3IAOA

Conformational plasticity of the coiled coil domain of bmrr is required for bmr promoter binding-the unliganded structure of bmrr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
273
Chain Sequence
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTSSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Conformational plasticity of the coiled-coil domain of BmrR is required for bmr operator binding: the structure of unliganded BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 73
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3iaoA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3iaoA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3iaoA03
5KAWA 2ZHHA 1BOWA 4WLSA 4AYZA 4R24B 3G9RA 4J2NA 1Q06A 2BOWA 3R8JA 3Q3DA 1DIPA 5KCBA 1Q09A 5GQQA 2DG6A 5D90A 4R4LA 1R8DA 1Q08A 3Q5PA 1JBGA 2J5UA 3Q5RA 5KAUA 2ZHGA 2GOVA 1EXIA 3Q1MA 2VZ4A 3Q5SA 4R22B 5KATA 3LURA 3D71A 2OQQA 4R4EA 3T97B 5I44A 3R8KA 4WLWA 4B0YA 3E0HA 1Q07A 3B49A 2HVAA 3D6YA 3D70A 4A1MA 3GPVA 5D8CA 3QAOA 3GP4A 5E01A 1EXJA 4R4MA 3D6ZA 5KAVA 3UCSA 3GK6A 5I41B 1Q0AA 3Q2YA 3IAOA 2JMLA 2KCUA 1Q05A 4AYZB 1D5YA 1R8EA 1JYHA 3HH0A 5KAXA
chains in the Genus database with same CATH superfamily
1SFCB 3HRNA 2J58A 4U3FG 3H25A 2QVAA 3R2PA 1FZCB 1S1CX 2YXRB 3VTPC 1SFCD 1L0LK 3E0HA 3A0BE 1NTKG 2IBZI 4WVZA 1PP9J 5DJTB 3B5NA 5EFWB 1KYOD 2QJKB 3HD7B 3N7NA 1JY3P 1X8YA 1IFNA 2ZYGA 5KLVJ 3BRVB 2W6JH 2JJLA 2AEJA 1UIIA 1VF5B 2QJYC 3HD7D 3LURA 1EDLA 2GUSA 3HE4B 3VP8A 1VF5D 2BEZF 3A0BH 1LNQA 2WPRA 5AW7B 4I7ZB 3VYIA 5APTA 1EDIA 2Q1KA 3CC4P 5APXA 1JY3O 2K9JA 1U7JA 1NTKE 3BCCD 3TSIA 1S72P 2HFED 1NU1D 2LR2A 3VMAA 2WSEH 1N7LA 2BCCJ 2C9LY 1SQXD 4OWFA 4U3FJ 1ZRTE 3H1HD 2IZ1A 4HYTB 3BVHA 3L70D 3S1KA 1NVOA 1SQBG 1L4AA 1NHLA 1VPCA 4HKZH 3LIDA 3H1LD 1FC2C 3EFFK 4L75A 1Q0AA 1PL5A 1U57A 3I55P 3CCVP 2P1JA 4GOFA 4YPCA 2WSCJ 1Q08A 2M8RA 4UB8E 3MIWA 3V2PA 5CBNA 1T2KD 3CXHD 2KUBA 1BE3D 5B66E 1EZVG 2Y0DA 5KJ7D 3TNUA 5AW1B 3TGUE 4IFMA 4BRYA 5KKZC 5KTBA 5AW8B 2I1JA 1AJYA 1G1IA 4XFJA 4WLWA 1N8RQ 2KZIA 1LJ2A 1VQNP 3CCSP 2WT7A 1YJNP 3RK3E 1SLQA 1BOWA 5B66H 3BRTB 2ZXXA 3FWLA 3H1KD 1IO4A 3CPWO 1SQBJ 2AEMA 2ZYAA 5BVZA 2ZXEB 3M06A 1FBMA 2SPZA 2BEQD 3AE6C 1R5LA 1OW6A 1IK9A 1EZVE 4NPDA 3AE7C 1JYHA 3NMDA 3PTZA 1VQ7P 1HF9A 2W8ZA 1IC2A 3C8VA 3WMM0 1JM0A 1SS1A 1K9MQ 1GK4A 1KD1Q 5APSA 1K73Q 1R8EA 2FYNB 2P67A 5AW9B 3Q3DA 1L0NE 2OTLP 2XZRA 1OWAA 1AA0A 3L73E 5KLVK 1NKZB 2L5GB 1VDFA 5AVZB 1NH4A 2C9NY 1OW8A 3B5NC 1EDKA 5CMZA 3P7KA 3F89A 3MHVA 4OVNF 3SWYA 3OJAB 4GKGA 1T6AA 4DCZA 1YJWP 4JYCA 3AEEC 2R3SA 1IK7A 3AE9C 1TU3F 1LTGC 1JO5A 1JOCA 3AEDC 2PP6A 3L36A 3MTUE 3QH9A 2NPSB 2IBZD 2QJPC 2OTJP 2B87B 1NOHA 4AYZB 3LW5H 3H32A 3BASA 1NTZG 2NPSD 2YKQA 2K3RA 3H1ID 3L74G 1RE4A 3FXDA 1JY2P 3IR9A 1VL2A 1KORA 5TISE 2P10A 3L72E 1JTHB 3BCCJ 1FAVA 3IAOA 1NU1J 3II6A 1OIPA 1URQA 5KAXA 4YXWH 3TF5A 1YQ4C 3GG2A 3CD6P 1L4AC 4U7JA 3Q1MA 4DT0A 1JCCA 1RHZB 3AECC 2UWJE 5TISH 4ZMDA 3W67A 3A3YB 3G3ZA 3M0DA 4C7NB 3AEFC 2YNYA 1SFCA 3L74E 1JCDA 2GA1A 3FX0A 1FZCA 4R22B 2LXBA 4A7PA 1PGQA 3AEGC 2M3BA 2FYUG 4EDFA 2H43A 1ZLLA 5I41B 3VP9A 1QVGO 1BE3J 3CL3D 3EZ7A 3O8ZA 1PV3A 1NTZJ 2KSEA 3L35A 4GOEA 1SQBK 2B9BA 1OZHA 1JMMA 4L73A 2FFDB 1NTMG 3HE4A 4C7RA 4JQ0D 1PP9D 2A06D 2YMYA 4EI2A 1KB9E 1R8DA 2E74C 2ITAA 3H1KJ 4M3LA 1PM6A 4ZKUA 1IZNB 1KQFB 5AW2B 1HUCA 1M7LA 4IL6X 5DJUB 1K05A 2IFMA 3EQ2A 3HUSB 1Q82Q 2JP3A 1DD4A 1UIXA 1KB9H 2N1TA 4YXDC 1LT1A 1S9KE 5AVUB 2FYUJ 1NTME 2KOGA 1QGKB 2D2CB 1W2BO 1HGZA 3HE5B 3TK1A 3RBZA 1SQVG 5CCHD 2K88A 4U3FD 2D2CD 1KQSO 1GZLA 5AVTB 4I1LA 1HWTC 5CCGA 3RBXA 4PV1C 1NTKD 3CX5E 5CBOA 3SFEC 3GP4A 1YQ3C 1K04A 2E76B 3A0HE 1J1DB 3UIAA 2FXMA 5APUA 3K5BA 3E1IA 1T3UA 2E76D 3A5TA 2W90A 2WSFJ 3AE2C 4ZNCA 1LX8A 1GL2B 2HLOA 3CLQA 3CX5H 2OYIB 5AW5B 1NU1K 3HH0A 1RE4C 1SQXK 2ZFCA 2AXTE 3V2RA 2FYZA 3H1IJ 1BSHA 2ZVOB 1VQ6P 4ZKPA 2WQYC 4AUWA 1BGYG 1URQC 2W27A 1IFJA 1ZMEC 2YIUB 1SQVJ 5KAWA 1FOSF 2V7QH 1SQBD 2AXTH 3B4SA 1LT9B 3QWOC 1M90Q 3RK3B 3M0DC 4H0LD 2RN0A 2POHA 2JO1A 3USSA 1SFCC 2Q6QA 3RK3D 3MP7B 1NTZK 3AEAC 1S5LE 1KC8Q 1FZCC 2HODB 2FKWB 3G71P 5AVXB 1IJDB 4PD4E 1SQQG 1EC5A 4H44C 2YO2A 4D6TE 2FXOA 1BGYE 3V5BA 3CC7P 5AVSB 3ZDMA 4KHXA 4N78D 1EZVD 1Y8AA 2QJKC 3HD7C 1KILB 1JY2N 1DEBA 3KXDA 1PGOA 1KILD 1S5LH 2M0BA 2WWWA 3JSVC 3IF4A 1W5CE 1X79B 3L75G 4I7ZC 2B87A 2JKVA 1H0TB 4GIFA 1Q06A 1LP1B 4H13C 1IFMA 1L2PA 1SQQE 3B71A 2WMMA 2KB7P 5APQA 2IDBA 4C46A 1YTZT 4B86A 1JTHA 1PGJA 1NYHA 2Y9YA 2N1TC 3EZ6A 2Q3IA 4AYCA 1FS0E 2YO3A 3G4SP 4DJGA 4RKUJ 3I56P 2Q9IA 2WSEJ 3L75E 2BCCE 2O1KA 2GUVA 3MD0A 4JF7A 1H88A 2VRSA 1SQPG 3TGUG 5CCGC 4XE5B 3GW6A 1DH3A 2Q7CA 1LWUB 1NTKJ 5E01A 3CCMP 3D6ZA 3VN0A 2KVVA 2A45G 4RO0A 5KCBA 2Z5IA 3I5CA 1RQVA 5KAUA 1NJIQ 2LXCB 1CW5A 2P7JA 3RK2B 5E79E 1VQ8P 1H8AA 2FFDA 2ZT9C 3GF3A 1SQVK 3RK2D 1NTZD 1SQPE 3U59A 2M5AB 5BU8B 3Q5PA 3TYYA 1RF1B 3RGUA 3C9IA 2W83C 1OVRA 3MZWB 3Q5SA 3JCUE 2PGDA 1BDCA 3P32A 5BU5A 4UB8H 5APYA 1YYCA 1JB0J 1N73B 1P84E 4WBAA 3HUSA 1MV8A 4WLSA 3TGUJ 4HH2A 3W68A 1M1JB 1VQ9P 1N7SB 1CI6B 1L0NG 2E43A 2JR8A 1YI2P 3L73G 3EWKA 3JCUH 1N7SD 4I2LC 2B89A 3GMAA 3HE5A 3CWBG 1GMJA 3WUUA 1KB9D 3CCEP 1P84H 2A45H 4LC1A 1NO4A 1X9VA 2FYUD 4WY4B 1Q07A 4Z1MH 4MN4C 1NAYA 2Q3EA 2RKLA 4WY4D 1G2CB 4BWNA 3M0AA 2ZHHA 1RY3A 1JBGA 2GOVA 2AXCA 1LTSC 1H89A 3D71A 3H1JG 3AE3C 1NTMD 3PRJA 1GU5A 3GPVA 1GL2A 2P58A 3L72G 1KYOE 2O01H 2WVRA 1HJBA 3CWBE 4RJTA 2IZ0A 2OYIA 3V4WA 1FJKA 1QX8A 3R8JA 2WTYA 5GQQA 1L0NJ 1M56D 3L73J 1Q81Q 1PGPA 3NTNA 3H1LG 1VQ4P 1SVFA 2WZ7A 3LW5J 1KYOH 3KYQA 3Q5RA 3RL0B 2VZ4A 3L4FA 3H1JE 1LT9A 2K9YA 1NTKK 1FZAA 4OGQC 3RL0D 1NU1E 2JMLA 1SQXE 1SQVD 1P84I 1A02J 2A45I 1QVFO 3H1HE 2E5TA 3L70E 5AVQB 3SWFA 2HODA 1LTJB 1IFIA 3FWNA 3H1LE 1JY2O 1PPJG 3GHGB 2PFXA 1KQGB 1OVUA 1EZVI 2K37A 1KILA 2NZ2A 1OMIA 2ZHGA 3L71G 2PAJA 1KFNA 1G1JA 2HR3A 2FFDC 1QEXA 1L0LG 3IN6A 1ZV8A 3TDKA 2W6BA 3CXHE 2QA4P 3PHLA 2B88A 1J1EB 4R24B 1QL2A 1H0TA 3HD7A 3L74J 1LP1A 1AQ5A 1MUUA 3B8EB 4GDOA 1OFCX 3B49A 1BGYD 1PPJE 1PFIA 1Y47A 3HUSC 1AVOA 5C39A 1YHQP 3H1KE 2R5DA 3L71E 3CI9A 2DW3A 1RE3A 1L0LE 2JEEA 3V2NA 1LTAC 2D2CC 3O6QB 2QIWA 2QG4A 3TNUB 4Y99C 5APVA 3WUVA 4BRYB 1K8AQ 1OXZA 2BOWA 1DEEG 1RF0A 4HB1A 2YXQB 1SQQD 1MZ9A 3CC2P 4TT3H 1GK6A 4KJMA 2QSIA 1LWUA 4TLFA 4QMAA 2E76C 3EZFA 1J1DC 5AVYB 3MUDA 2IPPA 3FXEA 2C0WA 4R4LA 2XKMA 1L0NK 2YKPA 1GL2C 2QE7H 5KJ7A 1NTMJ 2OYIC 3L75D 1RH6A 4DCKA 4RESB 1BCCG 2Z5HA 1FZGA 3BATA 1ZRTD 2M5AA 2J5UA 1RF1A 3PLNA 2OGUA 2ZVNB 1Z56A 4EIJA 1VQOP 5AW3B 2YIUC 3HTKB 2FBWC 1N73A 3C1LA 1FDMA 3EZ9A 3AE1C 2IFNA 3H1IE 3A0HH 5AW6B 1M1JA 2OYHB 1LT9C 1N7SA 4LGDE 1Y6UA 4ASWA 1ZP0C 4D6TG 3V4QA 1OX3A 2KP8A 1BCCE 2V7QJ 3NFQA 2ZYDA 1SQPD 4PV1D 2GM4A 3TGUD 1KB9I 2IX7C 1PZQA 1J2JB 4H0LB 3CCLP 1N86A 2BASA 1MKMA 3KQGA 1HTLC 4WY4A 5D8CA 1HVVA 1KILC 3H32B 3V6IA 3UCSA 4NPFX 1P84D 1YIJP 4BXLA 3RL0g 2Z4EA 2KI7B 5KLVG 2WPSA 3M9QA 1FDOA 1KV4A 1N2DC 3A2AA 5CHXA 2E75B 3H6PA 1WT6A 1WMKA 1D7MA 1GD2E 2R32A 2E75D 4K35A 1VF5C 4PJ0E 4R4EA 4PD4H 5KLIB 1YJ9P 1BGYJ 1PP9E 2KNCB 3CX5I 2NPSA 2BCCG 1HGVA 2WITA 4AYZA 1XTCC 1RE3C 5KLVE 1L0ND 1USDA 3L73D 5KAFE 5AVRB 2RMZA 1AQTA 1RQUA 4H44B 1M1KQ 3N4XA 1DD3A 2FYUK 4PJ0H 2KYVA 4KT0J 1FOSE 3CWBD 1RF0C 3ITKA 4H44D 4IFFA 1IFPA 1QLED 2RH0A 4W7ZA 3S9OA 1GTWA 1KTMA 1SQQJ 1LWUC 1LTJA 1HJ0A 5KAFH 1NTMK 3MUDC 2MKVA 1PIXA 2XNXA 3GHGA 2H7HA 3A7OA 4U3FE 2W6AA 4C7NA 1T2KC 5D90A 4W7YA 4LHFA 4H13B 2WPQA 1HH0A 2H8PD 5KJ7C 3RK2C 1LTBC 3H1JD 3ABVC 3T97B 2QJYB 3L72D 4H13D 5CJ0A 1FDIA 2JWAA 2O01N 4K3AA 3L75J 3JC22 3S4RA 4UB6E 2HPCB 2N1TB 3E7KA 1CZQA 1RF1C 3KPEA 1S5LX 2QM7A 2QRXA 1W2EA 4PD4I 1KMIZ 3VMYA 3NXSA 3M9BA 2N1TD 1N73C 4WB4A 2KS1B 2P2UA 1FZEA 3FGAD 4CPGA 3Q2YA 2FXPA 1M1JC 1GW4A 3AE4C 1N7SC 1ZR4A 1KFMA 3L74D 4UB6H 2WSCH 1Q2NA 1RH5B 2O1JA 5M1BA 5KATA 1X22A 2JDIH 2IEFA 5CCGD 3O6QA 2XDJA 2CPBA 1SP4A 2H89C 5E79H 1FZBA 4HJGH 2OYOA 1ZN5A 1S4XA 1SQPJ 1YTZI 1SQBE 1HBWA 4EYYQ 2ZAEB 1VQPP 4WY4C 4JPZB 3CMEP 1S3JA 4WWIA 1PPJD 4A1MA 3U1CA 5KAIE 5CCHA 2ZT9B 2FYNC 3KHUA 2O3JA 4AQRD 2XNDH 1A02F 3L71D 2ZT9D 1ZR2A 5KKZB 3VMXA 5H2FE 3OA7A 1L0LD 2OQQA 1NKNA 1XTGB 3P8CE 1MFTA 4N78E 2XU6A 1T8ZA 5KAIH 1LGHB 2N9BA 2Q5UA 2K1AA 1QL1A 1KILE 4EOTA 1S9KD 2IYPA 2NPSC 5H2FH 1AFOA 2O01J 1FE6A 3BCCG 4N6JA 2HYNA 1R5SA 1NU1G 1BSNA 3HTKA 4JBZA 1SQXG 1OVVA 4J2NA 3EZ2A 5B5EE 3RL0C 2Y0CA 3H1HG 2CPSA 3L70G 1M8OB 1SQQK 2OYHA 2Y9ZA 3R8KA 2NRGA 2I1KA 1KQLA 2JWDA 3CX5D 4R4MA 2G3AA 5KAVA 3CWBJ 1DIPA 3E1RA 3V2QA 4L74A 1LTJC 4IL6E 5B5EH 1U7MA 1LTTC 1NAFA 3GHGC 3B5NB 3BCCE 1Q7YQ 1BE3G 3MGNA 2OARA 1KN7A 3B5ND 2OTKE 2KK7A 3GF7A 4YTPC 1X0TA 1GW3A 1ZOYC 3H1JJ 4IL6H 5TJHA 3AE5C 3L72J 1J1EC 1ZW0A 2QJPB 1WRGA 1BCCD 1SQXJ 1OW7A 3VOPA 2DG6A 2K9JB 3H1HJ 3L70J 3H1KG 1IFDA 2XV5A 3WU2E 2V4HA 1JY3N 2QEXP 4L76A 3H1LJ 1BE3E 2KNCA 1BDDA 4OGQB 2R44A 3L37A 1NTZE 1FZFA 1YITP 1SQPK 4DZOA 2HG5D 1L4AB 1CSBA 4OGQD 3CCRP 4PD4D 2N9YB 4JYBA 1DX7A 2J59M 4D6TD 3D6YA 3WU2H 2IYOA 3U1AA 1L4AD 1KYOI 3CXHH 3PH0A 4LLHA 1VQMP 2H88C 4DOJA 1Q09A 3OAKA 5GTIE 3AE8C 2QM8A 3AEBC 2YMKA 2G8YA 2R3CA 5CCHC 4Y28J 2WPVB 2E5YA 2KSJA 4XA4A 3EFGA 5KLVD 2LKMA 1NWQA 2KLVA 1VQLP 4N3YB 1E79H 3L71J 1VQ5P 5GTIH 2FYUE 5I44A 1L0LJ 3T97A 5CJ4A 1Q86Q 2IBZG 3LIEA 3P8MC 2WT7B 3CCUP 3CMAP 1NGMB 2OG0A 1VQKP 1Q90D 2HPCA 3H1IG 2E74B 1E5WA 1GDTA 1JMBA 1AVYA 1Y9BA 2KXPB 1FU1A 1EXJA 5AW4B 3CCQP 2E74D 4Y99B 2KS1A 2BCCD 4OH8B 3CCJP 1D5YA 2MJZA 3KDPB 4I6MC 2C0XA 3PP5A 2OYHC 3M9HA 1S2EA 5AW0B 1EXIA 5AVVB 1MFZA 3SFDC 2IBZE 2Y0EA 4O9BA 3CXHI 4NPEA 3GK6A 3KZIE 3SSUA 2PRRA 4H0LC 1CI6A 2WSFH 3RK3C 1ZXGA 3M91A 1AV1A 3VMZA 2R5BA 2YKOA 4PV1B 2KIKA 4GODA 2CK3H 3QAOA 2ZJSE 2KCUA 1SQVE 1GL2D 5GTHE 4GT1A 5K5GB 1JEKA 1T3JA 3WUTA 3KZIH 3G9RA 4IOIH 3IFMA 1YBKA 5APWA 3GLMA 1USEA 1EDJA 3PJSK 2KLUA 4B0YA 2M3EA 2E75C 1PP9G 2A06G 1Q05A 1JUNA 2I8DA 1BCCJ 1JNMA 3G6EP 1FJPA 5GTHH 1G2CA 1EQ7A 4ASVA 1LTIC 2KZJA 1GU4A 5KLIC 1KZUB 3D70A 5AVWB 2AEFA 1URQB 3F5HA 2WSSH 2FY8A 5L8RJ 4W80A 4IFDK 2L91A 3SWKA 1M57D 1URQD 3R4YA 2E42A 2HVAA 4D6TJ 3P8CD 2A06E 3OW2O
chains in the Genus database with same CATH topology
1GMJA 4H44D 4PV1D 2H88C 2BOWA 3AEAC 3Q3DA 2WSCJ 1DIPA 1Q09A 2D2CD 4H0LC 3H25A 3S9OA 1Q08A 3AE8C 1KTMA 4H0LB 1S1CX 3AEBC 2YMKA 4R22B 2G8YA 3AEGC 1OW8A 1HJ0A 4H44C 4PV1C 4TT3H 4Y28J 3E0HA 1Q07A 2QSIA 1MKMA 4Z1MH 4A1MA 4PV1B 5D8CA 2WPVB 2MKVA 1PIXA 2E76C 3SFEC 3QAOA 3GP4A 5E01A 1YQ3C 3D6ZA 1K04A 3UCSA 1KQGB 2QJKC 3EZFA 5I41B 2E76B 2KVVA 2ZT9B 2KCUA 2FYNC 3EZ7A 4DCZA 1PV3A 2ZHHA 3RL0g 5KAUA 3G9RA 3AEEC 5KCBA 5D90A 3GF7A 4R4LA 5KKZC 1JBGA 4LHFA 1RQVA 2NZ2A 1IK7A 1OMIA 2ZHGA 2E76D 2WSFJ 2ZT9D 3AE9C 1TU3F 3AE2C 3GLMA 1AJYA 2GOVA 1VF5B 1ZOYC 2QJYC 3LURA 3D71A 1FDOA 2OQQA 3ABVC 3AEDC 4XFJA 5I44A 3T97B 1LX8A 3AE3C 4WLWA 3IN6A 4B0YA 4H13B 3GPVA 2E75C 3AE5C 4H13D 2ZT9C 1FDIA 2QJPC 2E75B 3GF3A 1RH6A 1VF5D 2BEZF 1NGMB 1Q05A 2OG0A 4I7ZC 4AYZB 3HH0A 1WMKA 3RK3E 4I7ZB 1OW7A 1BOWA 4R24B 1Q06A 3R8JA 1Q90D 5GQQA 2DG6A 4H13C 1R8DA 2E74C 3Q5PA 2J5UA 2E75D 1KILE 1S5LX 1VF5C 1PM6A 2E74B 3B71A 3Q5SA 1KQFB 1VL2A 1KMIZ 1KORA 5KLIC 4R4EA 2P10A 4GDOA 3B49A 2IDBA 2BEQD 1Y9BA 4IL6X 2WQYC 3D70A 3AE6C 2O01J 1K05A 1EXJA 1OW6A 3LW5J 2E74D 1ZMEC 1JB0J 2YIUC 3FGAD 3Q2YA 3IAOA 2FBWC 4OGQB 2FXPA 1D5YA 3AE7C 5L8RJ 1JYHA 5KAXA 1NYHA 5KAWA 3AE4C 2JP3A 1DD4A 4WLSA 4AYZA 3EZ9A 4J2NA 1YQ4C 1HF9A 1UIXA 3EZ6A 3AE1C 1ZRTE 3EZ2A 3Q5RA 4U7JA 4OGQD 4YXDC 1EXIA 3Q1MA 2VZ4A 5M1BA 1Y6UA 3R4YA 5KATA 3C8VA 3EWKA 3R8KA 3SFDC 2IEFA 1RQUA 4H44B 1ZP0C 2D2CC 1DD3A 3D6YA 2HVAA 2K9YA 2QIWA 3AECC 4KT0J 4RKUJ 3O6QA 2D2CB 4H0LD 2H89C 2WSEJ 4R4MA 4OGQC 2G3AA 3GK6A 5KAVA 1Q0AA 2JMLA 2JO1A 3GMAA 1PL5A 4YTPC 1U57A 1R8EA 2V7QJ 3AEFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAW A;  2ZHH A;  1BOW A;  4WLS A;  4AYZ A;  4R24 B;  3G9R A;  4J2N A;  1Q06 A;  2BOW A;  3R8J A;  3Q3D A;  1DIP A;  5KCB A;  1Q09 A;  5GQQ A;  2DG6 A;  5D90 A;  4R4L A;  1R8D A;  1Q08 A;  3Q5P A;  1JBG A;  2J5U A;  3Q5R A;  5KAU A;  2ZHG A;  2GOV A;  1EXI A;  3Q1M A;  2VZ4 A;  3Q5S A;  4R22 B;  5KAT A;  3LUR A;  3D71 A;  2OQQ A;  4R4E A;  3T97 B;  5I44 A;  3R8K A;  4WLW A;  4B0Y A;  3E0H A;  1Q07 A;  3B49 A;  2HVA A;  3D6Y A;  3D70 A;  4A1M A;  3GPV A;  5D8C A;  3QAO A;  3GP4 A;  5E01 A;  1EXJ A;  4R4M A;  3D6Z A;  5KAV A;  3UCS A;  3GK6 A;  5I41 B;  1Q0A A;  3Q2Y A;  3IAO A;  2JML A;  2KCU A;  1Q05 A;  4AYZ B;  1D5Y A;  1R8E A;  1JYH A;  3HH0 A;  5KAX A; 
#chains in the Genus database with same CATH topology
 1SFC B;  3HRN A;  2J58 A;  4U3F G;  3H25 A;  2QVA A;  3R2P A;  1FZC B;  1S1C X;  2YXR B;  3VTP C;  1SFC D;  1L0L K;  3E0H A;  3A0B E;  1NTK G;  2IBZ I;  4WVZ A;  1PP9 J;  5DJT B;  3B5N A;  5EFW B;  1KYO D;  2QJK B;  3HD7 B;  3N7N A;  1JY3 P;  1X8Y A;  1IFN A;  2ZYG A;  5KLV J;  3BRV B;  2W6J H;  2JJL A;  2AEJ A;  1UII A;  1VF5 B;  2QJY C;  3HD7 D;  3LUR A;  1EDL A;  2GUS A;  3HE4 B;  3VP8 A;  1VF5 D;  2BEZ F;  3A0B H;  1LNQ A;  2WPR A;  5AW7 B;  4I7Z B;  3VYI A;  5APT A;  1EDI A;  2Q1K A;  3CC4 P;  5APX A;  1JY3 O;  2K9J A;  1U7J A;  1NTK E;  3BCC D;  3TSI A;  1S72 P;  2HFE D;  1NU1 D;  2LR2 A;  3VMA A;  2WSE H;  1N7L A;  2BCC J;  2C9L Y;  1SQX D;  4OWF A;  4U3F J;  1ZRT E;  3H1H D;  2IZ1 A;  4HYT B;  3BVH A;  3L70 D;  3S1K A;  1NVO A;  1SQB G;  1L4A A;  1NHL A;  1VPC A;  4HKZ H;  3LID A;  3H1L D;  1FC2 C;  3EFF K;  4L75 A;  1Q0A A;  1PL5 A;  1U57 A;  3I55 P;  3CCV P;  2P1J A;  4GOF A;  4YPC A;  2WSC J;  1Q08 A;  2M8R A;  4UB8 E;  3MIW A;  3V2P A;  5CBN A;  1T2K D;  3CXH D;  2KUB A;  1BE3 D;  5B66 E;  1EZV G;  2Y0D A;  5KJ7 D;  3TNU A;  5AW1 B;  3TGU E;  4IFM A;  4BRY A;  5KKZ C;  5KTB A;  5AW8 B;  2I1J A;  1AJY A;  1G1I A;  4XFJ A;  4WLW A;  1N8R Q;  2KZI A;  1LJ2 A;  1VQN P;  3CCS P;  2WT7 A;  1YJN P;  3RK3 E;  1SLQ A;  1BOW A;  5B66 H;  3BRT B;  2ZXX A;  3FWL A;  3H1K D;  1IO4 A;  3CPW O;  1SQB J;  2AEM A;  2ZYA A;  5BVZ A;  2ZXE B;  3M06 A;  1FBM A;  2SPZ A;  2BEQ D;  3AE6 C;  1R5L A;  1OW6 A;  1IK9 A;  1EZV E;  4NPD A;  3AE7 C;  1JYH A;  3NMD A;  3PTZ A;  1VQ7 P;  1HF9 A;  2W8Z A;  1IC2 A;  3C8V A;  3WMM 0;  1JM0 A;  1SS1 A;  1K9M Q;  1GK4 A;  1KD1 Q;  5APS A;  1K73 Q;  1R8E A;  2FYN B;  2P67 A;  5AW9 B;  3Q3D A;  1L0N E;  2OTL P;  2XZR A;  1OWA A;  1AA0 A;  3L73 E;  5KLV K;  1NKZ B;  2L5G B;  1VDF A;  5AVZ B;  1NH4 A;  2C9N Y;  1OW8 A;  3B5N C;  1EDK A;  5CMZ A;  3P7K A;  3F89 A;  3MHV A;  4OVN F;  3SWY A;  3OJA B;  4GKG A;  1T6A A;  4DCZ A;  1YJW P;  4JYC A;  3AEE C;  2R3S A;  1IK7 A;  3AE9 C;  1TU3 F;  1LTG C;  1JO5 A;  1JOC A;  3AED C;  2PP6 A;  3L36 A;  3MTU E;  3QH9 A;  2NPS B;  2IBZ D;  2QJP C;  2OTJ P;  2B87 B;  1NOH A;  4AYZ B;  3LW5 H;  3H32 A;  3BAS A;  1NTZ G;  2NPS D;  2YKQ A;  2K3R A;  3H1I D;  3L74 G;  1RE4 A;  3FXD A;  1JY2 P;  3IR9 A;  1VL2 A;  1KOR A;  5TIS E;  2P10 A;  3L72 E;  1JTH B;  3BCC J;  1FAV A;  3IAO A;  1NU1 J;  3II6 A;  1OIP A;  1URQ A;  5KAX A;  4YXW H;  3TF5 A;  1YQ4 C;  3GG2 A;  3CD6 P;  1L4A C;  4U7J A;  3Q1M A;  4DT0 A;  1JCC A;  1RHZ B;  3AEC C;  2UWJ E;  5TIS H;  4ZMD A;  3W67 A;  3A3Y B;  3G3Z A;  3M0D A;  4C7N B;  3AEF C;  2YNY A;  1SFC A;  3L74 E;  1JCD A;  2GA1 A;  3FX0 A;  1FZC A;  4R22 B;  2LXB A;  4A7P A;  1PGQ A;  3AEG C;  2M3B A;  2FYU G;  4EDF A;  2H43 A;  1ZLL A;  5I41 B;  3VP9 A;  1QVG O;  1BE3 J;  3CL3 D;  3EZ7 A;  3O8Z A;  1PV3 A;  1NTZ J;  2KSE A;  3L35 A;  4GOE A;  1SQB K;  2B9B A;  1OZH A;  1JMM A;  4L73 A;  2FFD B;  1NTM G;  3HE4 A;  4C7R A;  4JQ0 D;  1PP9 D;  2A06 D;  2YMY A;  4EI2 A;  1KB9 E;  1R8D A;  2E74 C;  2ITA A;  3H1K J;  4M3L A;  1PM6 A;  4ZKU A;  1IZN B;  1KQF B;  5AW2 B;  1HUC A;  1M7L A;  4IL6 X;  5DJU B;  1K05 A;  2IFM A;  3EQ2 A;  3HUS B;  1Q82 Q;  2JP3 A;  1DD4 A;  1UIX A;  1KB9 H;  2N1T A;  4YXD C;  1LT1 A;  1S9K E;  5AVU B;  2FYU J;  1NTM E;  2KOG A;  1QGK B;  2D2C B;  1W2B O;  1HGZ A;  3HE5 B;  3TK1 A;  3RBZ A;  1SQV G;  5CCH D;  2K88 A;  4U3F D;  2D2C D;  1KQS O;  1GZL A;  5AVT B;  4I1L A;  1HWT C;  5CCG A;  3RBX A;  4PV1 C;  1NTK D;  3CX5 E;  5CBO A;  3SFE C;  3GP4 A;  1YQ3 C;  1K04 A;  2E76 B;  3A0H E;  1J1D B;  3UIA A;  2FXM A;  5APU A;  3K5B A;  3E1I A;  1T3U A;  2E76 D;  3A5T A;  2W90 A;  2WSF J;  3AE2 C;  4ZNC A;  1LX8 A;  1GL2 B;  2HLO A;  3CLQ A;  3CX5 H;  2OYI B;  5AW5 B;  1NU1 K;  3HH0 A;  1RE4 C;  1SQX K;  2ZFC A;  2AXT E;  3V2R A;  2FYZ A;  3H1I J;  1BSH A;  2ZVO B;  1VQ6 P;  4ZKP A;  2WQY C;  4AUW A;  1BGY G;  1URQ C;  2W27 A;  1IFJ A;  1ZME C;  2YIU B;  1SQV J;  5KAW A;  1FOS F;  2V7Q H;  1SQB D;  2AXT H;  3B4S A;  1LT9 B;  3QWO C;  1M90 Q;  3RK3 B;  3M0D C;  4H0L D;  2RN0 A;  2POH A;  2JO1 A;  3USS A;  1SFC C;  2Q6Q A;  3RK3 D;  3MP7 B;  1NTZ K;  3AEA C;  1S5L E;  1KC8 Q;  1FZC C;  2HOD B;  2FKW B;  3G71 P;  5AVX B;  1IJD B;  4PD4 E;  1SQQ G;  1EC5 A;  4H44 C;  2YO2 A;  4D6T E;  2FXO A;  1BGY E;  3V5B A;  3CC7 P;  5AVS B;  3ZDM A;  4KHX A;  4N78 D;  1EZV D;  1Y8A A;  2QJK C;  3HD7 C;  1KIL B;  1JY2 N;  1DEB A;  3KXD A;  1PGO A;  1KIL D;  1S5L H;  2M0B A;  2WWW A;  3JSV C;  3IF4 A;  1W5C E;  1X79 B;  3L75 G;  4I7Z C;  2B87 A;  2JKV A;  1H0T B;  4GIF A;  1Q06 A;  1LP1 B;  4H13 C;  1IFM A;  1L2P A;  1SQQ E;  3B71 A;  2WMM A;  2KB7 P;  5APQ A;  2IDB A;  4C46 A;  1YTZ T;  4B86 A;  1JTH A;  1PGJ A;  1NYH A;  2Y9Y A;  2N1T C;  3EZ6 A;  2Q3I A;  4AYC A;  1FS0 E;  2YO3 A;  3G4S P;  4DJG A;  4RKU J;  3I56 P;  2Q9I A;  2WSE J;  3L75 E;  2BCC E;  2O1K A;  2GUV A;  3MD0 A;  4JF7 A;  1H88 A;  2VRS A;  1SQP G;  3TGU G;  5CCG C;  4XE5 B;  3GW6 A;  1DH3 A;  2Q7C A;  1LWU B;  1NTK J;  5E01 A;  3CCM P;  3D6Z A;  3VN0 A;  2KVV A;  2A45 G;  4RO0 A;  5KCB A;  2Z5I A;  3I5C A;  1RQV A;  5KAU A;  1NJI Q;  2LXC B;  1CW5 A;  2P7J A;  3RK2 B;  5E79 E;  1VQ8 P;  1H8A A;  2FFD A;  2ZT9 C;  3GF3 A;  1SQV K;  3RK2 D;  1NTZ D;  1SQP E;  3U59 A;  2M5A B;  5BU8 B;  3Q5P A;  3TYY A;  1RF1 B;  3RGU A;  3C9I A;  2W83 C;  1OVR A;  3MZW B;  3Q5S A;  3JCU E;  2PGD A;  1BDC A;  3P32 A;  5BU5 A;  4UB8 H;  5APY A;  1YYC A;  1JB0 J;  1N73 B;  1P84 E;  4WBA A;  3HUS A;  1MV8 A;  4WLS A;  3TGU J;  4HH2 A;  3W68 A;  1M1J B;  1VQ9 P;  1N7S B;  1CI6 B;  1L0N G;  2E43 A;  2JR8 A;  1YI2 P;  3L73 G;  3EWK A;  3JCU H;  1N7S D;  4I2L C;  2B89 A;  3GMA A;  3HE5 A;  3CWB G;  1GMJ A;  3WUU A;  1KB9 D;  3CCE P;  1P84 H;  2A45 H;  4LC1 A;  1NO4 A;  1X9V A;  2FYU D;  4WY4 B;  1Q07 A;  4Z1M H;  4MN4 C;  1NAY A;  2Q3E A;  2RKL A;  4WY4 D;  1G2C B;  4BWN A;  3M0A A;  2ZHH A;  1RY3 A;  1JBG A;  2GOV A;  2AXC A;  1LTS C;  1H89 A;  3D71 A;  3H1J G;  3AE3 C;  1NTM D;  3PRJ A;  1GU5 A;  3GPV A;  1GL2 A;  2P58 A;  3L72 G;  1KYO E;  2O01 H;  2WVR A;  1HJB A;  3CWB E;  4RJT A;  2IZ0 A;  2OYI A;  3V4W A;  1FJK A;  1QX8 A;  3R8J A;  2WTY A;  5GQQ A;  1L0N J;  1M56 D;  3L73 J;  1Q81 Q;  1PGP A;  3NTN A;  3H1L G;  1VQ4 P;  1SVF A;  2WZ7 A;  3LW5 J;  1KYO H;  3KYQ A;  3Q5R A;  3RL0 B;  2VZ4 A;  3L4F A;  3H1J E;  1LT9 A;  2K9Y A;  1NTK K;  1FZA A;  4OGQ C;  3RL0 D;  1NU1 E;  2JML A;  1SQX E;  1SQV D;  1P84 I;  1A02 J;  2A45 I;  1QVF O;  3H1H E;  2E5T A;  3L70 E;  5AVQ B;  3SWF A;  2HOD A;  1LTJ B;  1IFI A;  3FWN A;  3H1L E;  1JY2 O;  1PPJ G;  3GHG B;  2PFX A;  1KQG B;  1OVU A;  1EZV I;  2K37 A;  1KIL A;  2NZ2 A;  1OMI A;  2ZHG A;  3L71 G;  2PAJ A;  1KFN A;  1G1J A;  2HR3 A;  2FFD C;  1QEX A;  1L0L G;  3IN6 A;  1ZV8 A;  3TDK A;  2W6B A;  3CXH E;  2QA4 P;  3PHL A;  2B88 A;  1J1E B;  4R24 B;  1QL2 A;  1H0T A;  3HD7 A;  3L74 J;  1LP1 A;  1AQ5 A;  1MUU A;  3B8E B;  4GDO A;  1OFC X;  3B49 A;  1BGY D;  1PPJ E;  1PFI A;  1Y47 A;  3HUS C;  1AVO A;  5C39 A;  1YHQ P;  3H1K E;  2R5D A;  3L71 E;  3CI9 A;  2DW3 A;  1RE3 A;  1L0L E;  2JEE A;  3V2N A;  1LTA C;  2D2C C;  3O6Q B;  2QIW A;  2QG4 A;  3TNU B;  4Y99 C;  5APV A;  3WUV A;  4BRY B;  1K8A Q;  1OXZ A;  2BOW A;  1DEE G;  1RF0 A;  4HB1 A;  2YXQ B;  1SQQ D;  1MZ9 A;  3CC2 P;  4TT3 H;  1GK6 A;  4KJM A;  2QSI A;  1LWU A;  4TLF A;  4QMA A;  2E76 C;  3EZF A;  1J1D C;  5AVY B;  3MUD A;  2IPP A;  3FXE A;  2C0W A;  4R4L A;  2XKM A;  1L0N K;  2YKP A;  1GL2 C;  2QE7 H;  5KJ7 A;  1NTM J;  2OYI C;  3L75 D;  1RH6 A;  4DCK A;  4RES B;  1BCC G;  2Z5H A;  1FZG A;  3BAT A;  1ZRT D;  2M5A A;  2J5U A;  1RF1 A;  3PLN A;  2OGU A;  2ZVN B;  1Z56 A;  4EIJ A;  1VQO P;  5AW3 B;  2YIU C;  3HTK B;  2FBW C;  1N73 A;  3C1L A;  1FDM A;  3EZ9 A;  3AE1 C;  2IFN A;  3H1I E;  3A0H H;  5AW6 B;  1M1J A;  2OYH B;  1LT9 C;  1N7S A;  4LGD E;  1Y6U A;  4ASW A;  1ZP0 C;  4D6T G;  3V4Q A;  1OX3 A;  2KP8 A;  1BCC E;  2V7Q J;  3NFQ A;  2ZYD A;  1SQP D;  4PV1 D;  2GM4 A;  3TGU D;  1KB9 I;  2IX7 C;  1PZQ A;  1J2J B;  4H0L B;  3CCL P;  1N86 A;  2BAS A;  1MKM A;  3KQG A;  1HTL C;  4WY4 A;  5D8C A;  1HVV A;  1KIL C;  3H32 B;  3V6I A;  3UCS A;  4NPF X;  1P84 D;  1YIJ P;  4BXL A;  3RL0 g;  2Z4E A;  2KI7 B;  5KLV G;  2WPS A;  3M9Q A;  1FDO A;  1KV4 A;  1N2D C;  3A2A A;  5CHX A;  2E75 B;  3H6P A;  1WT6 A;  1WMK A;  1D7M A;  1GD2 E;  2R32 A;  2E75 D;  4K35 A;  1VF5 C;  4PJ0 E;  4R4E A;  4PD4 H;  5KLI B;  1YJ9 P;  1BGY J;  1PP9 E;  2KNC B;  3CX5 I;  2NPS A;  2BCC G;  1HGV A;  2WIT A;  4AYZ A;  1XTC C;  1RE3 C;  5KLV E;  1L0N D;  1USD A;  3L73 D;  5KAF E;  5AVR B;  2RMZ A;  1AQT A;  1RQU A;  4H44 B;  1M1K Q;  3N4X A;  1DD3 A;  2FYU K;  4PJ0 H;  2KYV A;  4KT0 J;  1FOS E;  3CWB D;  1RF0 C;  3ITK A;  4H44 D;  4IFF A;  1IFP A;  1QLE D;  2RH0 A;  4W7Z A;  3S9O A;  1GTW A;  1KTM A;  1SQQ J;  1LWU C;  1LTJ A;  1HJ0 A;  5KAF H;  1NTM K;  3MUD C;  2MKV A;  1PIX A;  2XNX A;  3GHG A;  2H7H A;  3A7O A;  4U3F E;  2W6A A;  4C7N A;  1T2K C;  5D90 A;  4W7Y A;  4LHF A;  4H13 B;  2WPQ A;  1HH0 A;  2H8P D;  5KJ7 C;  3RK2 C;  1LTB C;  3H1J D;  3ABV C;  3T97 B;  2QJY B;  3L72 D;  4H13 D;  5CJ0 A;  1FDI A;  2JWA A;  2O01 N;  4K3A A;  3L75 J;  3JC2 2;  3S4R A;  4UB6 E;  2HPC B;  2N1T B;  3E7K A;  1CZQ A;  1RF1 C;  3KPE A;  1S5L X;  2QM7 A;  2QRX A;  1W2E A;  4PD4 I;  1KMI Z;  3VMY A;  3NXS A;  3M9B A;  2N1T D;  1N73 C;  4WB4 A;  2KS1 B;  2P2U A;  1FZE A;  3FGA D;  4CPG A;  3Q2Y A;  2FXP A;  1M1J C;  1GW4 A;  3AE4 C;  1N7S C;  1ZR4 A;  1KFM A;  3L74 D;  4UB6 H;  2WSC H;  1Q2N A;  1RH5 B;  2O1J A;  5M1B A;  5KAT A;  1X22 A;  2JDI H;  2IEF A;  5CCG D;  3O6Q A;  2XDJ A;  2CPB A;  1SP4 A;  2H89 C;  5E79 H;  1FZB A;  4HJG H;  2OYO A;  1ZN5 A;  1S4X A;  1SQP J;  1YTZ I;  1SQB E;  1HBW A;  4EYY Q;  2ZAE B;  1VQP P;  4WY4 C;  4JPZ B;  3CME P;  1S3J A;  4WWI A;  1PPJ D;  4A1M A;  3U1C A;  5KAI E;  5CCH A;  2ZT9 B;  2FYN C;  3KHU A;  2O3J A;  4AQR D;  2XND H;  1A02 F;  3L71 D;  2ZT9 D;  1ZR2 A;  5KKZ B;  3VMX A;  5H2F E;  3OA7 A;  1L0L D;  2OQQ A;  1NKN A;  1XTG B;  3P8C E;  1MFT A;  4N78 E;  2XU6 A;  1T8Z A;  5KAI H;  1LGH B;  2N9B A;  2Q5U A;  2K1A A;  1QL1 A;  1KIL E;  4EOT A;  1S9K D;  2IYP A;  2NPS C;  5H2F H;  1AFO A;  2O01 J;  1FE6 A;  3BCC G;  4N6J A;  2HYN A;  1R5S A;  1NU1 G;  1BSN A;  3HTK A;  4JBZ A;  1SQX G;  1OVV A;  4J2N A;  3EZ2 A;  5B5E E;  3RL0 C;  2Y0C A;  3H1H G;  2CPS A;  3L70 G;  1M8O B;  1SQQ K;  2OYH A;  2Y9Z A;  3R8K A;  2NRG A;  2I1K A;  1KQL A;  2JWD A;  3CX5 D;  4R4M A;  2G3A A;  5KAV A;  3CWB J;  1DIP A;  3E1R A;  3V2Q A;  4L74 A;  1LTJ C;  4IL6 E;  5B5E H;  1U7M A;  1LTT C;  1NAF A;  3GHG C;  3B5N B;  3BCC E;  1Q7Y Q;  1BE3 G;  3MGN A;  2OAR A;  1KN7 A;  3B5N D;  2OTK E;  2KK7 A;  3GF7 A;  4YTP C;  1X0T A;  1GW3 A;  1ZOY C;  3H1J J;  4IL6 H;  5TJH A;  3AE5 C;  3L72 J;  1J1E C;  1ZW0 A;  2QJP B;  1WRG A;  1BCC D;  1SQX J;  1OW7 A;  3VOP A;  2DG6 A;  2K9J B;  3H1H J;  3L70 J;  3H1K G;  1IFD A;  2XV5 A;  3WU2 E;  2V4H A;  1JY3 N;  2QEX P;  4L76 A;  3H1L J;  1BE3 E;  2KNC A;  1BDD A;  4OGQ B;  2R44 A;  3L37 A;  1NTZ E;  1FZF A;  1YIT P;  1SQP K;  4DZO A;  2HG5 D;  1L4A B;  1CSB A;  4OGQ D;  3CCR P;  4PD4 D;  2N9Y B;  4JYB A;  1DX7 A;  2J59 M;  4D6T D;  3D6Y A;  3WU2 H;  2IYO A;  3U1A A;  1L4A D;  1KYO I;  3CXH H;  3PH0 A;  4LLH A;  1VQM P;  2H88 C;  4DOJ A;  1Q09 A;  3OAK A;  5GTI E;  3AE8 C;  2QM8 A;  3AEB C;  2YMK A;  2G8Y A;  2R3C A;  5CCH C;  4Y28 J;  2WPV B;  2E5Y A;  2KSJ A;  4XA4 A;  3EFG A;  5KLV D;  2LKM A;  1NWQ A;  2KLV A;  1VQL P;  4N3Y B;  1E79 H;  3L71 J;  1VQ5 P;  5GTI H;  2FYU E;  5I44 A;  1L0L J;  3T97 A;  5CJ4 A;  1Q86 Q;  2IBZ G;  3LIE A;  3P8M C;  2WT7 B;  3CCU P;  3CMA P;  1NGM B;  2OG0 A;  1VQK P;  1Q90 D;  2HPC A;  3H1I G;  2E74 B;  1E5W A;  1GDT A;  1JMB A;  1AVY A;  1Y9B A;  2KXP B;  1FU1 A;  1EXJ A;  5AW4 B;  3CCQ P;  2E74 D;  4Y99 B;  2KS1 A;  2BCC D;  4OH8 B;  3CCJ P;  1D5Y A;  2MJZ A;  3KDP B;  4I6M C;  2C0X A;  3PP5 A;  2OYH C;  3M9H A;  1S2E A;  5AW0 B;  1EXI A;  5AVV B;  1MFZ A;  3SFD C;  2IBZ E;  2Y0E A;  4O9B A;  3CXH I;  4NPE A;  3GK6 A;  3KZI E;  3SSU A;  2PRR A;  4H0L C;  1CI6 A;  2WSF H;  3RK3 C;  1ZXG A;  3M91 A;  1AV1 A;  3VMZ A;  2R5B A;  2YKO A;  4PV1 B;  2KIK A;  4GOD A;  2CK3 H;  3QAO A;  2ZJS E;  2KCU A;  1SQV E;  1GL2 D;  5GTH E;  4GT1 A;  5K5G B;  1JEK A;  1T3J A;  3WUT A;  3KZI H;  3G9R A;  4IOI H;  3IFM A;  1YBK A;  5APW A;  3GLM A;  1USE A;  1EDJ A;  3PJS K;  2KLU A;  4B0Y A;  2M3E A;  2E75 C;  1PP9 G;  2A06 G;  1Q05 A;  1JUN A;  2I8D A;  1BCC J;  1JNM A;  3G6E P;  1FJP A;  5GTH H;  1G2C A;  1EQ7 A;  4ASV A;  1LTI C;  2KZJ A;  1GU4 A;  5KLI C;  1KZU B;  3D70 A;  5AVW B;  2AEF A;  1URQ B;  3F5H A;  2WSS H;  2FY8 A;  5L8R J;  4W80 A;  4IFD K;  2L91 A;  3SWK A;  1M57 D;  1URQ D;  3R4Y A;  2E42 A;  2HVA A;  4D6T J;  3P8C D;  2A06 E;  3OW2 O; 
#chains in the Genus database with same CATH homology
 1GMJ A;  4H44 D;  4PV1 D;  2H88 C;  2BOW A;  3AEA C;  3Q3D A;  2WSC J;  1DIP A;  1Q09 A;  2D2C D;  4H0L C;  3H25 A;  3S9O A;  1Q08 A;  3AE8 C;  1KTM A;  4H0L B;  1S1C X;  3AEB C;  2YMK A;  4R22 B;  2G8Y A;  3AEG C;  1OW8 A;  1HJ0 A;  4H44 C;  4PV1 C;  4TT3 H;  4Y28 J;  3E0H A;  1Q07 A;  2QSI A;  1MKM A;  4Z1M H;  4A1M A;  4PV1 B;  5D8C A;  2WPV B;  2MKV A;  1PIX A;  2E76 C;  3SFE C;  3QAO A;  3GP4 A;  5E01 A;  1YQ3 C;  3D6Z A;  1K04 A;  3UCS A;  1KQG B;  2QJK C;  3EZF A;  5I41 B;  2E76 B;  2KVV A;  2ZT9 B;  2KCU A;  2FYN C;  3EZ7 A;  4DCZ A;  1PV3 A;  2ZHH A;  3RL0 g;  5KAU A;  3G9R A;  3AEE C;  5KCB A;  5D90 A;  3GF7 A;  4R4L A;  5KKZ C;  1JBG A;  4LHF A;  1RQV A;  2NZ2 A;  1IK7 A;  1OMI A;  2ZHG A;  2E76 D;  2WSF J;  2ZT9 D;  3AE9 C;  1TU3 F;  3AE2 C;  3GLM A;  1AJY A;  2GOV A;  1VF5 B;  1ZOY C;  2QJY C;  3LUR A;  3D71 A;  1FDO A;  2OQQ A;  3ABV C;  3AED C;  4XFJ A;  5I44 A;  3T97 B;  1LX8 A;  3AE3 C;  4WLW A;  3IN6 A;  4B0Y A;  4H13 B;  3GPV A;  2E75 C;  3AE5 C;  4H13 D;  2ZT9 C;  1FDI A;  2QJP C;  2E75 B;  3GF3 A;  1RH6 A;  1VF5 D;  2BEZ F;  1NGM B;  1Q05 A;  2OG0 A;  4I7Z C;  4AYZ B;  3HH0 A;  1WMK A;  3RK3 E;  4I7Z B;  1OW7 A;  1BOW A;  4R24 B;  1Q06 A;  3R8J A;  1Q90 D;  5GQQ A;  2DG6 A;  4H13 C;  1R8D A;  2E74 C;  3Q5P A;  2J5U A;  2E75 D;  1KIL E;  1S5L X;  1VF5 C;  1PM6 A;  2E74 B;  3B71 A;  3Q5S A;  1KQF B;  1VL2 A;  1KMI Z;  1KOR A;  5KLI C;  4R4E A;  2P10 A;  4GDO A;  3B49 A;  2IDB A;  2BEQ D;  1Y9B A;  4IL6 X;  2WQY C;  3D70 A;  3AE6 C;  2O01 J;  1K05 A;  1EXJ A;  1OW6 A;  3LW5 J;  2E74 D;  1ZME C;  1JB0 J;  2YIU C;  3FGA D;  3Q2Y A;  3IAO A;  2FBW C;  4OGQ B;  2FXP A;  1D5Y A;  3AE7 C;  5L8R J;  1JYH A;  5KAX A;  1NYH A;  5KAW A;  3AE4 C;  2JP3 A;  1DD4 A;  4WLS A;  4AYZ A;  3EZ9 A;  4J2N A;  1YQ4 C;  1HF9 A;  1UIX A;  3EZ6 A;  3AE1 C;  1ZRT E;  3EZ2 A;  3Q5R A;  4U7J A;  4OGQ D;  4YXD C;  1EXI A;  3Q1M A;  2VZ4 A;  5M1B A;  1Y6U A;  3R4Y A;  5KAT A;  3C8V A;  3EWK A;  3R8K A;  3SFD C;  2IEF A;  1RQU A;  4H44 B;  1ZP0 C;  2D2C C;  1DD3 A;  3D6Y A;  2HVA A;  2K9Y A;  2QIW A;  3AEC C;  4KT0 J;  4RKU J;  3O6Q A;  2D2C B;  4H0L D;  2H89 C;  2WSE J;  4R4M A;  4OGQ C;  2G3A A;  3GK6 A;  5KAV A;  1Q0A A;  2JML A;  2JO1 A;  3GMA A;  1PL5 A;  4YTP C;  1U57 A;  1R8E A;  2V7Q J;  3AEF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...