3IAOA

Conformational plasticity of the coiled coil domain of bmrr is required for bmr promoter binding-the unliganded structure of bmrr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
273
Chain Sequence
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTSSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity of the coiled-coil domain of BmrR is required for bmr operator binding: the structure of unliganded BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 73
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3iaoA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3iaoA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3iaoA03
5KAWA 5KAVA 1Q07A 5KAXA 3D70A 4AYZA 3R8KA 3Q3DA 4WLWA 2JMLA 4R4EA 1D5YA 3UCSA 5GQQA 5D90A 1Q09A 2ZHHA 3B49A 1EXIA 3T97B 1R8DA 5KAUA 1BOWA 4AYZB 3G9RA 1JBGA 5I44A 3E0HA 3Q5RA 3HH0A 2OQQA 2KCUA 2GOVA 3R8JA 2VZ4A 4A1MA 1Q06A 2HVAA 1Q05A 3Q5PA 3Q2YA 2J5UA 2BOWA 3GK6A 5KATA 4B0YA 3Q1MA 3GP4A 4R24B 3D71A 4R22B 5D8CA 3D6ZA 3QAOA 1DIPA 4R4MA 3LURA 1R8EA 1EXJA 3GPVA 4J2NA 3IAOA 5I41B 5E01A 2ZHGA 4R4LA 1Q0AA 4WLSA 1JYHA 5KCBA 3D6YA 2DG6A 3Q5SA 1Q08A
chains in the Genus database with same CATH superfamily
2JP3A 4XE5B 2K88A 2YO3A 1L0NJ 1UIXA 1S72P 2OYHB 5AVRB 1CSBA 2YNYA 5AW1B 3KPEA 2FYUK 3TGUG 3E1RA 2N1TD 3WUTA 1ZMEC 3EZ2A 1JTHB 1L0NK 1IFDA 4NPDA 2WQYC 3AEEC 4PJ0H 1JO5A 4L74A 1OX3A 2BOWA 1SQVE 3H1HJ 4D6TD 2AXCA 2W8ZA 2JDIH 4Y99B 3TGUJ 3Q5SA 1T3UA 2AEMA 1BE3J 1K05A 5AW7B 2QJKC 1L0LG 2IPPA 1QEXA 2D2CB 2HPCA 4GT1A 1Q05A 1Y9BA 1JCCA 1QX8A 2W6AA 3CXHH 3G3ZA 2GM4A 2G8YA 3H1HE 1S5LE 3C9IA 4KT0J 2ZYAA 4ASVA 1VQMP 1FZCB 3JCUH 1SQQG 3L74J 2O01J 4H44D 3U59A 2N9BA 3H1KJ 3EFFK 2FYNB 1NU1D 1YYCA 1USDA 5KLIC 1KORA 2FYNC 1NU1E 5DJUB 2RH0A 4I6MC 3C8VA 3ITKA 5AVXB 3TGUD 1KYOH 4WVZA 5APYA 1CI6B 3TF5A 3L75J 3HE4B 1IFIA 1JOCA 5H2FH 1NTMD 1UIIA 3NXSA 4YPCA 4JPZB 2ZJSE 2G3AA 5M1BA 3CCEP 4WY4D 1HBWA 1N73B 1BGYG 2FY8A 1NTKK 3FXEA 1L2PA 1AA0A 1MKMA 1AVYA 4D6TE 2HR3A 2A45H 2KSJA 1DD4A 2ZT9B 1OZHA 3PTZA 2ZFCA 3U1AA 1KQLA 4U7JA 5KAXA 1XTGB 2AEJA 3CCUP 2I1KA 4H44B 3EZ6A 5CJ4A 2AEFA 3RGUA 2XNDH 4W7YA 4EIJA 1JY2O 2IYOA 3PP5A 1PIXA 3TSIA 3MZWB 4WWIA 3V2RA 4PJ0E 1P84D 2NPSD 1ZXGA 3A0HE 3B8EB 3BCCG 3EZ9A 1ZN5A 3SWFA 1LT9A 1M57D 3FWNA 4OGQD 3OA7A 1N2DC 4H44C 2FFDC 2QIWA 1YIJP 3I55P 2PFXA 1JMBA 2KS1B 1L0LK 1BE3G 2I8DA 3M9QA 3A5TA 5TISE 3GK6A 2JEEA 1VQNP 3EQ2A 3RL0C 4CPGA 1X22A 2FYUE 2Q1KA 1LWUA 1OW6A 2O01N 3CCVP 3NFQA 5AVYB 2POHA 1L0NE 2BCCJ 3AEFC 1M1JC 3BCCJ 3QAOA 3NMDA 4DCZA 3CCJP 4UB6H 1WRGA 3TK1A 4GKGA 3U1CA 2LR2A 1YI2P 4HYTB 2WMMA 1NHLA 4B86A 4HH2A 1RQUA 1FBMA 3RL0B 3OAKA 4PD4H 1GL2C 1QVGO 1LTTC 1EC5A 2HG5D 1RF1A 1IJDB 2BEZF 3P7KA 5KKZC 5E79H 1Z56A 2WZ7A 4YXDC 1FZCC 1AFOA 4GOFA 3P8MC 1Y47A 3CMEP 1G1JA 2K9YA 3KYQA 3HTKA 3CCQP 5KLVG 1NTZG 1M1JB 1Q09A 5KLIB 1RF1B 1ZW0A 4PV1B 2IZ1A 4H13D 3BRVB 2K9JA 2JR8A 1GZLA 2YO2A 5CHXA 1H8AA 3QWOC 2KP8A 3SWKA 3W67A 1M56D 2M0BA 3F5HA 2N1TC 1YITP 1FDIA 1VQ5P 5GTIH 3M9HA 3UCSA 4BRYA 1ZOYC 3RK3B 2YIUB 1M7LA 2E75C 2KXPB 2AXTH 1N7SD 3A2AA 3L74E 4I1LA 2R32A 1RH5B 3AEDC 3EZFA 1W2EA 3RK2C 4AYCA 5KTBA 4WLSA 1MFZA 5CCGC 1Y8AA 1AJYA 2OYOA 3RL0D 2QM7A 3LW5J 4W7ZA 1VF5B 3M9BA 4L73A 4ZKUA 5CCHD 1T2KC 1L0NG 1OW7A 1SQBG 1HJ0A 3L71J 1H0TA 4H0LC 2HYNA 1GL2A 1J2JB 1Q86Q 2LKMA 2YXRB 3WMM0 1PV3A 2FYUG 3AE6C 1BGYD 4DT0A 3G9RA 2Y9ZA 4KJMA 1K8AQ 3GHGB 3JSVC 1ZR2A 3VMXA 2GUVA 5KAFE 2IZ0A 3K5BA 1G2CA 2KNCA 1BCCD 1MFTA 5AVTB 2C0WA 1SQBE 3VMAA 2E75D 1ZRTE 3H1JE 1QVFO 3O8ZA 1FU1A 2OTKE 2QEXP 2JO1A 1EXJA 1HGVA 2M5AA 1NH4A 3E1IA 3CC2P 5CCGD 2QE7H 1USEA 2R3SA 2OYHC 2ZYDA 5GQQA 5AW5B 1FAVA 1KV4A 5APXA 2QJPB 1NTMG 1BGYJ 2WSSH 2WVRA 3L74G 3D6ZA 1PPJG 1IC2A 1NTMJ 1R5LA 1PPJD 3RK3E 1LNQA 1S4XA 2OARA 1KQSO 5AVZB 3RK2D 3H6PA 4AYZB 5BVZA 3E0HA 1SQXE 2B87B 4D6TG 1CI6A 1LJ2A 2FYUD 3M91A 1T6AA 1BGYE 4LC1A 2V7QJ 2LXCB 3VMYA 1LTBC 1PFIA 1Q2NA 1L4AA 2Y0CA 2QSIA 4GODA 1WT6A 2OGUA 4GDOA 1NTKE 1LTJB 2PAJA 3AE8C 1BSNA 1L4AB 3L72J 2IBZD 1IFMA 4WLWA 1N7SB 1NTKG 2OYIA 4DZOA 1LT9C 2UWJE 3H1JJ 1KB9D 2A06G 1RF1C 1PP9E 3M06A 2DW3A 2E42A 3G6EP 3AEGC 3VP9A 2WSFJ 3P8CE 1D5YA 3AE3C 2A45G 4OGQB 3T97A 1N86A 2E74D 2YIUC 1Q06A 3EZ7A 3O6QA 1N7SC 1YTZI 3WU2E 2E5TA 3CCMP 1PPJE 1BDCA 3CCRP 1SQQD 1NTME 2IEFA 2H7HA 1PGJA 2YKPA 2E43A 2CPSA 2FFDA 5KAIE 1W2BO 2WPSA 1SQPK 4U3FG 2H89C 3MUDA 3D71A 2J59M 1LT9B 1SQXJ 3CCLP 2W83C 1VQLP 1PP9G 3PHLA 1DEBA 4A7PA 2YXQB 3BCCE 3PJSK 4U3FD 4RESB 2ZXXA 3AEAC 4H0LD 5KKZB 3P32A 2K9JB 1N7LA 1J1EC 3MD0A 3V5BA 2PRRA 3R8JA 1GDTA 3L73E 4JBZA 1NTZD 5APUA 1LP1B 4KHXA 5CBOA 1SP4A 3V6IA 1H0TB 2XDJA 3CXHD 2MKVA 3V2PA 1RF0A 1EXIA 1BCCJ 2R44A 3CWBG 1PGQA 4N78D 3VTPC 4C7NB 2YKQA 2V4HA 4JQ0D 1NGMB 1LWUC 1Q08A 1KN7A 4PV1D 4H13B 5TISH 5AVSB 3SWYA 2N1TA 3L75E 3TNUA 4EI2A 1URQC 1M1KQ 4JYBA 4IFDK 3B5NC 2Q9IA 2FXMA 3M0DC 1URQA 1X9VA 1P84I 3BATA 5AW2B 4HKZH 4H0LB 1GK4A 2L91A 1NU1G 3IR9A 1Q82Q 2ZVOB 1LTAC 2FXOA 3GPVA 5I41B 3MTUE 2WITA 3HUSB 1M8OB 3UIAA 2B88A 2M3BA 1PL5A 5CBNA 4C46A 4WY4B 3I56P 3H1HG 3HD7A 2RN0A 3L73D 3AE1C 5APSA 4B0YA 1VQ8P 1PP9D 3MP7B 2WTYA 1KILA 4WY4A 5KAIH 2XNXA 3VOPA 2P1JA 4IOIH 1SQPD 1SFCD 1VPCA 1QL2A 5I44A 3VYIA 2HODA 1VQPP 2WSCJ 2A45I 2KLVA 1SQVG 2Y0DA 3L70D 3S4RA 1RY3A 5B5EE 1VQ9P 4J2NA 3GMAA 2PP6A 1KYOI 3W68A 2A06E 1NTMK 2WSEJ 4JYCA 3B5NA 2I1JA 2GUSA 1Q7YQ 2WSCH 2XZRA 1LP1A 3FGAD 1DH3A 2Y9YA 3I5CA 3L71G 1GW4A 2KIKA 3L70G 1URQD 4BRYB 2O1KA 3V4QA 1PP9J 1P84E 1OVUA 2Z4EA 4Z1MH 1YJNP 1TU3F 1SFCA 2OYHA 1NYHA 1HH0A 3Q1MA 3RK3D 1X0TA 3USSA 3V4WA 1S1CX 1JTHA 3KDPB 2E76B 4ZNCA 1VQKP 1SQXG 2R3CA 1JY2N 1L4AD 1OVVA 2KYVA 2OTJP 3KXDA 1NU1K 4Y99C 1YJ9P 3R2PA 5AVUB 1DEEG 3AECC 2BEQD 2FKWB 1HUCA 1M90Q 5CCHA 4R4EA 2QVAA 4K3AA 4Y28J 3H25A 1JUNA 2Z5HA 1NU1J 4NPFX 3GLMA 1K04A 2K1AA 1HJBA 1IO4A 3FX0A 2E74B 4NPEA 3L75G 2P7JA 2WPQA 1L0LJ 4GIFA 1ZLLA 1VL2A 5APVA 1SQVJ 1KILE 4I7ZC 5KLVE 1J1DB 2ZAEB 3QH9A 2O01H 1QL1A 4XA4A 3HD7D 1RHZB 5GTHH 2W6JH 4OGQC 1S5LH 2IBZI 4IL6E 2C9NY 3TYYA 4D6TJ 1RQVA 2JKVA 1HF9A 3L70E 4W80A 1GU5A 4GOEA 1PGOA 1FZGA 3L71E 3LIEA 2FBWC 3H1IG 5AW9B 1SQXD 3VMZA 4AYZA 1N73A 1FC2C 3LIDA 1J1DC 1Y6UA 1W5CE 1LTIC 1N73C 2Q3IA 3LW5H 3L73J 2SPZA 3O6QB 3L74D 1KB9I 1SQBJ 3HUSA 4C7RA 1X8YA 2N9YB 3PRJA 2KCUA 3JC22 4PV1C 4H13C 2WSFH 5B66E 1FDOA 1QLED 5E01A 3AE9C 1FJKA 3RBXA 4N3YB 5CCHC 4DCKA 5KAUA 2KI7B 1YQ4C 3N4XA 1GW3A 2O3JA 4RJTA 3L75D 1GK6A 3G71P 2Q5UA 5KJ7D 5APQA 1EZVD 1T8ZA 2WPVB 1LTJC 3HE4A 2L5GB 1LTGC 2QJKB 1NO4A 1KQFB 1LTJA 2V7QH 3H1JD 1OFCX 5AW0B 1L0ND 3ABVC 1KMIZ 1S9KE 1PGPA 1EZVE 2FXPA 1RE4A 4IL6X 4UB8E 3PLNA 2R5DA 3RK2B 2R5BA 4LGDE 3CXHI 3HUSC 2JJLA 4UB8H 1ZV8A 1SFCB 5EFWB 2HPCB 4IL6H 1SFCC 1KILD 3H32B 5KAVA 1T2KD 2BASA 1KB9E 1YHQP 3CX5H 1DX7A 1EDIA 2HLOA 3L36A 2E74C 2NPSA 1NWQA 4O9BA 3HD7B 3L73G 3KQGA 5CCGA 1JCDA 4AUWA 4MN4C 4N78E 3CCSP 3H1ID 1KFMA 3L71D 3VP8A 2YMKA 4ZMDA 1JBGA 1U7JA 1P84H 4R22B 1Q90D 4U3FE 3LURA 1R8EA 3H1JG 1JY3P 3CX5E 3L72D 3V2QA 1AVOA 3AE4C 1U57A 4BWNA 2JMLA 1NTKJ 2QRXA 5D90A 2JWAA 4I2LC 3BCCD 3Q5RA 3AEBC 1A02J 5TJHA 5KATA 3R4YA 4R4LA 3CC4P 4IFMA 2DG6A 1KQGB 1KILB 1HTLC 2XU6A 3HRNA 5KLVD 5K5GB 3AE7C 1KB9H 1VF5C 4M3LA 1NOHA 3CXHE 2MJZA 2OYIC 2J58A 2Q7CA 4AQRD 2IDBA 2KS1A 3A3YB 1BDDA 4HB1A 2P58A 3L35A 3B5NB 5BU5A 2QJYB 1CW5A 3P8CD 2KVVA 2VRSA 2B9BA 1H89A 4WBAA 2WWWA 5D8CA 1NVOA 3H1LE 1FZEA 2P2UA 2KOGA 1Q07A 4K35A 4OH8B 2P10A 2QA4P 1NTZK 1LT1A 1FOSF 3ZDMA 3MGNA 2A06D 2LXBA 4XFJA 2P67A 2JWDA 2KZJA 1ZR4A 1NJIQ 2D2CC 3S1KA 4RKUJ 1FZBA 1K73Q 1G1IA 3CX5I 4WY4C 3HE5A 2OG0A 1MZ9A 3WUUA 1GL2B 1SQPJ 1R8DA 2KZIA 3IN6A 2OQQA 5AVVB 3L70J 5AW8B 4TT3H 1Q0AA 1SQQK 2OTLP 2M5AB 2FYZA 2Y0EA 1G2CB 1SQBK 1NKNA 2KNCB 1GD2E 2IX7C 4ASWA 2Z5IA 3II6A 1PZQA 2NZ2A 5DJTB 3L4FA 1SQPE 1CZQA 2W6BA 3A0BE 3SFEC 1RE3A 2RMZA 3A7OA 1KZUB 2ZXEB 2KUBA 3L37A 3EWKA 3A0BH 3VN0A 1KC8Q 3Q3DA 1IK7A 1EQ7A 1YBKA 2BCCD 3AE2C 1BSHA 1AQTA 5AW3B 2Q6QA 1S9KD 1H88A 2KK7A 2ITAA 2BCCG 1SLQA 3T97B 3F89A 1AV1A 1BCCG 4RO0A 1GMJA 1BE3D 2M3EA 3H1LJ 3GW6A 4JF7A 4ZKPA 3NTNA 1BOWA 4EDFA 2PGDA 3FWLA 2B89A 1KD1Q 3KZIE 2NPSC 1GTWA 5B66H 5KJ7C 1DIPA 2ZT9D 1D7MA 2KLUA 4PD4D 1EZVG 3CPWO 2D2CD 4PD4E 1KYOD 1FZFA 5B5EH 3HH0A 4DJGA 2XV5A 4L76A 3CD6P 2YKOA 1S3JA 1FJPA 2C0XA 2IBZG 3L72E 2KSEA 2M8RA 3HTKB 3B5ND 4U3FJ 3GHGC 1M1JA 1IK9A 1EDJA 3MHVA 3B49A 2ZHHA 3RBZA 1OVRA 1VF5D 1E79H 3M0AA 3H1KG 1KILC 1JY3O 1YTZT 3Q2YA 1OW8A 3GF3A 3FXDA 1Q81Q 5KCBA 5APWA 2CK3H 1NTZE 1FS0E 1AQ5A 1RF0C 3BVHA 4IFFA 3SFDC 4OWFA 3GG2A 1U7MA 2NRGA 3CWBJ 1RE4C 4LLHA 4R24B 2ZT9C 5GTHE 3CMAP 3RL0g 2N1TB 1GL2D 3MIWA 2ZVNB 1VQ6P 2E75B 1MV8A 3MUDC 1K9MQ 2AXTE 2K37A 3EFGA 2GOVA 4C7NA 1EZVI 2FFDB 1HGZA 1A02F 3GF7A 2HODB 5AW6B 1HWTC 1KYOE 1FZCA 1SQQE 2HVAA 1FDMA 1VQ4P 4PD4I 5CMZA 2QG4A 3SSUA 3V2NA 3TNUB 3TDKA 1YQ3C 1EDLA 3RK3C 3CC7P 2NPSB 2BCCE 3WUVA 2B87A 4YXWH 3OW2O 1BE3E 3IFMA 1N7SA 1L0LD 2OYIB 2ZYGA 3D70A 3H32A 4OVNF 1L4AC 2VZ4A 3Q5PA 4N6JA 2WT7B 5KAFH 3GP4A 1T3JA 2QJYC 1QGKB 1IFPA 5KAWA 1IZNB 1NAYA 3H1KE 1GU4A 1NTZJ 1VQ7P 5CJ0A 3H1KD 3KZIH 3M0DA 1OXZA 1MUUA 1DD3A 2Q3EA 4R4MA 2IFNA 3CLQA 4HJGH 4LHFA 1NKZB 1PM6A 1URQB 1XTCC 1RH6A 1VQOP 2O1JA 2H43A 1WMKA 3H1LD 1IFJA 1JMMA 1X79B 2ZHGA 1SQBD 5AW4B 3HD7C 5BU8B 1N8RQ 1HVVA 1R5SA 4L75A 5H2FE 3OJAB 1SQQJ 2E76D 3H1HD 3N7NA 3B71A 2XKMA 3BRTB 2QM8A 3KHUA 2IBZE 2C9LY 4EOTA 3H1IJ 2E5YA 3HE5B 2W27A 2RKLA 4A1MA 4WB4A 1SQVD 2W90A 1JB0J 3R8KA 3PH0A 3S9OA 1LGHB 3C1LA 3WU2H 3IF4A 1NTKD 2WSEH 2HFED 3GHGA 5KLVK 3H1IE 1BCCE 1KTMA 3CWBD 4UB6E 3CI9A 1L0LE 3D6YA 2J5UA 1ZRTD 1S5LX 1RE3C 4BXLA 1NAFA 4TLFA 2H88C 2GA1A 3CX5D 5KLVJ 5APTA 1SQVK 3B4SA 5GTIE 4DOJA 1SS1A 2K3RA 5KJ7A 1JEKA 1SVFA 5C39A 1IFNA 2QJPC 1SQPG 4I7ZB 1JY3N 1JNMA 2H8PD 2CPBA 4EYYQ 5AVWB 1S2EA 1KFNA 3TGUE 2E76C 3JCUE 3A0HH 3IAOA 3H1LG 1SQXK 2WPRA 3L72G 5E79E 1E5WA 1OWAA 3CL3D 1JY2P 4YTPC 1LX8A 1J1EB 1LTSC 1LWUB 2KB7P 2IFMA 1YJWP 3BASA 1OIPA 1FOSE 1ZP0C 5AVQB 1FE6A 3AE5C 2YMYA 1EDKA 5L8RJ 2IYPA 1JM0A 3E7KA 1FZAA 2FYUJ 1VDFA 3CWBE 2WT7A 1OMIA 4QMAA 3G4SP 1JYHA
chains in the Genus database with same CATH topology
3AE9C 3C8VA 3AEGC 1S5LX 2QIWA 1Q07A 2WSFJ 2JP3A 1PM6A 1GMJA 2P10A 4PV1D 1FDIA 4H13B 1D5YA 2E75B 1RH6A 1VL2A 3UCSA 2H88C 3AE3C 5GQQA 1UIXA 2YMKA 1ZOYC 4OGQB 2E75C 1WMKA 1BOWA 4XFJA 5KAUA 3FGAD 1KILE 4I7ZC 1JBGA 2E74D 2GOVA 2YIUC 1Q06A 3EZ7A 3O6QA 1YQ4C 2D2CC 3GK6A 4R22B 3GF7A 1Q90D 3D6ZA 3AEDC 3EZFA 2ZT9D 4RKUJ 1DIPA 3LURA 1R8EA 2ZHGA 1ZMEC 3EZ2A 4WLSA 2G3AA 5M1BA 2HVAA 3AE4C 4OGQC 1AJYA 2QJPC 2D2CD 1U57A 3RK3E 2OG0A 2IEFA 1OW6A 4I7ZB 2JMLA 2E76D 2WPVB 5D90A 4H0LB 4Z1MH 1R8DA 3LW5J 4AYZB 3B71A 3IN6A 2WQYC 1RQVA 3Q5RA 1TU3F 3HH0A 2OQQA 3AEEC 3AEBC 1HF9A 3E0HA 1MKMA 1VF5B 1NYHA 2H89C 1KQFB 5KATA 3AEFC 2BOWA 3Q1MA 3D71A 3R4YA 3QAOA 1OW7A 1YQ3C 2E76C 2FBWC 3GPVA 4TT3H 3IAOA 5I41B 4R4LA 4DCZA 1Q0AA 1S1CX 1DD4A 2ZT9B 1HJ0A 2DG6A 1KQGB 3Q5SA 4U7JA 2V7QJ 4H0LC 3ABVC 2E76B 1KMIZ 3D70A 1PL5A 5KAXA 4AYZA 4H0LD 3AEAC 4YTPC 1LX8A 1K05A 2FXPA 4H44B 3AE7C 2QJKC 3EZ6A 4IL6X 1VF5C 2ZHHA 1PV3A 3B49A 2QSIA 3AE6C 1Y6UA 3G9RA 1VF5D 1RQUA 2D2CB 3R8JA 4GDOA 2NZ2A 2VZ4A 4A1MA 1Q05A 3Q5PA 3Q2YA 1Y9BA 1PIXA 3GP4A 2BEZF 3AE1C 1OW8A 3GF3A 3SFEC 1Q08A 5KKZC 3AE8C 4B0YA 2QJYC 1JB0J 1ZP0C 4YXDC 3AECC 2BEQD 2G8YA 5KCBA 4KT0J 2IDBA 5KAWA 5KAVA 3EWKA 2K9YA 3AE5C 3R8KA 3Q3DA 3S9OA 4WLWA 4R4EA 1IK7A 2MKVA 5L8RJ 1Q09A 3SFDC 3EZ9A 4Y28J 1EXIA 2E75D 2O01J 1ZRTE 3T97B 4H44D 3AE2C 3H25A 2KVVA 5I44A 4PV1B 2E74C 2KCUA 2WSCJ 4H13D 3GLMA 2J5UA 4PV1C 4H13C 1K04A 4OGQD 4R24B 5D8CA 2ZT9C 5KLIC 1KTMA 1DD3A 1KORA 2FYNC 2JO1A 4R4MA 1EXJA 4J2NA 1FDOA 2E74B 1OMIA 3RL0g 3GMAA 4H44C 1JYHA 3D6YA 1NGMB 5E01A 2WSEJ 4LHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAW A;  5KAV A;  1Q07 A;  5KAX A;  3D70 A;  4AYZ A;  3R8K A;  3Q3D A;  4WLW A;  2JML A;  4R4E A;  1D5Y A;  3UCS A;  5GQQ A;  5D90 A;  1Q09 A;  2ZHH A;  3B49 A;  1EXI A;  3T97 B;  1R8D A;  5KAU A;  1BOW A;  4AYZ B;  3G9R A;  1JBG A;  5I44 A;  3E0H A;  3Q5R A;  3HH0 A;  2OQQ A;  2KCU A;  2GOV A;  3R8J A;  2VZ4 A;  4A1M A;  1Q06 A;  2HVA A;  1Q05 A;  3Q5P A;  3Q2Y A;  2J5U A;  2BOW A;  3GK6 A;  5KAT A;  4B0Y A;  3Q1M A;  3GP4 A;  4R24 B;  3D71 A;  4R22 B;  5D8C A;  3D6Z A;  3QAO A;  1DIP A;  4R4M A;  3LUR A;  1R8E A;  1EXJ A;  3GPV A;  4J2N A;  3IAO A;  5I41 B;  5E01 A;  2ZHG A;  4R4L A;  1Q0A A;  4WLS A;  1JYH A;  5KCB A;  3D6Y A;  2DG6 A;  3Q5S A;  1Q08 A; 
#chains in the Genus database with same CATH topology
 2JP3 A;  4XE5 B;  2K88 A;  2YO3 A;  1L0N J;  1UIX A;  1S72 P;  2OYH B;  5AVR B;  1CSB A;  2YNY A;  5AW1 B;  3KPE A;  2FYU K;  3TGU G;  3E1R A;  2N1T D;  3WUT A;  1ZME C;  3EZ2 A;  1JTH B;  1L0N K;  1IFD A;  4NPD A;  2WQY C;  3AEE C;  4PJ0 H;  1JO5 A;  4L74 A;  1OX3 A;  2BOW A;  1SQV E;  3H1H J;  4D6T D;  2AXC A;  2W8Z A;  2JDI H;  4Y99 B;  3TGU J;  3Q5S A;  1T3U A;  2AEM A;  1BE3 J;  1K05 A;  5AW7 B;  2QJK C;  1L0L G;  2IPP A;  1QEX A;  2D2C B;  2HPC A;  4GT1 A;  1Q05 A;  1Y9B A;  1JCC A;  1QX8 A;  2W6A A;  3CXH H;  3G3Z A;  2GM4 A;  2G8Y A;  3H1H E;  1S5L E;  3C9I A;  4KT0 J;  2ZYA A;  4ASV A;  1VQM P;  1FZC B;  3JCU H;  1SQQ G;  3L74 J;  2O01 J;  4H44 D;  3U59 A;  2N9B A;  3H1K J;  3EFF K;  2FYN B;  1NU1 D;  1YYC A;  1USD A;  5KLI C;  1KOR A;  2FYN C;  1NU1 E;  5DJU B;  2RH0 A;  4I6M C;  3C8V A;  3ITK A;  5AVX B;  3TGU D;  1KYO H;  4WVZ A;  5APY A;  1CI6 B;  3TF5 A;  3L75 J;  3HE4 B;  1IFI A;  1JOC A;  5H2F H;  1NTM D;  1UII A;  3NXS A;  4YPC A;  4JPZ B;  2ZJS E;  2G3A A;  5M1B A;  3CCE P;  4WY4 D;  1HBW A;  1N73 B;  1BGY G;  2FY8 A;  1NTK K;  3FXE A;  1L2P A;  1AA0 A;  1MKM A;  1AVY A;  4D6T E;  2HR3 A;  2A45 H;  2KSJ A;  1DD4 A;  2ZT9 B;  1OZH A;  3PTZ A;  2ZFC A;  3U1A A;  1KQL A;  4U7J A;  5KAX A;  1XTG B;  2AEJ A;  3CCU P;  2I1K A;  4H44 B;  3EZ6 A;  5CJ4 A;  2AEF A;  3RGU A;  2XND H;  4W7Y A;  4EIJ A;  1JY2 O;  2IYO A;  3PP5 A;  1PIX A;  3TSI A;  3MZW B;  4WWI A;  3V2R A;  4PJ0 E;  1P84 D;  2NPS D;  1ZXG A;  3A0H E;  3B8E B;  3BCC G;  3EZ9 A;  1ZN5 A;  3SWF A;  1LT9 A;  1M57 D;  3FWN A;  4OGQ D;  3OA7 A;  1N2D C;  4H44 C;  2FFD C;  2QIW A;  1YIJ P;  3I55 P;  2PFX A;  1JMB A;  2KS1 B;  1L0L K;  1BE3 G;  2I8D A;  3M9Q A;  3A5T A;  5TIS E;  3GK6 A;  2JEE A;  1VQN P;  3EQ2 A;  3RL0 C;  4CPG A;  1X22 A;  2FYU E;  2Q1K A;  1LWU A;  1OW6 A;  2O01 N;  3CCV P;  3NFQ A;  5AVY B;  2POH A;  1L0N E;  2BCC J;  3AEF C;  1M1J C;  3BCC J;  3QAO A;  3NMD A;  4DCZ A;  3CCJ P;  4UB6 H;  1WRG A;  3TK1 A;  4GKG A;  3U1C A;  2LR2 A;  1YI2 P;  4HYT B;  2WMM A;  1NHL A;  4B86 A;  4HH2 A;  1RQU A;  1FBM A;  3RL0 B;  3OAK A;  4PD4 H;  1GL2 C;  1QVG O;  1LTT C;  1EC5 A;  2HG5 D;  1RF1 A;  1IJD B;  2BEZ F;  3P7K A;  5KKZ C;  5E79 H;  1Z56 A;  2WZ7 A;  4YXD C;  1FZC C;  1AFO A;  4GOF A;  3P8M C;  1Y47 A;  3CME P;  1G1J A;  2K9Y A;  3KYQ A;  3HTK A;  3CCQ P;  5KLV G;  1NTZ G;  1M1J B;  1Q09 A;  5KLI B;  1RF1 B;  1ZW0 A;  4PV1 B;  2IZ1 A;  4H13 D;  3BRV B;  2K9J A;  2JR8 A;  1GZL A;  2YO2 A;  5CHX A;  1H8A A;  3QWO C;  2KP8 A;  3SWK A;  3W67 A;  1M56 D;  2M0B A;  3F5H A;  2N1T C;  1YIT P;  1FDI A;  1VQ5 P;  5GTI H;  3M9H A;  3UCS A;  4BRY A;  1ZOY C;  3RK3 B;  2YIU B;  1M7L A;  2E75 C;  2KXP B;  2AXT H;  1N7S D;  3A2A A;  3L74 E;  4I1L A;  2R32 A;  1RH5 B;  3AED C;  3EZF A;  1W2E A;  3RK2 C;  4AYC A;  5KTB A;  4WLS A;  1MFZ A;  5CCG C;  1Y8A A;  1AJY A;  2OYO A;  3RL0 D;  2QM7 A;  3LW5 J;  4W7Z A;  1VF5 B;  3M9B A;  4L73 A;  4ZKU A;  5CCH D;  1T2K C;  1L0N G;  1OW7 A;  1SQB G;  1HJ0 A;  3L71 J;  1H0T A;  4H0L C;  2HYN A;  1GL2 A;  1J2J B;  1Q86 Q;  2LKM A;  2YXR B;  3WMM 0;  1PV3 A;  2FYU G;  3AE6 C;  1BGY D;  4DT0 A;  3G9R A;  2Y9Z A;  4KJM A;  1K8A Q;  3GHG B;  3JSV C;  1ZR2 A;  3VMX A;  2GUV A;  5KAF E;  2IZ0 A;  3K5B A;  1G2C A;  2KNC A;  1BCC D;  1MFT A;  5AVT B;  2C0W A;  1SQB E;  3VMA A;  2E75 D;  1ZRT E;  3H1J E;  1QVF O;  3O8Z A;  1FU1 A;  2OTK E;  2QEX P;  2JO1 A;  1EXJ A;  1HGV A;  2M5A A;  1NH4 A;  3E1I A;  3CC2 P;  5CCG D;  2QE7 H;  1USE A;  2R3S A;  2OYH C;  2ZYD A;  5GQQ A;  5AW5 B;  1FAV A;  1KV4 A;  5APX A;  2QJP B;  1NTM G;  1BGY J;  2WSS H;  2WVR A;  3L74 G;  3D6Z A;  1PPJ G;  1IC2 A;  1NTM J;  1R5L A;  1PPJ D;  3RK3 E;  1LNQ A;  1S4X A;  2OAR A;  1KQS O;  5AVZ B;  3RK2 D;  3H6P A;  4AYZ B;  5BVZ A;  3E0H A;  1SQX E;  2B87 B;  4D6T G;  1CI6 A;  1LJ2 A;  2FYU D;  3M91 A;  1T6A A;  1BGY E;  4LC1 A;  2V7Q J;  2LXC B;  3VMY A;  1LTB C;  1PFI A;  1Q2N A;  1L4A A;  2Y0C A;  2QSI A;  4GOD A;  1WT6 A;  2OGU A;  4GDO A;  1NTK E;  1LTJ B;  2PAJ A;  3AE8 C;  1BSN A;  1L4A B;  3L72 J;  2IBZ D;  1IFM A;  4WLW A;  1N7S B;  1NTK G;  2OYI A;  4DZO A;  1LT9 C;  2UWJ E;  3H1J J;  1KB9 D;  2A06 G;  1RF1 C;  1PP9 E;  3M06 A;  2DW3 A;  2E42 A;  3G6E P;  3AEG C;  3VP9 A;  2WSF J;  3P8C E;  1D5Y A;  3AE3 C;  2A45 G;  4OGQ B;  3T97 A;  1N86 A;  2E74 D;  2YIU C;  1Q06 A;  3EZ7 A;  3O6Q A;  1N7S C;  1YTZ I;  3WU2 E;  2E5T A;  3CCM P;  1PPJ E;  1BDC A;  3CCR P;  1SQQ D;  1NTM E;  2IEF A;  2H7H A;  1PGJ A;  2YKP A;  2E43 A;  2CPS A;  2FFD A;  5KAI E;  1W2B O;  2WPS A;  1SQP K;  4U3F G;  2H89 C;  3MUD A;  3D71 A;  2J59 M;  1LT9 B;  1SQX J;  3CCL P;  2W83 C;  1VQL P;  1PP9 G;  3PHL A;  1DEB A;  4A7P A;  2YXQ B;  3BCC E;  3PJS K;  4U3F D;  4RES B;  2ZXX A;  3AEA C;  4H0L D;  5KKZ B;  3P32 A;  2K9J B;  1N7L A;  1J1E C;  3MD0 A;  3V5B A;  2PRR A;  3R8J A;  1GDT A;  3L73 E;  4JBZ A;  1NTZ D;  5APU A;  1LP1 B;  4KHX A;  5CBO A;  1SP4 A;  3V6I A;  1H0T B;  2XDJ A;  3CXH D;  2MKV A;  3V2P A;  1RF0 A;  1EXI A;  1BCC J;  2R44 A;  3CWB G;  1PGQ A;  4N78 D;  3VTP C;  4C7N B;  2YKQ A;  2V4H A;  4JQ0 D;  1NGM B;  1LWU C;  1Q08 A;  1KN7 A;  4PV1 D;  4H13 B;  5TIS H;  5AVS B;  3SWY A;  2N1T A;  3L75 E;  3TNU A;  4EI2 A;  1URQ C;  1M1K Q;  4JYB A;  4IFD K;  3B5N C;  2Q9I A;  2FXM A;  3M0D C;  1URQ A;  1X9V A;  1P84 I;  3BAT A;  5AW2 B;  4HKZ H;  4H0L B;  1GK4 A;  2L91 A;  1NU1 G;  3IR9 A;  1Q82 Q;  2ZVO B;  1LTA C;  2FXO A;  3GPV A;  5I41 B;  3MTU E;  2WIT A;  3HUS B;  1M8O B;  3UIA A;  2B88 A;  2M3B A;  1PL5 A;  5CBN A;  4C46 A;  4WY4 B;  3I56 P;  3H1H G;  3HD7 A;  2RN0 A;  3L73 D;  3AE1 C;  5APS A;  4B0Y A;  1VQ8 P;  1PP9 D;  3MP7 B;  2WTY A;  1KIL A;  4WY4 A;  5KAI H;  2XNX A;  3VOP A;  2P1J A;  4IOI H;  1SQP D;  1SFC D;  1VPC A;  1QL2 A;  5I44 A;  3VYI A;  2HOD A;  1VQP P;  2WSC J;  2A45 I;  2KLV A;  1SQV G;  2Y0D A;  3L70 D;  3S4R A;  1RY3 A;  5B5E E;  1VQ9 P;  4J2N A;  3GMA A;  2PP6 A;  1KYO I;  3W68 A;  2A06 E;  1NTM K;  2WSE J;  4JYC A;  3B5N A;  2I1J A;  2GUS A;  1Q7Y Q;  2WSC H;  2XZR A;  1LP1 A;  3FGA D;  1DH3 A;  2Y9Y A;  3I5C A;  3L71 G;  1GW4 A;  2KIK A;  3L70 G;  1URQ D;  4BRY B;  2O1K A;  3V4Q A;  1PP9 J;  1P84 E;  1OVU A;  2Z4E A;  4Z1M H;  1YJN P;  1TU3 F;  1SFC A;  2OYH A;  1NYH A;  1HH0 A;  3Q1M A;  3RK3 D;  1X0T A;  3USS A;  3V4W A;  1S1C X;  1JTH A;  3KDP B;  2E76 B;  4ZNC A;  1VQK P;  1SQX G;  2R3C A;  1JY2 N;  1L4A D;  1OVV A;  2KYV A;  2OTJ P;  3KXD A;  1NU1 K;  4Y99 C;  1YJ9 P;  3R2P A;  5AVU B;  1DEE G;  3AEC C;  2BEQ D;  2FKW B;  1HUC A;  1M90 Q;  5CCH A;  4R4E A;  2QVA A;  4K3A A;  4Y28 J;  3H25 A;  1JUN A;  2Z5H A;  1NU1 J;  4NPF X;  3GLM A;  1K04 A;  2K1A A;  1HJB A;  1IO4 A;  3FX0 A;  2E74 B;  4NPE A;  3L75 G;  2P7J A;  2WPQ A;  1L0L J;  4GIF A;  1ZLL A;  1VL2 A;  5APV A;  1SQV J;  1KIL E;  4I7Z C;  5KLV E;  1J1D B;  2ZAE B;  3QH9 A;  2O01 H;  1QL1 A;  4XA4 A;  3HD7 D;  1RHZ B;  5GTH H;  2W6J H;  4OGQ C;  1S5L H;  2IBZ I;  4IL6 E;  2C9N Y;  3TYY A;  4D6T J;  1RQV A;  2JKV A;  1HF9 A;  3L70 E;  4W80 A;  1GU5 A;  4GOE A;  1PGO A;  1FZG A;  3L71 E;  3LIE A;  2FBW C;  3H1I G;  5AW9 B;  1SQX D;  3VMZ A;  4AYZ A;  1N73 A;  1FC2 C;  3LID A;  1J1D C;  1Y6U A;  1W5C E;  1LTI C;  1N73 C;  2Q3I A;  3LW5 H;  3L73 J;  2SPZ A;  3O6Q B;  3L74 D;  1KB9 I;  1SQB J;  3HUS A;  4C7R A;  1X8Y A;  2N9Y B;  3PRJ A;  2KCU A;  3JC2 2;  4PV1 C;  4H13 C;  2WSF H;  5B66 E;  1FDO A;  1QLE D;  5E01 A;  3AE9 C;  1FJK A;  3RBX A;  4N3Y B;  5CCH C;  4DCK A;  5KAU A;  2KI7 B;  1YQ4 C;  3N4X A;  1GW3 A;  2O3J A;  4RJT A;  3L75 D;  1GK6 A;  3G71 P;  2Q5U A;  5KJ7 D;  5APQ A;  1EZV D;  1T8Z A;  2WPV B;  1LTJ C;  3HE4 A;  2L5G B;  1LTG C;  2QJK B;  1NO4 A;  1KQF B;  1LTJ A;  2V7Q H;  3H1J D;  1OFC X;  5AW0 B;  1L0N D;  3ABV C;  1KMI Z;  1S9K E;  1PGP A;  1EZV E;  2FXP A;  1RE4 A;  4IL6 X;  4UB8 E;  3PLN A;  2R5D A;  3RK2 B;  2R5B A;  4LGD E;  3CXH I;  3HUS C;  2JJL A;  4UB8 H;  1ZV8 A;  1SFC B;  5EFW B;  2HPC B;  4IL6 H;  1SFC C;  1KIL D;  3H32 B;  5KAV A;  1T2K D;  2BAS A;  1KB9 E;  1YHQ P;  3CX5 H;  1DX7 A;  1EDI A;  2HLO A;  3L36 A;  2E74 C;  2NPS A;  1NWQ A;  4O9B A;  3HD7 B;  3L73 G;  3KQG A;  5CCG A;  1JCD A;  4AUW A;  4MN4 C;  4N78 E;  3CCS P;  3H1I D;  1KFM A;  3L71 D;  3VP8 A;  2YMK A;  4ZMD A;  1JBG A;  1U7J A;  1P84 H;  4R22 B;  1Q90 D;  4U3F E;  3LUR A;  1R8E A;  3H1J G;  1JY3 P;  3CX5 E;  3L72 D;  3V2Q A;  1AVO A;  3AE4 C;  1U57 A;  4BWN A;  2JML A;  1NTK J;  2QRX A;  5D90 A;  2JWA A;  4I2L C;  3BCC D;  3Q5R A;  3AEB C;  1A02 J;  5TJH A;  5KAT A;  3R4Y A;  4R4L A;  3CC4 P;  4IFM A;  2DG6 A;  1KQG B;  1KIL B;  1HTL C;  2XU6 A;  3HRN A;  5KLV D;  5K5G B;  3AE7 C;  1KB9 H;  1VF5 C;  4M3L A;  1NOH A;  3CXH E;  2MJZ A;  2OYI C;  2J58 A;  2Q7C A;  4AQR D;  2IDB A;  2KS1 A;  3A3Y B;  1BDD A;  4HB1 A;  2P58 A;  3L35 A;  3B5N B;  5BU5 A;  2QJY B;  1CW5 A;  3P8C D;  2KVV A;  2VRS A;  2B9B A;  1H89 A;  4WBA A;  2WWW A;  5D8C A;  1NVO A;  3H1L E;  1FZE A;  2P2U A;  2KOG A;  1Q07 A;  4K35 A;  4OH8 B;  2P10 A;  2QA4 P;  1NTZ K;  1LT1 A;  1FOS F;  3ZDM A;  3MGN A;  2A06 D;  2LXB A;  4XFJ A;  2P67 A;  2JWD A;  2KZJ A;  1ZR4 A;  1NJI Q;  2D2C C;  3S1K A;  4RKU J;  1FZB A;  1K73 Q;  1G1I A;  3CX5 I;  4WY4 C;  3HE5 A;  2OG0 A;  1MZ9 A;  3WUU A;  1GL2 B;  1SQP J;  1R8D A;  2KZI A;  3IN6 A;  2OQQ A;  5AVV B;  3L70 J;  5AW8 B;  4TT3 H;  1Q0A A;  1SQQ K;  2OTL P;  2M5A B;  2FYZ A;  2Y0E A;  1G2C B;  1SQB K;  1NKN A;  2KNC B;  1GD2 E;  2IX7 C;  4ASW A;  2Z5I A;  3II6 A;  1PZQ A;  2NZ2 A;  5DJT B;  3L4F A;  1SQP E;  1CZQ A;  2W6B A;  3A0B E;  3SFE C;  1RE3 A;  2RMZ A;  3A7O A;  1KZU B;  2ZXE B;  2KUB A;  3L37 A;  3EWK A;  3A0B H;  3VN0 A;  1KC8 Q;  3Q3D A;  1IK7 A;  1EQ7 A;  1YBK A;  2BCC D;  3AE2 C;  1BSH A;  1AQT A;  5AW3 B;  2Q6Q A;  1S9K D;  1H88 A;  2KK7 A;  2ITA A;  2BCC G;  1SLQ A;  3T97 B;  3F89 A;  1AV1 A;  1BCC G;  4RO0 A;  1GMJ A;  1BE3 D;  2M3E A;  3H1L J;  3GW6 A;  4JF7 A;  4ZKP A;  3NTN A;  1BOW A;  4EDF A;  2PGD A;  3FWL A;  2B89 A;  1KD1 Q;  3KZI E;  2NPS C;  1GTW A;  5B66 H;  5KJ7 C;  1DIP A;  2ZT9 D;  1D7M A;  2KLU A;  4PD4 D;  1EZV G;  3CPW O;  2D2C D;  4PD4 E;  1KYO D;  1FZF A;  5B5E H;  3HH0 A;  4DJG A;  2XV5 A;  4L76 A;  3CD6 P;  2YKO A;  1S3J A;  1FJP A;  2C0X A;  2IBZ G;  3L72 E;  2KSE A;  2M8R A;  3HTK B;  3B5N D;  4U3F J;  3GHG C;  1M1J A;  1IK9 A;  1EDJ A;  3MHV A;  3B49 A;  2ZHH A;  3RBZ A;  1OVR A;  1VF5 D;  1E79 H;  3M0A A;  3H1K G;  1KIL C;  1JY3 O;  1YTZ T;  3Q2Y A;  1OW8 A;  3GF3 A;  3FXD A;  1Q81 Q;  5KCB A;  5APW A;  2CK3 H;  1NTZ E;  1FS0 E;  1AQ5 A;  1RF0 C;  3BVH A;  4IFF A;  3SFD C;  4OWF A;  3GG2 A;  1U7M A;  2NRG A;  3CWB J;  1RE4 C;  4LLH A;  4R24 B;  2ZT9 C;  5GTH E;  3CMA P;  3RL0 g;  2N1T B;  1GL2 D;  3MIW A;  2ZVN B;  1VQ6 P;  2E75 B;  1MV8 A;  3MUD C;  1K9M Q;  2AXT E;  2K37 A;  3EFG A;  2GOV A;  4C7N A;  1EZV I;  2FFD B;  1HGZ A;  1A02 F;  3GF7 A;  2HOD B;  5AW6 B;  1HWT C;  1KYO E;  1FZC A;  1SQQ E;  2HVA A;  1FDM A;  1VQ4 P;  4PD4 I;  5CMZ A;  2QG4 A;  3SSU A;  3V2N A;  3TNU B;  3TDK A;  1YQ3 C;  1EDL A;  3RK3 C;  3CC7 P;  2NPS B;  2BCC E;  3WUV A;  2B87 A;  4YXW H;  3OW2 O;  1BE3 E;  3IFM A;  1N7S A;  1L0L D;  2OYI B;  2ZYG A;  3D70 A;  3H32 A;  4OVN F;  1L4A C;  2VZ4 A;  3Q5P A;  4N6J A;  2WT7 B;  5KAF H;  3GP4 A;  1T3J A;  2QJY C;  1QGK B;  1IFP A;  5KAW A;  1IZN B;  1NAY A;  3H1K E;  1GU4 A;  1NTZ J;  1VQ7 P;  5CJ0 A;  3H1K D;  3KZI H;  3M0D A;  1OXZ A;  1MUU A;  1DD3 A;  2Q3E A;  4R4M A;  2IFN A;  3CLQ A;  4HJG H;  4LHF A;  1NKZ B;  1PM6 A;  1URQ B;  1XTC C;  1RH6 A;  1VQO P;  2O1J A;  2H43 A;  1WMK A;  3H1L D;  1IFJ A;  1JMM A;  1X79 B;  2ZHG A;  1SQB D;  5AW4 B;  3HD7 C;  5BU8 B;  1N8R Q;  1HVV A;  1R5S A;  4L75 A;  5H2F E;  3OJA B;  1SQQ J;  2E76 D;  3H1H D;  3N7N A;  3B71 A;  2XKM A;  3BRT B;  2QM8 A;  3KHU A;  2IBZ E;  2C9L Y;  4EOT A;  3H1I J;  2E5Y A;  3HE5 B;  2W27 A;  2RKL A;  4A1M A;  4WB4 A;  1SQV D;  2W90 A;  1JB0 J;  3R8K A;  3PH0 A;  3S9O A;  1LGH B;  3C1L A;  3WU2 H;  3IF4 A;  1NTK D;  2WSE H;  2HFE D;  3GHG A;  5KLV K;  3H1I E;  1BCC E;  1KTM A;  3CWB D;  4UB6 E;  3CI9 A;  1L0L E;  3D6Y A;  2J5U A;  1ZRT D;  1S5L X;  1RE3 C;  4BXL A;  1NAF A;  4TLF A;  2H88 C;  2GA1 A;  3CX5 D;  5KLV J;  5APT A;  1SQV K;  3B4S A;  5GTI E;  4DOJ A;  1SS1 A;  2K3R A;  5KJ7 A;  1JEK A;  1SVF A;  5C39 A;  1IFN A;  2QJP C;  1SQP G;  4I7Z B;  1JY3 N;  1JNM A;  2H8P D;  2CPB A;  4EYY Q;  5AVW B;  1S2E A;  1KFN A;  3TGU E;  2E76 C;  3JCU E;  3A0H H;  3IAO A;  3H1L G;  1SQX K;  2WPR A;  3L72 G;  5E79 E;  1E5W A;  1OWA A;  3CL3 D;  1JY2 P;  4YTP C;  1LX8 A;  1J1E B;  1LTS C;  1LWU B;  2KB7 P;  2IFM A;  1YJW P;  3BAS A;  1OIP A;  1FOS E;  1ZP0 C;  5AVQ B;  1FE6 A;  3AE5 C;  2YMY A;  1EDK A;  5L8R J;  2IYP A;  1JM0 A;  3E7K A;  1FZA A;  2FYU J;  1VDF A;  3CWB E;  2WT7 A;  1OMI A;  4QMA A;  3G4S P;  1JYH A; 
#chains in the Genus database with same CATH homology
 3AE9 C;  3C8V A;  3AEG C;  1S5L X;  2QIW A;  1Q07 A;  2WSF J;  2JP3 A;  1PM6 A;  1GMJ A;  2P10 A;  4PV1 D;  1FDI A;  4H13 B;  1D5Y A;  2E75 B;  1RH6 A;  1VL2 A;  3UCS A;  2H88 C;  3AE3 C;  5GQQ A;  1UIX A;  2YMK A;  1ZOY C;  4OGQ B;  2E75 C;  1WMK A;  1BOW A;  4XFJ A;  5KAU A;  3FGA D;  1KIL E;  4I7Z C;  1JBG A;  2E74 D;  2GOV A;  2YIU C;  1Q06 A;  3EZ7 A;  3O6Q A;  1YQ4 C;  2D2C C;  3GK6 A;  4R22 B;  3GF7 A;  1Q90 D;  3D6Z A;  3AED C;  3EZF A;  2ZT9 D;  4RKU J;  1DIP A;  3LUR A;  1R8E A;  2ZHG A;  1ZME C;  3EZ2 A;  4WLS A;  2G3A A;  5M1B A;  2HVA A;  3AE4 C;  4OGQ C;  1AJY A;  2QJP C;  2D2C D;  1U57 A;  3RK3 E;  2OG0 A;  2IEF A;  1OW6 A;  4I7Z B;  2JML A;  2E76 D;  2WPV B;  5D90 A;  4H0L B;  4Z1M H;  1R8D A;  3LW5 J;  4AYZ B;  3B71 A;  3IN6 A;  2WQY C;  1RQV A;  3Q5R A;  1TU3 F;  3HH0 A;  2OQQ A;  3AEE C;  3AEB C;  1HF9 A;  3E0H A;  1MKM A;  1VF5 B;  1NYH A;  2H89 C;  1KQF B;  5KAT A;  3AEF C;  2BOW A;  3Q1M A;  3D71 A;  3R4Y A;  3QAO A;  1OW7 A;  1YQ3 C;  2E76 C;  2FBW C;  3GPV A;  4TT3 H;  3IAO A;  5I41 B;  4R4L A;  4DCZ A;  1Q0A A;  1S1C X;  1DD4 A;  2ZT9 B;  1HJ0 A;  2DG6 A;  1KQG B;  3Q5S A;  4U7J A;  2V7Q J;  4H0L C;  3ABV C;  2E76 B;  1KMI Z;  3D70 A;  1PL5 A;  5KAX A;  4AYZ A;  4H0L D;  3AEA C;  4YTP C;  1LX8 A;  1K05 A;  2FXP A;  4H44 B;  3AE7 C;  2QJK C;  3EZ6 A;  4IL6 X;  1VF5 C;  2ZHH A;  1PV3 A;  3B49 A;  2QSI A;  3AE6 C;  1Y6U A;  3G9R A;  1VF5 D;  1RQU A;  2D2C B;  3R8J A;  4GDO A;  2NZ2 A;  2VZ4 A;  4A1M A;  1Q05 A;  3Q5P A;  3Q2Y A;  1Y9B A;  1PIX A;  3GP4 A;  2BEZ F;  3AE1 C;  1OW8 A;  3GF3 A;  3SFE C;  1Q08 A;  5KKZ C;  3AE8 C;  4B0Y A;  2QJY C;  1JB0 J;  1ZP0 C;  4YXD C;  3AEC C;  2BEQ D;  2G8Y A;  5KCB A;  4KT0 J;  2IDB A;  5KAW A;  5KAV A;  3EWK A;  2K9Y A;  3AE5 C;  3R8K A;  3Q3D A;  3S9O A;  4WLW A;  4R4E A;  1IK7 A;  2MKV A;  5L8R J;  1Q09 A;  3SFD C;  3EZ9 A;  4Y28 J;  1EXI A;  2E75 D;  2O01 J;  1ZRT E;  3T97 B;  4H44 D;  3AE2 C;  3H25 A;  2KVV A;  5I44 A;  4PV1 B;  2E74 C;  2KCU A;  2WSC J;  4H13 D;  3GLM A;  2J5U A;  4PV1 C;  4H13 C;  1K04 A;  4OGQ D;  4R24 B;  5D8C A;  2ZT9 C;  5KLI C;  1KTM A;  1DD3 A;  1KOR A;  2FYN C;  2JO1 A;  4R4M A;  1EXJ A;  4J2N A;  1FDO A;  2E74 B;  1OMI A;  3RL0 g;  3GMA A;  4H44 C;  1JYH A;  3D6Y A;  1NGM B;  5E01 A;  2WSE J;  4LHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...