UWJ E;  1LTJ C;  2WQY C;  2XV5 A;  1LWU C;  5B5E H;  1N7S D;  1VQN P;  1E5W A;  1NH4 A;  3JC2 2;  2OTL P;  2B89 A;  1YQ3 C;  4IL6 X;  3AE7 C;  3K5B A;  2A06 G;  1PL5 A;  2PGD A;  1IZN B;  3FWN A;  1KIL E;  2HG5 D;  2GM4 A;  4RKU J;  3VP8 A;  1KIL D;  2BEZ F;  2M0B A;  1RH6 A;  2RKL A;  3MTU E;  4L76 A;  2WIT A;  3C1L A;  2WSC H;  2K9Y A;  4EIJ A;  5B66 E;  3PJS K;  1JY3 P;  2W6B A;  3R8J A;  1KYO H;  3M0A A;  3PP5 A;  1DD4 A;  2AXC A;  1Y9B A;  5CCH A;  5CCG D;  1KYO I;  4UB6 H;  2E76 B;  1QVF O;  3HTK A;  1NO4 A;  1NTK E;  1NTK D;  2O1K A;  1LNQ A;  1GW4 A;  2XNX A;  1MV8 A;  3MIW A;  3TSI A;  2H88 C;  1J2J B;  1RF0 C;  2AEM A;  1DX7 A;  3F89 A;  1MZ9 A;  1WT6 A;  3P8C D;  2B88 A;  1NTM G;  2N1T A;  4UB8 H;  3Q2Y A;  1Q7Y Q;  1KQL A;  2HFE D;  1JTH B;  1CW5 A;  2B87 A;  2SPZ A;  2WT7 B;  2M3B A;  1GK6 A;  3L75 J;  5KJ7 C;  1HTL C;  4XE5 B;  1JOC A;  1YJ9 P;  4WY4 C;  2WPQ A;  1ZP0 C;  4IFD K;  2W6J H;  1N7S C;  3LW5 H;  1RQU A;  1SQQ G;  5I44 A;  2W8Z A;  4WVZ A;  3OA7 A;  4GOF A;  1LTT C;  2FYU G;  1KIL C;  1L0N J;  4U3F G;  2L5G B;  1ZME C;  2JJL A;  3GHG B;  2Q7C A;  2KUB A;  4I2L C;  5KKZ C;  1USE A;  1QX8 A;  2P1J A;  1T8Z A;  1S3J A;  2KNC B;  4I6M C;  2Y0C A;  1NU1 G;  4LGD E;  1YTZ T;  1KD1 Q;  2Y0D A;  2QJY B;  3N7N A;  2J5U A;  4DCK A;  2ZJS E;  1ZXG A;  2M5A B;  3H1K G;  3H1L E;  3H1L D;  4DOJ A;  3L72 E;  3L72 D;  5CCH D;  3QH9 A;  1JNM A;  3PTZ A;  1HJ0 A;  1NTZ E;  1KMI Z;  1NTZ D;  3H1J G;  4DT0 A;  4ZKP A;  1LP1 B;  3AE1 C;  5APQ A;  1PV3 A;  3KHU A;  3M0D A;  2W27 A;  1N73 B;  1SQB E;  4HYT B;  2OYI C;  4H0L B;  1SQB D;  3KYQ A;  1SQV J;  2IZ0 A;  3RK3 B;  3V4W A;  1ZRT E;  1ZRT D;  5CBO A;  1D5Y A;  3M91 A;  2BAS A;  2ZYA A;  1N7L A;  2N1T D;  3OJA B;  1L0N K;  3B5N A;  2ZVN B;  3CC4 P;  3MUD C;  2NPS A;  2FXP A;  2YO2 A;  1HVV A;  1JMB A;  3A0H E;  3VOP A;  1AQ5 A;  1K05 A;  3S4R A;  2FKW B;  2AXT E;  1NAY A;  1QEX A;  2I8D A;  3M06 A;  1M1J A;  2OYH B;  4QMA A;  4IOI H;  3D6Z A;  1URQ B;  3MP7 B;  2Z5I A;  3KQG A;  3FGA D;  1JY3 O;  2AEJ A;  2DW3 A;  4B86 A;  1ZN5 A;  4WLS A;  2KP8 A;  3Q3D A;  2W90 A;  1G2C B;  4YXW H;  2XZR A;  3HD7 A;  4I7Z C;  4R24 B;  1U7J A;  1AQT A;  3AE8 C;  4IL6 E;  3MGN A;  3O6Q A;  5KAT A;  2FXM A;  3CCL P;  1IC2 A;  2C0W A;  5DJU B;  3U59 A;  5CCH C;  1SQV K;  2QSI A;  1SQB J;  1MUU A;  4EYY Q;  2LR2 A;  2WVR A;  4Y28 J;  3CCJ P;  3VTP C;  1MKM A;  1NTK G;  1EXI A;  3TGU J;  3H1I E;  2V7Q H;  3H1I D;  2KYV A;  3M9B A;  4OGQ C;  3IR9 A;  2N1T C;  4DZO A;  1FS0 E;  1M90 Q;  2L91 A;  2LXC B;  1LX8 A;  5KLV G;  3S1K A;  4ASV A;  1X79 B;  1ZR2 A;  1H89 A;  1H0T B;  1RH5 B;  2OG0 A;  2QIW A;  2R5B A;  3FXD A;  3I5C A;  3Q5R A;  1BE3 G;  1N8R Q;  2D2C D;  2K88 A;  1OXZ A;  3B5N D;  1MFZ A;  5D8C A;  4H13 D;  2NPS D;  3OW2 O;  5KAF E;  1FOS F;  2KS1 B;  2R3C A;  1K04 A;  3CI9 A;  3L71 G;  2IYO A;  4R4L A;  3GLM A;  3BCC G;  3PHL A;  1FOS E;  2K1A A;  2JDI H;  3TYY A;  5EFW B;  1OIP A;  3L70 G;  1BCC G;  1K73 Q;  1ZV8 A;  3A0H H;  3AEF C;  1IFP A;  3SWK A;  5CHX A;  1S5L X;  1FE6 A;  3C8V A;  2AXT H;  2H89 C;  1U7M A;  5CBN A;  3O6Q B;  1N2D C;  1OFC X;  4OH8 B;  1GL2 A;  2P10 A;  3L73 E;  1IFJ A;  3MZW B;  4WY4 A;  3G9R A;  3L73 D;  2HLO A;  1E79 H;  2O01 J;  1VF5 B;  1DD3 A;  2IYP A;  3V2Q A;  2IPP A;  1VQO P;  3L72 G;  2VZ4 A;  1JBG A;  3KZI H;  3M0D C;  3CCQ P;  2YKP A;  2WPR A;  1R8D A;  4PV1 B;  1PFI A;  2BCC E;  2BCC D;  2J59 M;  5E79 H;  2OQQ A;  1A02 F;  1KQG B;  3W67 A;  1LGH B;  1LTS C;  1VQ7 P;  1BSH A;  3AE2 C;  2D2C C;  1KB9 E;  3B5N C;  1CI6 B;  1KB9 D;  3WUV A;  2WSF H;  2NPS C;  3VMZ A;  1NJI Q;  3WUT A;  4WLW A;  1UII A;  1R5L A;  4O9B A;  4LHF A;  4LC1 A;  5KAW A;  1KTM A;  1Y47 A;  3RL0 g;  4D6T G;  1M1J C;  1OVR A;  3CXH I;  4PJ0 E;  1K8A Q;  2OTJ P;  1L0L K;  3HE4 A;  1NGM B;  3IAO A;  3QWO C;  3CWB G;  4OWF A;  1PPJ E;  4HKZ H;  1PPJ D;  3CMA P;  1YHQ P;  3B49 A;  3H1H G;  2MJZ A;  3HD7 C;  2Q3E A;  5AVW B;  5AW5 B;  1GDT A;  1JTH A;  2WT7 A;  4H44 B;  4BWN A;  3C9I A;  1Q07 A;  4EOT A;  3M9H A;  5KAX A;  3N4X A;  1SQQ J;  3ZDM A;  1TU3 F;  4GIF A;  2BCC J;  3V2P A;  5KJ7 D;  1S2E A;  2E75 B;  2OAR A;  3A3Y B;  3AE4 C;  3GG2 A;  4WY4 D;  3A2A A;  3HRN A;  2E5Y A;  2M8R A;  4ASW A;  2FYU J;  3L75 E;  3L75 D;  1G1J A;  2KCU A;  1A02 J;  2KI7 B;  4R4E A;  4PV1 C;  4EI2 A;  3GHG A;  1DEB A;  1EZV G;  2PP6 A;  1YJW P;  3IF4 A;  3TDK A;  2NRG A;  1NU1 J;  3RK2 B;  4MN4 C;  1UIX A;  2YIU B;  2KNC A;  2ZT9 B;  3V2R A;  1Q06 A;  1BSN A;  3A5T A;  2E5T A;  1GD2 E;  3CC2 P;  3W68 A;  1L0N E;  1L0N D;  2WPV B;  3CCR P;  4L74 A;  2LKM A;  2J58 A;  1W5C E;  4PD4 E;  2M5A A;  4PD4 D;  1KV4 A;  1JY3 N;  1JM0 A;  1WMK A;  1AA0 A;  1QL1 A;  1Q09 A;  2QJK B;  2E76 D;  4IFF A;  2HPC A;  1KB9 H;  1LP1 A;  3HE4 B;  1N73 A;  1SQQ K;  3P7K A;  2I1J A;  3CC7 P;  3P8C E;  2FBW C;  1KB9 I;  1T3U A;  2KOG A;  2QJP C;  3BAT A;  3IFM A;  1SQX G;  5AVY B;  1GK4 A;  2FYU K;  4H44 C;  2BOW A;  3GK6 A;  4K3A A;  1LTB C;  1KZU B;  1GL2 C;  3TK1 A;  1VQL P;  2RH0 A;  1SQV E;  3RL0 B;  3G6E P;  1SQV D;  4Z1M H;  3PLN A;  5KLI C;  1S5L E;  1NU1 K;  5GTI H;  3B4S A;  4M3L A;  1YI2 P;  4J2N A;  1R5S A;  2OYH A;  5BU5 A;  1J1D B;  1URQ A;  5AW4 B;  1QL2 A;  2G3A A;  3GF3 A;  3AE6 C;  4W7Y A;  3JSV C;  1PGP A;  2PFX A;  3RK2 C;  1WRG A;  4GDO A;  3HE5 B;  1G2C A;  1RQV A;  5AVU B;  1PZQ A;  2Y9Y A;  1J1E B;  5APX A;  3TNU B;  3VMA A;  3A0B E;  2IZ1 A;  4XFJ A;  3PH0 A;  2OYO A;  3G71 P;  5L8R J;  2E76 C;  1USD A;  1AVO A;  2DG6 A;  2GUS A;  5E01 A;  4BXL A;  3AED C;  5B66 H;  2O1J A;  5AVZ B;  2HPC B;  1SQP E;  3HH0 A;  1VQ8 P;  1SQP D;  4A7P A;  1FZE A;  2JKV A;  2KLU A;  5KLV J;  1IK9 A;  4H0L D;  3RK3 E;  1KQS O;  1OX3 A;  3RK3 D;  4OGQ D;  3B8E B;  3G3Z A;  3TGU E;  1PGO A;  3TGU D;  1H0T A;  3CPW O;  2ZXE B;  5AW8 B;  1BE3 J;  4RO0 A;  5AW2 B;  1JO5 A;  5APW A;  2K37 A;  1Q90 D;  1YBK A;  4JYB A;  2IBZ E;  1FZB A;  4A1M A;  2IBZ D;  4N3Y B;  1BOW A;  2KS1 A;  3BCC J;  1SFC B;  2HVA A;  3L74 D;  1J1D C;  1EXJ A;  3NXS A;  4XA4 A;  2W6A A;  3GHG C;  1NHL A;  1BCC J;  3SFE C;  5KTB A;  1QLE D;  3SWF A;  5KAU A;  1URQ D;  2HOD A;  3Q1M A;  3FWL A;  2KLV A;  2V7Q J;  3M9Q A;  1DH3 A;  5APS A;  1ZLL A;  1GZL A;  2QJY C;  1L0N G;  1IFM A;  2P67 A;  3OAK A;  2GUV A;  3AEE C;  4GT1 A;  1SQP J;  3HUS B;  2PRR A;  2QEX P;  1PP9 E;  1IFN A;  1AJY A;  5BVZ A;  1PP9 D;  2HR3 A;  2GOV A;  4WB4 A;  1VDF A;  5KLV K;  2IEF A;  3R2P A;  2Q3I A;  2QA4 P;  1HH0 A;  1NVO A;  2KZI A;  3RGU A;  1JEK A;  1L0L E;  3EZ6 A;  1L0L D;  2KSJ A;  1N73 C;  3A0B H;  4H0L C;  3RK3 C;  3BRV B;  2MKV A;  1XTC C;  3I55 P;  2OGU A;  2E42 A;  3CLQ A;  3GP4 A;  4HJG H;  3GMA A;  1L4A B;  4TT3 H;  1CI6 A;  3L74 J;  2QM7 A;  2FY8 A;  2H7H A;  2A06 D;  1VQ5 P;  1Q86 Q;  3WUU A;  1AFO A;  3II6 A;  5APY A;  1SQV G;  4KHX A;  1LTA C;  1FZG A;  1T6A A;  3UCS A;  1RF1 B;  5AVX B;  1Y8A A;  4D6T J;  3CX5 E;  1PGQ A;  3CX5 D;  2OYH C;  2C9L Y;  1BGY J;  5AVQ B;  1URQ C;  3S9O A;  1FZC B;  5AW7 B;  1SQP K;  1QVG O;  3RBX A;  1IO4 A;  2HYN A;  3WU2 E;  3O8Z A;  3H1H J;  1PP9 J;  2FXO A;  2HOD B;  3BRT B;  2YKQ A;  2IFM A;  1SLQ A;  2FFD B;  3JCU E;  3VP9 A;  3L37 A;  4R4M A;  4I1L A;  3AEC C;  2YXR B;  1L0L J;  2WZ7 A;  3HD7 D;  2IBZ I;  2H8P D;  1NTM E;  1NTM D;  4Y99 B;  4RJT A;  1HBW A;  3LID A;  3H1L G;  1M57 D;  3FXE A;  2RN0 A;  5CJ4 A;  2WSF J;  1D7M A;  3AE3 C;  1M56 D;  1VF5 D;  2YMK A;  1EDJ A;  1S1C X;  1NTZ G;  3G4S P;  1HUC A;  1IK7 A;  4IL6 H;  3EZ9 A;  1P84 E;  1SQQ E;  1P84 D;  1SQQ D;  2Z5H A;  1SQB G;  4L73 A;  2E74 B;  2CK3 H;  3QAO A;  2V4H A;  1LTJ B;  4AYC A;  1LWU B;  4PV1 D;  2Q1K A;  3P32 A;  2FYU E;  1L4A C;  3MD0 A;  2FYU D;  4U3F D;  2P7J A;  2B9B A;  2WMM A;  1SP4 A;  2Y0E A;  1FDM A;  2WWW A;  2JML A;  2VRS A;  1VQ4 P;  2OTK E;  1NU1 E;  1T3J A;  3V6I A;  2WSE H;  1DIP A;  2O01 H;  1NU1 D;  2IBZ G;  1GU5 A;  1EDL A;  3NMD A;  2Z4E A;  5CCG A;  5KCB A;  3KXD A;  4LLH A;  2WTY A;  3L4F A;  3H1K E;  4B0Y A;  4GKG A;  3H1K D;  1NTM J;  4NPF X;  4EDF A;  1AVY A;  3P8M C;  3FX0 A;  3LIE A;  1M1K Q;  2FFD C;  3H1J E;  4WBA A;  5KAF H;  3H1J D;  2XDJ A;  3WMM 0;  2KZJ A;  3MHV A;  4HB1 A;  2JR8 A;  1YYC A;  4Y99 C;  4H44 D;  2IX7 C;  1VF5 C;  2WSC J;  3Q5P A;  2JEE A;  2R44 A;  1NYH A;  1GL2 D;  1W2B O;  1JY2 P;  2E75 D;  3AEG C;  3GPV A;  3JCU H;  2IDB A;  2R3S A;  4U3F J;  1L2P A;  2I1K A;  1HGZ A;  3H1I G;  1ZW0 A;  1NWQ A;  5H2F E;  3CCE P;  4CPG A;  1N7S B;  2YO3 A;  2YKO A;  1KC8 Q;  5DJT B;  3HE5 A;  3EZF A;  1JY2 N;  2Q9I A;  2JWD A;  1EDK A;  1JCD A;  3GW6 A;  3RK2 D;  1KIL B;  3TNU A;  4C7N B;  5BU8 B;  2ZT9 D;  5AW1 B;  2QRX A;  5KKZ B;  3H1K J;  1P84 H;  1KOR A;  1LTI C;  2O3J A;  1X0T A;  1NTM K;  1KN7 A;  1SQX K;  3H32 B;  1S9K E;  1S9K D;  2JP3 A;  5KAV A;  1P84 I;  3H1J J;  2WSS H;  4OVN F;  1HGV A;  3LW5 J;  4K35 A;  1T2K D;  1KFM A;  1RY3 A;  2RMZ A;  1OWA A;  1FC2 C;  3SSU A;  5GTH E;  1KQF B;  2O01 N;  4N78 E;  4N78 D;  5D90 A;  5AVV B;  3NFQ A;  2Q5U A;  2E43 A;  2XND H;  2ZXX A;  4PJ0 H;  2OYI B;  1OW7 A;  3V5B A;  2N9B A;  3L73 G;  1DEE G;  3R8K A;  2E75 C;  2YXQ B;  5KLV E;  5KLV D;  3RL0 D;  1FZA A;  1MFT A;  4YXD C;  1LT9 B;  1SFC A;  2WPS A;  1S4X A;  3T97 B;  3CCM P;  2ITA A;  2ZFC A;  1BE3 E;  3V4Q A;  1BE3 D;  4KJM A;  2ZHH A;  2M3E A;  4KT0 J;  3H6P A;  2BCC G;  1RE4 A;  1BDC A;  3L35 A;  3VMY A;  2YIU C;  3L71 E;  2ZT9 C;  3BCC E;  3L71 D;  3BCC D;  4DCZ A;  1HWT C;  2ZVO B;  5AW0 B;  2K3R A;  2NZ2 A;  4ZKU A;  3Q5S A;  3U1A A;  5K5G B;  1OVU A;  3L70 E;  1H8A A;  1X22 A;  1BCC E;  3L70 D;  4C7R A;  1BCC D;  3HUS A;  2ZAE B;  5H2F H;  1R8E A;  3EFF K;  1NTK J;  1OZH A;  4I7Z B;  1SVF A;  3EFG A;  1T2K C;  3KPE A;  5CCG C;  2QJK C;  3D6Y A;  2YNY A;  3EQ2 A;  1SS1 A;  5APT A;  3H25 A;  1FJK A;  1PPJ G;  3HTK B;  3AE5 C;  4PD4 H;  1S72 P;  3L36 A;  1VQK P;  3PRJ A;  3CCU P;  2JO1 A;  1VPC A;  1L4A A;  4TLF A;  1RHZ B;  5GQQ A;  4PD4 I;  1JY2 O;  4OGQ B;  2AEF A;  3RL0 C;  2N1T B;  3V2N A;  2KVV A;  1JMM A;  5GTH H;  3E1I A;  1NKZ B;  1LT9 C;  1OW6 A;  1RF1 A;  2B87 B;  3B71 A;  3L71 J;  4W80 A;  1CSB A;  3L74 E;  3L75 G;  1FZC A;  1IFD A;  3L70 J;  1SFC D;  5APU A;  1Q2N A;  1EDI A;  1M7L A;  1NTK K;  1IJD B;  4D6T E;  5TIS E;  1IFI A;  1S5L H;  4L75 A;  4D6T D;  2FFD A;  5CMZ A;  1J1E C;  1RE3 A;  1GTW A;  1BGY E;  1W2E A;  5M1B A;  1BGY D;  3CWB E;  1Q05 A;  3CWB D;  1QGK B;  2ZYG A;  4RES B;  1VQM P;  3AEA C;  1G1I A;  3H1H E;  1VQ9 P;  2P2U A;  1EQ7 A;  3H1H D;  1U57 A;  4AYZ A;  3H1L J;  2BEQ D;  3BAS A;  3L72 J;  1Q81 Q;  3AE9 C;  3KZI E;  5KAI E;  1FBM A;  1YJN P;  1FDI A;  1Q82 Q;  1NTZ J;  2QG4 A;  4GOE A;  1JYH A;  3D71 A;  1FDO A;  1YQ4 C;  2ZYD A;  5I41 B;  3SFD C;  5E79 E;  4JPZ B;  2QVA A;  5C39 A;  1GW3 A;  3CD6 P;  1NAF A;  5CJ0 A;  1LTJ A;  2KXP B;  2R5D A;  1LWU A;  4AQR D;  1JUN A;  5AW3 B;  2ZHG A;  1VL2 A;  1EZV E;  2A06 E;  1EZV D;  3CXH E;  3VYI A;  3CXH D;  2W83 C;  2GA1 A;  2C9N Y;  1OMI A;  1ZOY C;  4NPD A;  1L4A D;  4BRY A;  5AW9 B;  2LXB A;  4JBZ A;  4YTP C;  4C46 A;  3D70 A;  4GOD A;  1SFC C;  2D2C B;  3E0H A;  2Y9Z A;  3B5N B;  1CZQ A;  4H13 B;  2NPS B;  1NKN A;  2Q6Q A;  1Z56 A;  3CWB J;  3RBZ A;  3VN0 A;  1YIJ P;  1Q08 A;  2A45 H;  1YIT P;  2XKM A;  1RE4 C;  2FYZ A;  2IFN A;  4WWI A;  2KB7 P;  3U1C A;  2FYN B;  3CL3 D;  1M1J B;  1NTZ K;  2A45 I;  1HF9 A;  1X9V A;  3CCV P;  3CCS P; 
#chains in the Genus database with same CATH homology
 3Q5R A;  3H25 A;  2FYN C;  2D2C D;  3AE9 C;  3AE2 C;  4H44 D;  1S1C X;  1VF5 C;  5D8C A;  2D2C C;  1DD4 A;  2WSC J;  1IK7 A;  1FDI A;  3D6Z A;  3Q5P A;  4H13 D;  3EZ2 A;  1Q90 D;  1NYH A;  3EZ9 A;  3FGA D;  4J2N A;  1Y9B A;  3GP4 A;  3AE5 C;  1JYH A;  1GMJ A;  3D71 A;  1FDO A;  1YQ4 C;  3GMA A;  1UIX A;  1K04 A;  5I41 B;  3EWK A;  4WLW A;  4TT3 H;  3SFD C;  1OW7 A;  2E76 B;  4WLS A;  2ZT9 B;  2E75 D;  2E74 B;  3GLM A;  3R4Y A;  3QAO A;  3AEG C;  3GPV A;  4R4L A;  4LHF A;  2IDB A;  1BOW A;  1Q06 A;  3Q3D A;  2G3A A;  3R8K A;  2J5U A;  2E75 C;  3AEB C;  1OW8 A;  2JO1 A;  3AE6 C;  3GF3 A;  4PV1 D;  3ABV C;  5KAW A;  2HVA A;  1PIX A;  4AYZ B;  1KTM A;  4GDO A;  5GQQ A;  4I7Z C;  4R24 B;  2WPV B;  3LUR A;  3IN6 A;  1EXJ A;  4OGQ B;  4YXD C;  3UCS A;  2H88 C;  2YMK A;  3AE8 C;  1RQV A;  3RL0 g;  3AEF C;  3O6Q A;  5KAT A;  1Y6U A;  2G8Y A;  3SFE C;  2WSE J;  3T97 B;  2ZHG A;  1S5L X;  3EZF A;  1NGM B;  3IAO A;  3C8V A;  2KVV A;  1VL2 A;  3EZ7 A;  2JML A;  1HJ0 A;  5KAU A;  2ZHH A;  1KMI Z;  2QSI A;  1Q0A A;  1OW6 A;  4KT0 J;  3B71 A;  1PM6 A;  2H89 C;  3Q1M A;  1DIP A;  3AE1 C;  1WMK A;  4U7J A;  3S9O A;  4XFJ A;  1OMI A;  3Q2Y A;  1PV3 A;  4R22 B;  1ZOY C;  3GF7 A;  4Y28 J;  2V7Q J;  1Q09 A;  1MKM A;  2E76 D;  2ZT9 D;  2E74 D;  2YIU C;  3B49 A;  4H0L B;  5L8R J;  1EXI A;  2E76 C;  2ZT9 C;  2E74 C;  2P10 A;  1JB0 J;  4DCZ A;  2QJY C;  3G9R A;  1ZRT E;  4YTP C;  1KOR A;  2WQY C;  2DG6 A;  3D70 A;  4A1M A;  3AEE C;  5E01 A;  1VF5 B;  2O01 J;  1ZP0 C;  2NZ2 A;  5KCB A;  2D2C B;  1DD3 A;  3AED C;  4H44 B;  3E0H A;  3Q5S A;  1D5Y A;  1Q07 A;  4H13 B;  1AJY A;  4B0Y A;  4OGQ C;  1RQU A;  2FBW C;  2JP3 A;  4R4M A;  5I44 A;  1YQ3 C;  4IL6 X;  3AEC C;  5KAX A;  3HH0 A;  2GOV A;  3AE7 C;  2QJP C;  5KAV A;  2VZ4 A;  1Q08 A;  2IEF A;  1TU3 F;  1PL5 A;  3AE3 C;  4H44 C;  1JBG A;  1R8E A;  2BOW A;  2FXP A;  3GK6 A;  2E75 B;  5M1B A;  4H13 C;  1KIL E;  1LX8 A;  3LW5 J;  1Q05 A;  3AE4 C;  4RKU J;  1R8D A;  2BEZ F;  1K05 A;  4I7Z B;  4PV1 B;  1RH6 A;  3EZ6 A;  1ZME C;  4H0L D;  2K9Y A;  2QJK C;  3RK3 E;  1KQF B;  3AEA C;  4OGQ D;  2OG0 A;  3D6Y A;  2QIW A;  4H0L C;  4Z1M H;  2OQQ A;  2KCU A;  1HF9 A;  3R8J A;  1U57 A;  5KKZ C;  4AYZ A;  2WSF J;  5KLI C;  2BEQ D;  5D90 A;  1KQG B;  4R4E A;  2MKV A;  1VF5 D;  4PV1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...