3IAOA

Conformational plasticity of the coiled coil domain of bmrr is required for bmr promoter binding-the unliganded structure of bmrr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
273
Chain Sequence
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTSSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity of the coiled-coil domain of BmrR is required for bmr operator binding: the structure of unliganded BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 73
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3iaoA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3iaoA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3iaoA03
2DG6A 3GP4A 2OQQA 1R8DA 1Q08A 4WLSA 2VZ4A 3LURA 5I44A 4R4MA 3G9RA 2KCUA 2HVAA 3QAOA 2ZHGA 1Q06A 5KAWA 3D6ZA 4R4EA 3Q1MA 3Q5SA 3R8KA 3UCSA 2J5UA 1BOWA 5KAVA 5E01A 5KAUA 1Q09A 1JYHA 5GQQA 3Q5PA 2GOVA 3HH0A 4WLWA 3Q2YA 3GK6A 4AYZA 1EXJA 1EXIA 4R24B 5KAXA 3T97B 1D5YA 3Q5RA 5D8CA 3Q3DA 2BOWA 1Q0AA 3D70A 4R4LA 3B49A 3E0HA 3R8JA 2ZHHA 3IAOA 2JMLA 3GPVA 1Q05A 1R8EA 1DIPA 5KATA 5I41B 4J2NA 1JBGA 5KCBA 4A1MA 4AYZB 4B0YA 4R22B 3D71A 1Q07A 5D90A 3D6YA
chains in the Genus database with same CATH superfamily
1RH6A 3H25A 1MV8A 3AEGC 5C39A 3V2QA 5E01A 2WZ7A 1M1JA 2QEXP 3TGUJ 1LP1B 2V7QH 3M9HA 2E42A 1K04A 1N2DC 5DJTB 2KZJA 3U1AA 5TJHA 1BCCE 4AYZB 1CZQA 3P8MC 3GLMA 2FBWC 1URQA 1SQQE 4H13C 3TDKA 2A06G 5L8RJ 1YTZI 2QM7A 1JCDA 5APUA 2OG0A 1PL5A 1DX7A 2JJLA 2YKPA 3T97B 2WSEJ 2IZ0A 1T8ZA 3D70A 1KMIZ 2AXTH 3O8ZA 4NPEA 3S1KA 2OYIA 2DG6A 2LXBA 2OYHB 3CMEP 2AEJA 1YIJP 4WY4D 1EDKA 1MZ9A 1FZFA 2Q6QA 1SQQG 3CWBE 4GOEA 3V4WA 1Q82Q 2I1JA 1BCCD 1OVRA 3OA7A 3HE5B 3WMM0 1H0TA 2Q1KA 1WRGA 2K3RA 2J5UA 3PLNA 1NU1D 1NTKJ 2ZVOB 1J1DC 4GT1A 1L0LG 3HD7D 2ZJSE 1PZQA 1P84I 1BSHA 1OW7A 1WT6A 3H1ID 1GZLA 3HD7C 2B87B 2HPCB 1BE3G 4BRYA 1AFOA 2Q3EA 3P7KA 4UB6H 2NZ2A 4L74A 3KHUA 5CMZA 1R5SA 1L4AB 3PH0A 3HD7B 3R4YA 3HE4A 4GIFA 4WVZA 3L75G 4PJ0E 3CCEP 1NO4A 1FZEA 2H7HA 1Q86Q 3KQGA 3L70D 4L73A 2FYUJ 3FWNA 1OVVA 5AVSB 3VOPA 3U59A 2FY8A 2ZXXA 3QAOA 1R5LA 1VPCA 4OH8B 5AVUB 3CCVP 5GQQA 2N1TD 3R2PA 4ASVA 2L5GB 1FBMA 1Q0AA 1P84H 1KFMA 2CPSA 3H1IJ 2N1TB 1RQUA 2SPZA 2RN0A 3MHVA 3FGAD 1IFMA 3C8VA 2PP6A 1KB9D 3HUSC 1QVGO 1LTIC 2HYNA 1YJWP 3CLQA 5AVXB 4WY4C 1NWQA 4A1MA 4LGDE 5H2FH 3AE7C 1J2JB 2A45I 4OWFA 3L75D 3H1IE 1ZLLA 1FZBA 3VMXA 3L71J 4JF7A 3L74J 1FDMA 1NTKE 1XTGB 1VF5C 2BCCG 3VMYA 1VQKP 1RF0A 3M0DA 1FU1A 1QX8A 3EZ9A 2YNYA 2WPQA 3HRNA 5BU8B 1JYHA 2KP8A 2AXCA 1DD3A 4I1LA 4D6TJ 4UB8H 1N7SA 3R8JA 1HGZA 2KLUA 1NH4A 1LP1A 1GL2C 3CX5I 2O1KA 1KYOD 2A06E 1SQXK 4GDOA 1PIXA 1FDIA 3KXDA 1S9KD 1NAFA 2Q3IA 1GK4A 3KZIE 5AVRB 2A45H 2WWWA 4I6MC 2YIUB 2KLVA 2E76B 1SQQD 1IC2A 1K05A 2WT7B 4H0LC 1AA0A 3RK3E 2JDIH 3SWYA 3WUTA 1H89A 4W7YA 3AE6C 4I2LC 2AEMA 1KB9E 3TYYA 2OYHA 1YTZT 4R24B 4H0LD 5KLVG 1SLQA 4DCZA 3MD0A 1SFCC 3L4FA 4J2NA 2KSEA 3T97A 1NTKG 2E75D 2Z4EA 2QJYB 3VP8A 1GW4A 3L74E 1KV4A 2HVAA 1Q06A 4B86A 2QRXA 3CWBD 2YIUC 2H89C 3HH0A 3H1HG 5AVZB 1H0TB 2P10A 4XA4A 4NPFX 3V6IA 2C9LY 1XTCC 3A0HE 2QE7H 1JMMA 3L72G 1HTLC 1LT9A 1GD2E 4OGQC 2OYOA 3RGUA 1HGVA 3V2RA 1DH3A 3O6QB 3CMAP 4YXWH 2KS1A 1BE3D 2HODB 2E74D 3CPWO 1M1KQ 2IYPA 5KKZC 1HWTC 3CCJP 1OMIA 4OGQD 2W90A 1KORA 2HG5D 2B87A 3CCRP 1QVFO 3AEAC 1KYOE 5GTIH 1ZV8A 4QMAA 3BCCD 1NU1G 1S9KE 3Q5SA 2ZT9D 4ZKUA 1HBWA 1FZCA 4U3FE 1EXJA 3ABVC 1IK9A 1BCCG 1L4AC 2IFMA 2WPSA 2Y9YA 2ZT9C 1L0LK 1N86A 5KLIC 2KNCA 1QL2A 1L4AD 2KK7A 3CCUP 1L4AA 1FZAA 1ZXGA 2QG4A 1SQVG 3M0AA 1K8AQ 3GHGC 2OYHC 1P84D 3GPVA 4IL6H 1LWUC 5KCBA 3PHLA 2W6BA 3L74D 4U3FG 1Y8AA 5CBOA 2N1TA 4HH2A 2YMYA 4H13D 2KSJA 1KN7A 2A06D 4I7ZC 3SSUA 3H32A 2ITAA 2KZIA 4U3FD 3L74G 3V4QA 3W68A 3N4XA 5AW5B 2KOGA 2E75C 3P8CD 1ZR2A 1FJKA 1Z56A 3GF7A 1VQ9P 4PD4I 3M06A 1JNMA 4IOIH 2Y0CA 5AW6B 1LNQA 1NJIQ 1Q07A 2XZRA 3GP4A 1L0NK 1G1IA 3AE8C 3OW2O 4DCKA 1VL2A 2ZXEB 5KKZB 3CCLP 3HE5A 5KTBA 3BCCG 2FFDC 5B5EH 2QIWA 3LW5J 1N8RQ 4HKZH 3GW6A 2M5AA 5E79H 3HD7A 1N73B 1NKZB 3HE4B 2NRGA 1GL2D 3A3YB 2WVRA 1LTTC 1S5LX 3Q5RA 3H1KD 3JCUE 1NTMJ 4LC1A 5DJUB 4JQ0D 3CCMP 4B0YA 5AW8B 1Q81Q 2J58A 3H1HD 2ZHGA 2FXPA 4UB6E 3JCUH 4R4EA 3TGUE 1USEA 3L75E 4H0LB 1GDTA 3G6EP 2FXOA 1NTKD 1HF9A 1U57A 2WQYC 2W6AA 1JY2N 5AVVB 3P8CE 4R4MA 1HH0A 1HVVA 2FFDA 3KYQA 5APQA 1BE3E 1RQVA 2E5TA 3CI9A 5E79E 1PP9E 2FKWB 4ZMDA 1UIXA 5CBNA 5CCGC 1GL2B 2PAJA 4TLFA 4WWIA 1OZHA 3LIEA 5EFWB 3AE1C 1FOSE 1UIIA 1RE4C 5AVTB 4C7NA 1X9VA 3Q2YA 3NTNA 3A2AA 1EXIA 2V4HA 3BRVB 2OGUA 1NTKK 1T6AA 2W6JH 1CW5A 5AVQB 1DD4A 2QJKB 1BCCJ 1NTMK 3C9IA 2XDJA 1NAYA 2IYOA 3H1KG 4L76A 2LR2A 4IFFA 1SQPG 2WSEH 1EZVE 2YMKA 3VMZA 1GW3A 2N9YB 3PRJA 5CJ0A 2ZYAA 1N7LA 1CI6B 1YQ3C 4Y28J 2GUVA 5APYA 2IPPA 4L75A 4ZNCA 3WUUA 1ZW0A 3CX5H 2OTLP 1FZCB 2R3CA 3L73J 3USSA 3AE5C 1DEBA 4AYZA 2YXRB 5AW9B 1OWAA 2O01J 3TSIA 2P2UA 5AW4B 3II6A 1SQBJ 1YITP 3E1RA 4ZKPA 5KJ7C 4N6JA 1M1JC 2RMZA 3K5BA 3IN6A 5D90A 2D2CB 1PFIA 3KPEA 4WLSA 4K35A 2C0XA 1BGYD 2O01N 2QJKC 2Y0EA 4C46A 4DOJA 3EZ6A 3H1HE 4OGQB 4XFJA 5KJ7D 4ASWA 4DT0A 1M56D 2JMLA 1H88A 1AQTA 1Q2NA 3MIWA 5B5EE 3AEEC 1SFCD 2BASA 1SQBE 1SQBK 1LT1A 5CCGD 3H1JD 5KLVJ 1VQ7P 1SQVD 1M8OB 3WUVA 5KAIH 3S9OA 4PV1B 3AE4C 3E0HA 1LTJA 4H44B 1JBGA 2PGDA 3H1KE 3A0HH 1PP9D 1U7JA 1NHLA 2XNDH 4W80A 4RESB 2E43A 1NTMG 2IZ1A 1VQ4P 1SVFA 2O3JA 5KAVA 3O6QA 3GHGB 2E76C 3TGUD 5KLVE 2QA4P 4HB1A 1URQC 1IFPA 4H13B 1M90Q 2JO1A 2E76D 2IEFA 3RK3D 1N7SB 2RH0A 2J59M 2B89A 1KB9H 2K9YA 4XE5B 1S72P 1JY2P 1SQVE 5APSA 3L72D 4IL6E 1NGMB 3A0BE 3L73E 3CC7P 1KD1Q 3FXEA 3RK3C 2KB7P 2W27A 1J1DB 3CWBG 2ZFCA 2GUSA 3S4RA 4Y99B 2Q9IA 1E5WA 2V7QJ 3L36A 3ZDMA 5KLVD 2Y9ZA 2OQQA 1KILE 3RBZA 1RF1B 4PV1D 2LXCB 5BVZA 1L0NJ 2OTJP 1HUCA 1MKMA 1L0NG 2L91A 4U3FJ 1SQXD 2BCCE 1GMJA 1OX3A 4D6TE 5B66E 2YO3A 4N78D 1EZVD 1USDA 1SQVJ 3LURA 1AQ5A 3HUSA 1S5LH 4BWNA 2IBZD 2M5AB 3CC2P 1VQOP 4C7NB 5I41B 4KT0J 2VZ4A 2BCCJ 3BASA 2Z5IA 1W2EA 1CI6A 1N7SD 3IR9A 1LX8A 3CCQP 4RJTA 1A02J 1DIPA 1EDLA 1KYOI 1LTBC 1NU1K 1KILC 4IFDK 3NXSA 1GTWA 3EZ7A 3MZWB 3GF3A 5I44A 3CXHH 4YPCA 1SQQJ 1M7LA 5AW2B 2RKLA 1LTJC 3CX5E 2FYUD 2GOVA 3PJSK 1IO4A 3A0BH 2E5YA 3I55P 1NTZJ 4RO0A 2G3AA 3SWFA 3A7OA 3EZ2A 2H8PD 2IBZG 2ZAEB 4MN4C 3RL0B 1D7MA 1SQBD 3NMDA 4D6TD 2KI7B 1GL2A 4HYTB 2OARA 1RY3A 1FAVA 1RE4A 3TNUB 1BDCA 3F5HA 1L0NE 5KJ7A 4UB8E 1JO5A 5AW0B 1DEEG 4DJGA 1G1JA 1HJBA 1X0TA 5APVA 1SQVK 1SFCA 2P1JA 1W5CE 3L37A 1LTJB 3RK2B 2XV5A 5AVWB 2R32A 2YXQB 5AW7B 1WMKA 3AEBC 1NTZD 2JKVA 3V2PA 5B66H 2QJYC 3HTKB 1Q05A 5KATA 4BXLA 2P67A 3AE3C 4M3LA 3B5NA 1KILA 1VQ5P 1AVYA 1T3UA 1YJ9P 2QJPC 1YI2P 2W8ZA 1GU4A 1FC2C 1X79B 1YYCA 2AXTE 2IBZE 1YHQP 2CPBA 3EZFA 1N7SC 2NPSD 1L0LE 1SQPJ 1KILD 3UIAA 1NKNA 3L70J 1NTZK 3H1JE 5TISH 3MP7B 3L73D 2ZYGA 2GM4A 3TF5A 2O01H 1D5YA 4YXDC 3AEFC 1M1JB 3E1IA 1PP9G 4C7RA 1YQ4C 2NPSC 2KNCB 4TT3H 3MUDC 3CC4P 2H43A 1MUUA 4IL6X 1P84E 3D6YA 1M57D 2E74B 1LTGC 3QH9A 3IF4A 3TK1A 4PV1C 1KFNA 1S1CX 1A02F 3R8KA 1SP4A 2E75B 3Q5PA 3M9QA 3MUDA 3G4SP 3SWKA 1KQSO 2QM8A 2FXMA 2K9JA 2R3SA 1GK6A 1FZGA 1PV3A 5KAXA 2M8RA 3B49A 1L2PA 1RHZB 1EQ7A 3H6PA 3E7KA 2KYVA 2KXPB 4D6TG 4JPZB 3VTPC 1X8YA 1LGHB 1SQBG 1RF1C 3G3ZA 3JC22 2FYUK 3H1LD 1FDOA 2BOWA 2P7JA 3CX5D 1JTHB 1ZMEC 3N7NA 4EYYQ 2B9BA 1NTME 4KJMA 4N3YB 3B5ND 1T2KC 1PM6A 1GU5A 4O9BA 3LW5H 1BDDA 2LKMA 1LT9B 3WU2E 3RK3B 1LWUB 2HR3A 3L35A 1PGPA 1LTAC 2BCCD 4NPDA 2IFNA 1URQD 1IZNB 1PGQA 1OVUA 2JP3A 3VN0A 2W83C 2WPRA 1JUNA 1VQ6P 3EWKA 2A45G 3D71A 1W2BO 1QEXA 3L75J 4KHXA 1BOWA 5GTIE 2M3BA 3Q1MA 3GG2A 1AV1A 3L70E 5CJ4A 1VQPP 1EZVG 4GKGA 1AJYA 2DW3A 3IAOA 1YJNP 1BGYG 1SQXG 3H1LJ 1L0ND 3HUSB 1PGJA 5CCHA 1LT9C 3D6ZA 1KYOH 3BRTB 1HJ0A 1ZRTD 1FJPA 3RL0C 1Q09A 2FYZA 1RF0C 1BSNA 3FX0A 3NFQA 1RE3C 4K3AA 1JCCA 2ZHHA 1IFIA 1NVOA 2KVVA 4EDFA 3L70G 3HTKA 5AVYB 1IFDA 3MTUE 1FS0E 3MGNA 1MFTA 2Q5UA 3I56P 1PPJG 3OAKA 3CL3D 3H1KJ 4A7PA 1OIPA 1Q7YQ 2VRSA 1JEKA 2YKOA 2HLOA 3F89A 1J1EB 3L71D 3V2NA 3SFDC 2IDBA 1Q08A 5KAFE 3AECC 3CCSP 3BATA 3KZIH 2PRRA 3AE9C 2POHA 2QVAA 3EFGA 1N73C 1S2EA 3L71G 4DZOA 3TGUG 1SS1A 1L0LD 5AW1B 1CSBA 3CXHI 2O1JA 3VP9A 3G9RA 1QGKB 3C1LA 2JEEA 5KAUA 1NTMD 2QJPB 2XKMA 2WTYA 3H32B 1VQMP 5CCGA 4WY4B 3BCCJ 1LTSC 2WSCJ 4N78E 3L71E 2WT7A 1JY3N 1BGYE 1SFCB 1VQ8P 1OFCX 3PP5A 1NYHA 2JWDA 3H1LE 3A5TA 3CXHE 3M9BA 3G71P 4JBZA 1OW6A 1VF5B 2R44A 2K1AA 1EC5A 2IBZI 2D2CC 4W7ZA 4EI2A 3B5NB 1KILB 3IFMA 3I5CA 2NPSB 5APWA 5AW3B 3RL0g 1R8DA 1VDFA 3EFFK 3H1HJ 1N73A 4AUWA 2K88A 1G2CA 3B5NC 2M3EA 3L72J 5KAIE 2UWJE 2ZT9B 1AVOA 1T3JA 1S5LE 2FYUE 2IX7C 3AEDC 1Y6UA 3QWOC 4PJ0H 2N9BA 3JSVC 1LWUA 1ZN5A 1SQQK 5BU5A 5KLIB 1U7MA 1Q90D 3W67A 3UCSA 1H8AA 1SQXJ 1JOCA 1JB0J 2YO2A 1IFNA 2M0BA 2BEZF 1KB9I 3L72E 1JY3O 1SQPD 3BCCE 4EIJA 4AYCA 4H44C 1QLED 4HJGH 3FXDA 1BGYJ 3H1LG 1S4XA 4WY4A 2WSFH 1FZCC 4PD4D 3H1JG 1TU3F 2ZVNB 5KLVK 2FFDB 2P58A 1URQB 1VQLP 4I7ZB 1IJDB 1ZP0C 2C0WA 1S3JA 2I1KA 3EQ2A 3RL0D 2OYIB 4YTPC 4EOTA 5D8CA 5GTHH 3TNUA 1NTZE 3B4SA 4WBAA 4Y99C 5KAFH 1K73Q 2XNXA 1OW8A 2R5DA 1SQXE 3LIDA 2FYNC 2KUBA 1OXZA 1PGOA 2K9JB 3OJAB 1FE6A 2OYIC 5H2FE 4AQRD 1KQFB 4IFMA 3Q3DA 1LJ2A 2K37A 1JY3P 2WSFJ 4LHFA 1IK7A 4R22B 1PPJE 3L73G 2KCUA 4GODA 3BVHA 3CD6P 2WPVB 5K5GB 4CPGA 2Y0DA 2WSSH 2HODA 2JWAA 4R4LA 2MJZA 1KTMA 2G8YA 2WSCH 2AEFA 1JTHA 1SQPK 5CCHD 4WB4A 3RBXA 5M1BA 1Y9BA 4JYCA 3P32A 2KIKA 1T2KD 1KQGB 1ZRTE 3GMAA 1R8EA 5TISE 3VYIA 2WITA 3CXHD 3WU2H 2YKQA 2Q7CA 2B88A 1KQLA 1NTZG 2HPCA 3VMAA 3SFEC 4BRYB 4Z1MH 5GTHE 1PPJD 1JMBA 4RKUJ 2JR8A 2CK3H 1ZOYC 5CHXA 3M0DC 1L0LJ 1SQPE 5KAWA 3PTZA 5APXA 2XU6A 4WLWA 2D2CD 2BEQD 4PD4E 1FOSF 1BE3J 1YBKA 2QSIA 2NPSA 4JYBA 2GA1A 3AE2C 1ZR4A 2HFED 3B8EB 1K9MQ 1NU1E 3FWLA 4LLHA 2N1TC 3V5BA 4PD4H 4U7JA 2PFXA 3CWBJ 1G2CB 1RF1A 1X22A 3GHGA 3RK2D 2KS1B 3ITKA 1IFJA 1VQNP 2WMMA 2Z5HA 5APTA 2E74C 2FYUG 1Y47A 1NOHA 3U1CA 2I8DA 3KDPB 2OTKE 3RK2C 1NU1J 2H88C 3H1JJ 1RE3A 1EDJA 3M91A 2FYNB 1E79H 3H1IG 1EZVI 4H44D 1J1EC 2MKVA 5CCHC 1PP9J 3B71A 1QL1A 1EDIA 1KC8Q 2C9NY 1VF5D 1JY2O 4GOFA 4OVNF 3GK6A 2R5BA 1KZUB 1RH5B 1JM0A 1MFZA 2ZYDA
chains in the Genus database with same CATH topology
2E74B 3RL0g 1R8DA 2FYNC 1RH6A 1Q08A 3H25A 3LURA 1OW7A 2HVAA 2ZHGA 1Q06A 2FXPA 3AECC 2JP3A 4PV1C 1S1CX 5KAWA 4R4EA 3AEGC 1YQ3C 4H13D 4Y28J 3R8KA 5KAVA 5E01A 3O6QA 2E75B 4H0LB 2YIUC 2H89C 3Q5PA 4I7ZC 3HH0A 4WLWA 2E76C 2D2CD 2ZT9B 2BEQD 1VF5C 2P10A 3AE9C 1KQFB 1K04A 3Q3DA 3AEDC 3EWKA 1HF9A 1Y6UA 5I41B 1U57A 2WSFJ 3AE5C 2WQYC 4AYZB 4KT0J 4LHFA 1IK7A 4R22B 3D71A 2NZ2A 2QSIA 4OGQC 1BOWA 3GLMA 2FBWC 4H13B 3EZ9A 2VZ4A 4IL6X 3AE2C 4H13C 4R4MA 2JO1A 3G9RA 2E76D 2KCUA 2IEFA 1Q90D 3R4YA 3Q1MA 2E75C 2E74D 3UCSA 5KAUA 5L8RJ 1JYHA 5KKZC 2K9YA 1WMKA 1RQVA 2WPVB 1JB0J 3AEBC 2OG0A 1DD3A 1PL5A 1PV3A 3GF7A 4AYZA 5KAXA 1LX8A 3T97B 2WSEJ 1OMIA 4OGQD 2BEZF 2O01J 2QJYC 4U7JA 1AJYA 3D70A 1KMIZ 4R4LA 3B49A 1KORA 1NGMB 3R8JA 1Q05A 3IAOA 1DIPA 5KATA 1UIXA 1KTMA 3AEAC 3AE3C 1Q07A 3IN6A 5D90A 2D2CB 2G8YA 2DG6A 3GP4A 3EZ7A 3GF3A 4WLSA 4H44C 5I44A 3AE8C 2WSCJ 3AE1C 2QJKC 2E74C 3QAOA 5M1BA 3D6ZA 1Y9BA 1VL2A 4GDOA 3Q5SA 2E75D 2ZT9D 1PIXA 1FDIA 1HJ0A 2QJPC 3EZ6A 4OGQB 1Q09A 4XFJA 5GQQA 2GOVA 3Q2YA 1EXJA 1TU3F 1EXIA 3ABVC 1FDOA 1KQGB 1ZRTE 2QIWA 3LW5J 2V7QJ 2BOWA 1Q0AA 3GMAA 1NYHA 2ZHHA 2JMLA 1R8EA 1ZMEC 2H88C 2E76B 3EZFA 4I7ZB 3AEEC 1K05A 2G3AA 1RQUA 1OW6A 1DD4A 2KVVA 2ZT9C 4H0LC 3RK3E 5KLIC 2OQQA 1VF5B 1KILE 4PV1D 1ZP0C 3AE6C 3EZ2A 3FGAD 4H44D 3SFEC 2MKVA 1PM6A 3SFDC 4Z1MH 2J5UA 3C8VA 3S9OA 2D2CC 4PV1B 3B71A 1S5LX 1VF5D 1MKMA 3GK6A 4R24B 4YTPC 1D5YA 3Q5RA 3AE4C 4H0LD 5D8CA 4H44B 4YXDC 3E0HA 2YMKA 4DCZA 3AEFC 3GPVA 1GMJA 4RKUJ 1YQ4C 4J2NA 1JBGA 1ZOYC 5KCBA 4A1MA 4TT3H 4B0YA 1OW8A 2IDBA 3AE7C 3D6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG6 A;  3GP4 A;  2OQQ A;  1R8D A;  1Q08 A;  4WLS A;  2VZ4 A;  3LUR A;  5I44 A;  4R4M A;  3G9R A;  2KCU A;  2HVA A;  3QAO A;  2ZHG A;  1Q06 A;  5KAW A;  3D6Z A;  4R4E A;  3Q1M A;  3Q5S A;  3R8K A;  3UCS A;  2J5U A;  1BOW A;  5KAV A;  5E01 A;  5KAU A;  1Q09 A;  1JYH A;  5GQQ A;  3Q5P A;  2GOV A;  3HH0 A;  4WLW A;  3Q2Y A;  3GK6 A;  4AYZ A;  1EXJ A;  1EXI A;  4R24 B;  5KAX A;  3T97 B;  1D5Y A;  3Q5R A;  5D8C A;  3Q3D A;  2BOW A;  1Q0A A;  3D70 A;  4R4L A;  3B49 A;  3E0H A;  3R8J A;  2ZHH A;  3IAO A;  2JML A;  3GPV A;  1Q05 A;  1R8E A;  1DIP A;  5KAT A;  5I41 B;  4J2N A;  1JBG A;  5KCB A;  4A1M A;  4AYZ B;  4B0Y A;  4R22 B;  3D71 A;  1Q07 A;  5D90 A;  3D6Y A; 
#chains in the Genus database with same CATH topology
 1RH6 A;  3H25 A;  1MV8 A;  3AEG C;  5C39 A;  3V2Q A;  5E01 A;  2WZ7 A;  1M1J A;  2QEX P;  3TGU J;  1LP1 B;  2V7Q H;  3M9H A;  2E42 A;  1K04 A;  1N2D C;  5DJT B;  2KZJ A;  3U1A A;  5TJH A;  1BCC E;  4AYZ B;  1CZQ A;  3P8M C;  3GLM A;  2FBW C;  1URQ A;  1SQQ E;  4H13 C;  3TDK A;  2A06 G;  5L8R J;  1YTZ I;  2QM7 A;  1JCD A;  5APU A;  2OG0 A;  1PL5 A;  1DX7 A;  2JJL A;  2YKP A;  3T97 B;  2WSE J;  2IZ0 A;  1T8Z A;  3D70 A;  1KMI Z;  2AXT H;  3O8Z A;  4NPE A;  3S1K A;  2OYI A;  2DG6 A;  2LXB A;  2OYH B;  3CME P;  2AEJ A;  1YIJ P;  4WY4 D;  1EDK A;  1MZ9 A;  1FZF A;  2Q6Q A;  1SQQ G;  3CWB E;  4GOE A;  3V4W A;  1Q82 Q;  2I1J A;  1BCC D;  1OVR A;  3OA7 A;  3HE5 B;  3WMM 0;  1H0T A;  2Q1K A;  1WRG A;  2K3R A;  2J5U A;  3PLN A;  1NU1 D;  1NTK J;  2ZVO B;  1J1D C;  4GT1 A;  1L0L G;  3HD7 D;  2ZJS E;  1PZQ A;  1P84 I;  1BSH A;  1OW7 A;  1WT6 A;  3H1I D;  1GZL A;  3HD7 C;  2B87 B;  2HPC B;  1BE3 G;  4BRY A;  1AFO A;  2Q3E A;  3P7K A;  4UB6 H;  2NZ2 A;  4L74 A;  3KHU A;  5CMZ A;  1R5S A;  1L4A B;  3PH0 A;  3HD7 B;  3R4Y A;  3HE4 A;  4GIF A;  4WVZ A;  3L75 G;  4PJ0 E;  3CCE P;  1NO4 A;  1FZE A;  2H7H A;  1Q86 Q;  3KQG A;  3L70 D;  4L73 A;  2FYU J;  3FWN A;  1OVV A;  5AVS B;  3VOP A;  3U59 A;  2FY8 A;  2ZXX A;  3QAO A;  1R5L A;  1VPC A;  4OH8 B;  5AVU B;  3CCV P;  5GQQ A;  2N1T D;  3R2P A;  4ASV A;  2L5G B;  1FBM A;  1Q0A A;  1P84 H;  1KFM A;  2CPS A;  3H1I J;  2N1T B;  1RQU A;  2SPZ A;  2RN0 A;  3MHV A;  3FGA D;  1IFM A;  3C8V A;  2PP6 A;  1KB9 D;  3HUS C;  1QVG O;  1LTI C;  2HYN A;  1YJW P;  3CLQ A;  5AVX B;  4WY4 C;  1NWQ A;  4A1M A;  4LGD E;  5H2F H;  3AE7 C;  1J2J B;  2A45 I;  4OWF A;  3L75 D;  3H1I E;  1ZLL A;  1FZB A;  3VMX A;  3L71 J;  4JF7 A;  3L74 J;  1FDM A;  1NTK E;  1XTG B;  1VF5 C;  2BCC G;  3VMY A;  1VQK P;  1RF0 A;  3M0D A;  1FU1 A;  1QX8 A;  3EZ9 A;  2YNY A;  2WPQ A;  3HRN A;  5BU8 B;  1JYH A;  2KP8 A;  2AXC A;  1DD3 A;  4I1L A;  4D6T J;  4UB8 H;  1N7S A;  3R8J A;  1HGZ A;  2KLU A;  1NH4 A;  1LP1 A;  1GL2 C;  3CX5 I;  2O1K A;  1KYO D;  2A06 E;  1SQX K;  4GDO A;  1PIX A;  1FDI A;  3KXD A;  1S9K D;  1NAF A;  2Q3I A;  1GK4 A;  3KZI E;  5AVR B;  2A45 H;  2WWW A;  4I6M C;  2YIU B;  2KLV A;  2E76 B;  1SQQ D;  1IC2 A;  1K05 A;  2WT7 B;  4H0L C;  1AA0 A;  3RK3 E;  2JDI H;  3SWY A;  3WUT A;  1H89 A;  4W7Y A;  3AE6 C;  4I2L C;  2AEM A;  1KB9 E;  3TYY A;  2OYH A;  1YTZ T;  4R24 B;  4H0L D;  5KLV G;  1SLQ A;  4DCZ A;  3MD0 A;  1SFC C;  3L4F A;  4J2N A;  2KSE A;  3T97 A;  1NTK G;  2E75 D;  2Z4E A;  2QJY B;  3VP8 A;  1GW4 A;  3L74 E;  1KV4 A;  2HVA A;  1Q06 A;  4B86 A;  2QRX A;  3CWB D;  2YIU C;  2H89 C;  3HH0 A;  3H1H G;  5AVZ B;  1H0T B;  2P10 A;  4XA4 A;  4NPF X;  3V6I A;  2C9L Y;  1XTC C;  3A0H E;  2QE7 H;  1JMM A;  3L72 G;  1HTL C;  1LT9 A;  1GD2 E;  4OGQ C;  2OYO A;  3RGU A;  1HGV A;  3V2R A;  1DH3 A;  3O6Q B;  3CMA P;  4YXW H;  2KS1 A;  1BE3 D;  2HOD B;  2E74 D;  3CPW O;  1M1K Q;  2IYP A;  5KKZ C;  1HWT C;  3CCJ P;  1OMI A;  4OGQ D;  2W90 A;  1KOR A;  2HG5 D;  2B87 A;  3CCR P;  1QVF O;  3AEA C;  1KYO E;  5GTI H;  1ZV8 A;  4QMA A;  3BCC D;  1NU1 G;  1S9K E;  3Q5S A;  2ZT9 D;  4ZKU A;  1HBW A;  1FZC A;  4U3F E;  1EXJ A;  3ABV C;  1IK9 A;  1BCC G;  1L4A C;  2IFM A;  2WPS A;  2Y9Y A;  2ZT9 C;  1L0L K;  1N86 A;  5KLI C;  2KNC A;  1QL2 A;  1L4A D;  2KK7 A;  3CCU P;  1L4A A;  1FZA A;  1ZXG A;  2QG4 A;  1SQV G;  3M0A A;  1K8A Q;  3GHG C;  2OYH C;  1P84 D;  3GPV A;  4IL6 H;  1LWU C;  5KCB A;  3PHL A;  2W6B A;  3L74 D;  4U3F G;  1Y8A A;  5CBO A;  2N1T A;  4HH2 A;  2YMY A;  4H13 D;  2KSJ A;  1KN7 A;  2A06 D;  4I7Z C;  3SSU A;  3H32 A;  2ITA A;  2KZI A;  4U3F D;  3L74 G;  3V4Q A;  3W68 A;  3N4X A;  5AW5 B;  2KOG A;  2E75 C;  3P8C D;  1ZR2 A;  1FJK A;  1Z56 A;  3GF7 A;  1VQ9 P;  4PD4 I;  3M06 A;  1JNM A;  4IOI H;  2Y0C A;  5AW6 B;  1LNQ A;  1NJI Q;  1Q07 A;  2XZR A;  3GP4 A;  1L0N K;  1G1I A;  3AE8 C;  3OW2 O;  4DCK A;  1VL2 A;  2ZXE B;  5KKZ B;  3CCL P;  3HE5 A;  5KTB A;  3BCC G;  2FFD C;  5B5E H;  2QIW A;  3LW5 J;  1N8R Q;  4HKZ H;  3GW6 A;  2M5A A;  5E79 H;  3HD7 A;  1N73 B;  1NKZ B;  3HE4 B;  2NRG A;  1GL2 D;  3A3Y B;  2WVR A;  1LTT C;  1S5L X;  3Q5R A;  3H1K D;  3JCU E;  1NTM J;  4LC1 A;  5DJU B;  4JQ0 D;  3CCM P;  4B0Y A;  5AW8 B;  1Q81 Q;  2J58 A;  3H1H D;  2ZHG A;  2FXP A;  4UB6 E;  3JCU H;  4R4E A;  3TGU E;  1USE A;  3L75 E;  4H0L B;  1GDT A;  3G6E P;  2FXO A;  1NTK D;  1HF9 A;  1U57 A;  2WQY C;  2W6A A;  1JY2 N;  5AVV B;  3P8C E;  4R4M A;  1HH0 A;  1HVV A;  2FFD A;  3KYQ A;  5APQ A;  1BE3 E;  1RQV A;  2E5T A;  3CI9 A;  5E79 E;  1PP9 E;  2FKW B;  4ZMD A;  1UIX A;  5CBN A;  5CCG C;  1GL2 B;  2PAJ A;  4TLF A;  4WWI A;  1OZH A;  3LIE A;  5EFW B;  3AE1 C;  1FOS E;  1UII A;  1RE4 C;  5AVT B;  4C7N A;  1X9V A;  3Q2Y A;  3NTN A;  3A2A A;  1EXI A;  2V4H A;  3BRV B;  2OGU A;  1NTK K;  1T6A A;  2W6J H;  1CW5 A;  5AVQ B;  1DD4 A;  2QJK B;  1BCC J;  1NTM K;  3C9I A;  2XDJ A;  1NAY A;  2IYO A;  3H1K G;  4L76 A;  2LR2 A;  4IFF A;  1SQP G;  2WSE H;  1EZV E;  2YMK A;  3VMZ A;  1GW3 A;  2N9Y B;  3PRJ A;  5CJ0 A;  2ZYA A;  1N7L A;  1CI6 B;  1YQ3 C;  4Y28 J;  2GUV A;  5APY A;  2IPP A;  4L75 A;  4ZNC A;  3WUU A;  1ZW0 A;  3CX5 H;  2OTL P;  1FZC B;  2R3C A;  3L73 J;  3USS A;  3AE5 C;  1DEB A;  4AYZ A;  2YXR B;  5AW9 B;  1OWA A;  2O01 J;  3TSI A;  2P2U A;  5AW4 B;  3II6 A;  1SQB J;  1YIT P;  3E1R A;  4ZKP A;  5KJ7 C;  4N6J A;  1M1J C;  2RMZ A;  3K5B A;  3IN6 A;  5D90 A;  2D2C B;  1PFI A;  3KPE A;  4WLS A;  4K35 A;  2C0X A;  1BGY D;  2O01 N;  2QJK C;  2Y0E A;  4C46 A;  4DOJ A;  3EZ6 A;  3H1H E;  4OGQ B;  4XFJ A;  5KJ7 D;  4ASW A;  4DT0 A;  1M56 D;  2JML A;  1H88 A;  1AQT A;  1Q2N A;  3MIW A;  5B5E E;  3AEE C;  1SFC D;  2BAS A;  1SQB E;  1SQB K;  1LT1 A;  5CCG D;  3H1J D;  5KLV J;  1VQ7 P;  1SQV D;  1M8O B;  3WUV A;  5KAI H;  3S9O A;  4PV1 B;  3AE4 C;  3E0H A;  1LTJ A;  4H44 B;  1JBG A;  2PGD A;  3H1K E;  3A0H H;  1PP9 D;  1U7J A;  1NHL A;  2XND H;  4W80 A;  4RES B;  2E43 A;  1NTM G;  2IZ1 A;  1VQ4 P;  1SVF A;  2O3J A;  5KAV A;  3O6Q A;  3GHG B;  2E76 C;  3TGU D;  5KLV E;  2QA4 P;  4HB1 A;  1URQ C;  1IFP A;  4H13 B;  1M90 Q;  2JO1 A;  2E76 D;  2IEF A;  3RK3 D;  1N7S B;  2RH0 A;  2J59 M;  2B89 A;  1KB9 H;  2K9Y A;  4XE5 B;  1S72 P;  1JY2 P;  1SQV E;  5APS A;  3L72 D;  4IL6 E;  1NGM B;  3A0B E;  3L73 E;  3CC7 P;  1KD1 Q;  3FXE A;  3RK3 C;  2KB7 P;  2W27 A;  1J1D B;  3CWB G;  2ZFC A;  2GUS A;  3S4R A;  4Y99 B;  2Q9I A;  1E5W A;  2V7Q J;  3L36 A;  3ZDM A;  5KLV D;  2Y9Z A;  2OQQ A;  1KIL E;  3RBZ A;  1RF1 B;  4PV1 D;  2LXC B;  5BVZ A;  1L0N J;  2OTJ P;  1HUC A;  1MKM A;  1L0N G;  2L91 A;  4U3F J;  1SQX D;  2BCC E;  1GMJ A;  1OX3 A;  4D6T E;  5B66 E;  2YO3 A;  4N78 D;  1EZV D;  1USD A;  1SQV J;  3LUR A;  1AQ5 A;  3HUS A;  1S5L H;  4BWN A;  2IBZ D;  2M5A B;  3CC2 P;  1VQO P;  4C7N B;  5I41 B;  4KT0 J;  2VZ4 A;  2BCC J;  3BAS A;  2Z5I A;  1W2E A;  1CI6 A;  1N7S D;  3IR9 A;  1LX8 A;  3CCQ P;  4RJT A;  1A02 J;  1DIP A;  1EDL A;  1KYO I;  1LTB C;  1NU1 K;  1KIL C;  4IFD K;  3NXS A;  1GTW A;  3EZ7 A;  3MZW B;  3GF3 A;  5I44 A;  3CXH H;  4YPC A;  1SQQ J;  1M7L A;  5AW2 B;  2RKL A;  1LTJ C;  3CX5 E;  2FYU D;  2GOV A;  3PJS K;  1IO4 A;  3A0B H;  2E5Y A;  3I55 P;  1NTZ J;  4RO0 A;  2G3A A;  3SWF A;  3A7O A;  3EZ2 A;  2H8P D;  2IBZ G;  2ZAE B;  4MN4 C;  3RL0 B;  1D7M A;  1SQB D;  3NMD A;  4D6T D;  2KI7 B;  1GL2 A;  4HYT B;  2OAR A;  1RY3 A;  1FAV A;  1RE4 A;  3TNU B;  1BDC A;  3F5H A;  1L0N E;  5KJ7 A;  4UB8 E;  1JO5 A;  5AW0 B;  1DEE G;  4DJG A;  1G1J A;  1HJB A;  1X0T A;  5APV A;  1SQV K;  1SFC A;  2P1J A;  1W5C E;  3L37 A;  1LTJ B;  3RK2 B;  2XV5 A;  5AVW B;  2R32 A;  2YXQ B;  5AW7 B;  1WMK A;  3AEB C;  1NTZ D;  2JKV A;  3V2P A;  5B66 H;  2QJY C;  3HTK B;  1Q05 A;  5KAT A;  4BXL A;  2P67 A;  3AE3 C;  4M3L A;  3B5N A;  1KIL A;  1VQ5 P;  1AVY A;  1T3U A;  1YJ9 P;  2QJP C;  1YI2 P;  2W8Z A;  1GU4 A;  1FC2 C;  1X79 B;  1YYC A;  2AXT E;  2IBZ E;  1YHQ P;  2CPB A;  3EZF A;  1N7S C;  2NPS D;  1L0L E;  1SQP J;  1KIL D;  3UIA A;  1NKN A;  3L70 J;  1NTZ K;  3H1J E;  5TIS H;  3MP7 B;  3L73 D;  2ZYG A;  2GM4 A;  3TF5 A;  2O01 H;  1D5Y A;  4YXD C;  3AEF C;  1M1J B;  3E1I A;  1PP9 G;  4C7R A;  1YQ4 C;  2NPS C;  2KNC B;  4TT3 H;  3MUD C;  3CC4 P;  2H43 A;  1MUU A;  4IL6 X;  1P84 E;  3D6Y A;  1M57 D;  2E74 B;  1LTG C;  3QH9 A;  3IF4 A;  3TK1 A;  4PV1 C;  1KFN A;  1S1C X;  1A02 F;  3R8K A;  1SP4 A;  2E75 B;  3Q5P A;  3M9Q A;  3MUD A;  3G4S P;  3SWK A;  1KQS O;  2QM8 A;  2FXM A;  2K9J A;  2R3S A;  1GK6 A;  1FZG A;  1PV3 A;  5KAX A;  2M8R A;  3B49 A;  1L2P A;  1RHZ B;  1EQ7 A;  3H6P A;  3E7K A;  2KYV A;  2KXP B;  4D6T G;  4JPZ B;  3VTP C;  1X8Y A;  1LGH B;  1SQB G;  1RF1 C;  3G3Z A;  3JC2 2;  2FYU K;  3H1L D;  1FDO A;  2BOW A;  2P7J A;  3CX5 D;  1JTH B;  1ZME C;  3N7N A;  4EYY Q;  2B9B A;  1NTM E;  4KJM A;  4N3Y B;  3B5N D;  1T2K C;  1PM6 A;  1GU5 A;  4O9B A;  3LW5 H;  1BDD A;  2LKM A;  1LT9 B;  3WU2 E;  3RK3 B;  1LWU B;  2HR3 A;  3L35 A;  1PGP A;  1LTA C;  2BCC D;  4NPD A;  2IFN A;  1URQ D;  1IZN B;  1PGQ A;  1OVU A;  2JP3 A;  3VN0 A;  2W83 C;  2WPR A;  1JUN A;  1VQ6 P;  3EWK A;  2A45 G;  3D71 A;  1W2B O;  1QEX A;  3L75 J;  4KHX A;  1BOW A;  5GTI E;  2M3B A;  3Q1M A;  3GG2 A;  1AV1 A;  3L70 E;  5CJ4 A;  1VQP P;  1EZV G;  4GKG A;  1AJY A;  2DW3 A;  3IAO A;  1YJN P;  1BGY G;  1SQX G;  3H1L J;  1L0N D;  3HUS B;  1PGJ A;  5CCH A;  1LT9 C;  3D6Z A;  1KYO H;  3BRT B;  1HJ0 A;  1ZRT D;  1FJP A;  3RL0 C;  1Q09 A;  2FYZ A;  1RF0 C;  1BSN A;  3FX0 A;  3NFQ A;  1RE3 C;  4K3A A;  1JCC A;  2ZHH A;  1IFI A;  1NVO A;  2KVV A;  4EDF A;  3L70 G;  3HTK A;  5AVY B;  1IFD A;  3MTU E;  1FS0 E;  3MGN A;  1MFT A;  2Q5U A;  3I56 P;  1PPJ G;  3OAK A;  3CL3 D;  3H1K J;  4A7P A;  1OIP A;  1Q7Y Q;  2VRS A;  1JEK A;  2YKO A;  2HLO A;  3F89 A;  1J1E B;  3L71 D;  3V2N A;  3SFD C;  2IDB A;  1Q08 A;  5KAF E;  3AEC C;  3CCS P;  3BAT A;  3KZI H;  2PRR A;  3AE9 C;  2POH A;  2QVA A;  3EFG A;  1N73 C;  1S2E A;  3L71 G;  4DZO A;  3TGU G;  1SS1 A;  1L0L D;  5AW1 B;  1CSB A;  3CXH I;  2O1J A;  3VP9 A;  3G9R A;  1QGK B;  3C1L A;  2JEE A;  5KAU A;  1NTM D;  2QJP B;  2XKM A;  2WTY A;  3H32 B;  1VQM P;  5CCG A;  4WY4 B;  3BCC J;  1LTS C;  2WSC J;  4N78 E;  3L71 E;  2WT7 A;  1JY3 N;  1BGY E;  1SFC B;  1VQ8 P;  1OFC X;  3PP5 A;  1NYH A;  2JWD A;  3H1L E;  3A5T A;  3CXH E;  3M9B A;  3G71 P;  4JBZ A;  1OW6 A;  1VF5 B;  2R44 A;  2K1A A;  1EC5 A;  2IBZ I;  2D2C C;  4W7Z A;  4EI2 A;  3B5N B;  1KIL B;  3IFM A;  3I5C A;  2NPS B;  5APW A;  5AW3 B;  3RL0 g;  1R8D A;  1VDF A;  3EFF K;  3H1H J;  1N73 A;  4AUW A;  2K88 A;  1G2C A;  3B5N C;  2M3E A;  3L72 J;  5KAI E;  2UWJ E;  2ZT9 B;  1AVO A;  1T3J A;  1S5L E;  2FYU E;  2IX7 C;  3AED C;  1Y6U A;  3QWO C;  4PJ0 H;  2N9B A;  3JSV C;  1LWU A;  1ZN5 A;  1SQQ K;  5BU5 A;  5KLI B;  1U7M A;  1Q90 D;  3W67 A;  3UCS A;  1H8A A;  1SQX J;  1JOC A;  1JB0 J;  2YO2 A;  1IFN A;  2M0B A;  2BEZ F;  1KB9 I;  3L72 E;  1JY3 O;  1SQP D;  3BCC E;  4EIJ A;  4AYC A;  4H44 C;  1QLE D;  4HJG H;  3FXD A;  1BGY J;  3H1L G;  1S4X A;  4WY4 A;  2WSF H;  1FZC C;  4PD4 D;  3H1J G;  1TU3 F;  2ZVN B;  5KLV K;  2FFD B;  2P58 A;  1URQ B;  1VQL P;  4I7Z B;  1IJD B;  1ZP0 C;  2C0W A;  1S3J A;  2I1K A;  3EQ2 A;  3RL0 D;  2OYI B;  4YTP C;  4EOT A;  5D8C A;  5GTH H;  3TNU A;  1NTZ E;  3B4S A;  4WBA A;  4Y99 C;  5KAF H;  1K73 Q;  2XNX A;  1OW8 A;  2R5D A;  1SQX E;  3LID A;  2FYN C;  2KUB A;  1OXZ A;  1PGO A;  2K9J B;  3OJA B;  1FE6 A;  2OYI C;  5H2F E;  4AQR D;  1KQF B;  4IFM A;  3Q3D A;  1LJ2 A;  2K37 A;  1JY3 P;  2WSF J;  4LHF A;  1IK7 A;  4R22 B;  1PPJ E;  3L73 G;  2KCU A;  4GOD A;  3BVH A;  3CD6 P;  2WPV B;  5K5G B;  4CPG A;  2Y0D A;  2WSS H;  2HOD A;  2JWA A;  4R4L A;  2MJZ A;  1KTM A;  2G8Y A;  2WSC H;  2AEF A;  1JTH A;  1SQP K;  5CCH D;  4WB4 A;  3RBX A;  5M1B A;  1Y9B A;  4JYC A;  3P32 A;  2KIK A;  1T2K D;  1KQG B;  1ZRT E;  3GMA A;  1R8E A;  5TIS E;  3VYI A;  2WIT A;  3CXH D;  3WU2 H;  2YKQ A;  2Q7C A;  2B88 A;  1KQL A;  1NTZ G;  2HPC A;  3VMA A;  3SFE C;  4BRY B;  4Z1M H;  5GTH E;  1PPJ D;  1JMB A;  4RKU J;  2JR8 A;  2CK3 H;  1ZOY C;  5CHX A;  3M0D C;  1L0L J;  1SQP E;  5KAW A;  3PTZ A;  5APX A;  2XU6 A;  4WLW A;  2D2C D;  2BEQ D;  4PD4 E;  1FOS F;  1BE3 J;  1YBK A;  2QSI A;  2NPS A;  4JYB A;  2GA1 A;  3AE2 C;  1ZR4 A;  2HFE D;  3B8E B;  1K9M Q;  1NU1 E;  3FWL A;  4LLH A;  2N1T C;  3V5B A;  4PD4 H;  4U7J A;  2PFX A;  3CWB J;  1G2C B;  1RF1 A;  1X22 A;  3GHG A;  3RK2 D;  2KS1 B;  3ITK A;  1IFJ A;  1VQN P;  2WMM A;  2Z5H A;  5APT A;  2E74 C;  2FYU G;  1Y47 A;  1NOH A;  3U1C A;  2I8D A;  3KDP B;  2OTK E;  3RK2 C;  1NU1 J;  2H88 C;  3H1J J;  1RE3 A;  1EDJ A;  3M91 A;  2FYN B;  1E79 H;  3H1I G;  1EZV I;  4H44 D;  1J1E C;  2MKV A;  5CCH C;  1PP9 J;  3B71 A;  1QL1 A;  1EDI A;  1KC8 Q;  2C9N Y;  1VF5 D;  1JY2 O;  4GOF A;  4OVN F;  3GK6 A;  2R5B A;  1KZU B;  1RH5 B;  1JM0 A;  1MFZ A;  2ZYD A; 
#chains in the Genus database with same CATH homology
 2E74 B;  3RL0 g;  1R8D A;  2FYN C;  1RH6 A;  1Q08 A;  3H25 A;  3LUR A;  1OW7 A;  2HVA A;  2ZHG A;  1Q06 A;  2FXP A;  3AEC C;  2JP3 A;  4PV1 C;  1S1C X;  5KAW A;  4R4E A;  3AEG C;  1YQ3 C;  4H13 D;  4Y28 J;  3R8K A;  5KAV A;  5E01 A;  3O6Q A;  2E75 B;  4H0L B;  2YIU C;  2H89 C;  3Q5P A;  4I7Z C;  3HH0 A;  4WLW A;  2E76 C;  2D2C D;  2ZT9 B;  2BEQ D;  1VF5 C;  2P10 A;  3AE9 C;  1KQF B;  1K04 A;  3Q3D A;  3AED C;  3EWK A;  1HF9 A;  1Y6U A;  5I41 B;  1U57 A;  2WSF J;  3AE5 C;  2WQY C;  4AYZ B;  4KT0 J;  4LHF A;  1IK7 A;  4R22 B;  3D71 A;  2NZ2 A;  2QSI A;  4OGQ C;  1BOW A;  3GLM A;  2FBW C;  4H13 B;  3EZ9 A;  2VZ4 A;  4IL6 X;  3AE2 C;  4H13 C;  4R4M A;  2JO1 A;  3G9R A;  2E76 D;  2KCU A;  2IEF A;  1Q90 D;  3R4Y A;  3Q1M A;  2E75 C;  2E74 D;  3UCS A;  5KAU A;  5L8R J;  1JYH A;  5KKZ C;  2K9Y A;  1WMK A;  1RQV A;  2WPV B;  1JB0 J;  3AEB C;  2OG0 A;  1DD3 A;  1PL5 A;  1PV3 A;  3GF7 A;  4AYZ A;  5KAX A;  1LX8 A;  3T97 B;  2WSE J;  1OMI A;  4OGQ D;  2BEZ F;  2O01 J;  2QJY C;  4U7J A;  1AJY A;  3D70 A;  1KMI Z;  4R4L A;  3B49 A;  1KOR A;  1NGM B;  3R8J A;  1Q05 A;  3IAO A;  1DIP A;  5KAT A;  1UIX A;  1KTM A;  3AEA C;  3AE3 C;  1Q07 A;  3IN6 A;  5D90 A;  2D2C B;  2G8Y A;  2DG6 A;  3GP4 A;  3EZ7 A;  3GF3 A;  4WLS A;  4H44 C;  5I44 A;  3AE8 C;  2WSC J;  3AE1 C;  2QJK C;  2E74 C;  3QAO A;  5M1B A;  3D6Z A;  1Y9B A;  1VL2 A;  4GDO A;  3Q5S A;  2E75 D;  2ZT9 D;  1PIX A;  1FDI A;  1HJ0 A;  2QJP C;  3EZ6 A;  4OGQ B;  1Q09 A;  4XFJ A;  5GQQ A;  2GOV A;  3Q2Y A;  1EXJ A;  1TU3 F;  1EXI A;  3ABV C;  1FDO A;  1KQG B;  1ZRT E;  2QIW A;  3LW5 J;  2V7Q J;  2BOW A;  1Q0A A;  3GMA A;  1NYH A;  2ZHH A;  2JML A;  1R8E A;  1ZME C;  2H88 C;  2E76 B;  3EZF A;  4I7Z B;  3AEE C;  1K05 A;  2G3A A;  1RQU A;  1OW6 A;  1DD4 A;  2KVV A;  2ZT9 C;  4H0L C;  3RK3 E;  5KLI C;  2OQQ A;  1VF5 B;  1KIL E;  4PV1 D;  1ZP0 C;  3AE6 C;  3EZ2 A;  3FGA D;  4H44 D;  3SFE C;  2MKV A;  1PM6 A;  3SFD C;  4Z1M H;  2J5U A;  3C8V A;  3S9O A;  2D2C C;  4PV1 B;  3B71 A;  1S5L X;  1VF5 D;  1MKM A;  3GK6 A;  4R24 B;  4YTP C;  1D5Y A;  3Q5R A;  3AE4 C;  4H0L D;  5D8C A;  4H44 B;  4YXD C;  3E0H A;  2YMK A;  4DCZ A;  3AEF C;  3GPV A;  1GMJ A;  4RKU J;  1YQ4 C;  4J2N A;  1JBG A;  1ZOY C;  5KCB A;  4A1M A;  4TT3 H;  4B0Y A;  1OW8 A;  2IDB A;  3AE7 C;  3D6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...