3Q5RA

Crystal structure of bmrr bound to kanamycin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/antibiotic
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 79
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5rA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5rA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5rA03
4R24B 2ZHGA 3Q5SA 2GOVA 4A1MA 1BOWA 3GK6A 5KAXA 1R8EA 4R4EA 2ZHHA 5KATA 1R8DA 2J5UA 5E01A 2DG6A 4R22B 4AYZB 5I41B 3Q5PA 4B0YA 3GP4A 5GQQA 5KCBA 1Q05A 1Q07A 3Q5RA 5KAUA 3R8JA 3E0HA 1Q09A 1Q0AA 4J2NA 2VZ4A 3T97B 2JMLA 3B49A 5KAVA 1D5YA 3Q1MA 4R4LA 3Q2YA 2KCUA 4R4MA 1DIPA 5KAWA 1EXJA 3QAOA 3D71A 3R8KA 4AYZA 1Q08A 3LURA 3D6ZA 3HH0A 1JBGA 2OQQA 3G9RA 1Q06A 5D8CA 5D90A 3Q3DA 1EXIA 3GPVA 4WLSA 5I44A 3IAOA 3D6YA 3D70A 2BOWA 3UCSA 2HVAA 1JYHA 4WLWA
chains in the Genus database with same CATH superfamily
2IFNA 2FFDC 1G2CB 5GTHH 3LW5J 1R5SA 3CMAP 2CPSA 1SQPK 1BDDA 1RH5B 1Q09A 2VZ4A 3MUDC 1NTKE 1E5WA 2KCUA 2P67A 1SQXD 3MIWA 3RBZA 1NTKG 3F5HA 2Q3IA 5H2FE 4EDFA 2P10A 3CCVP 3W67A 2WPRA 1KV4A 1KB9H 3H1KG 4Y99B 5I41B 1IFMA 4GDOA 3AEGC 2OYHC 1SQVD 4IFFA 1DIPA 2A06D 2PP6A 1LTAC 4PJ0H 3L37A 3O6QB 1RF1B 2I1JA 3PHLA 1RY3A 3MTUE 1ZW0A 3HE4B 3F89A 3A0BH 1L0LE 1SQQG 2QA4P 3TNUA 5KLVJ 1L0LG 4YXDC 3PRJA 2KZJA 2LKMA 1CZQA 1CW5A 1FZEA 3JC22 1OW6A 2O1KA 1HF9A 4D6TD 1NGMB 1IFJA 4HKZH 2WSCJ 3H1HE 1SP4A 2LR2A 1BE3E 2GUSA 5AW9B 1EZVD 5CCGC 1BE3G 3HTKA 3AE8C 1ZMEC 2IDBA 1VQ4P 2Q3EA 1IJDB 2XV5A 1MKMA 3CCRP 1KQSO 3HE5A 1DD3A 1NAFA 3AECC 1IFNA 1AQ5A 4CPGA 3IN6A 1L2PA 3RL0B 1PV3A 1LWUB 1S2EA 3P8CD 1VQNP 3RL0C 4MN4C 4M3LA 1LWUC 1VQ5P 4UB8H 1YQ4C 4EIJA 5AVVB 1FU1A 2ZXEB 1NU1G 1K05A 1GMJA 3EZ7A 1SQQK 1NTMD 4HB1A 1FZFA 3P7KA 1GK6A 2B87A 5GQQA 1X22A 1FBMA 4L74A 2FYUE 3B5NA 2KOGA 3TGUG 3WUTA 1J1EB 4IL6H 4RKUJ 3QWOC 3JCUH 5CHXA 1IK7A 1SVFA 2W6AA 4R4MA 1FE6A 3V6IA 3UIAA 3RK2B 3B71A 4RESB 1OW8A 1MZ9A 5KCBA 3RK3C 2Z5HA 1EDKA 2L91A 2B9BA 1JTHA 4DZOA 3L4FA 1Q06A 2G3AA 4D6TJ 1PPJE 2GOVA 1PPJG 2OG0A 1R5LA 4N3YB 3KZIH 2ZJSE 2QJKB 2MJZA 3CWBD 1VF5B 2E74B 5B66E 3H1HD 4U7JA 2RN0A 1VF5C 1Q81Q 2H7HA 1N7SA 4UB6H 1KTMA 1NTZE 5AW0B 2ZT9C 2GUVA 2P1JA 5CCHD 1IC2A 1URQA 1K73Q 2M8RA 3WU2H 1SFCA 3AEAC 3EFGA 2QVAA 1T3UA 2GM4A 3L70E 1U7JA 3L73D 3L70G 4HYTB 1S5LX 4XA4A 1L4AA 3CI9A 3S9OA 1RE4A 3TSIA 2XZRA 2WSEH 2B87B 1SQBD 2OARA 1FDMA 1NTKJ 1YQ3C 3L71E 1E79H 2M0BA 3QH9A 3L71G 1JUNA 1HUCA 2FYUD 1JY3O 3SFDC 2E5TA 2JP3A 3D70A 3BCCE 3B5NC 3H1JG 5E79H 2KUBA 2QJPC 3BCCG 2R32A 2KVVA 1S1CX 1HWTC 5CJ0A 3RK2D 2YKPA 4L73A 3A7OA 4Z1MH 1GD2E 1EZVI 1GU5A 3E1RA 1L0NE 2KI7B 3PP5A 1L0NG 3IAOA 1KC8Q 1G1JA 1PGJA 2HODA 2O01H 1L0LJ 1IFPA 1JTHB 3I55P 1QX8A 4H44B 2O3JA 3T97B 3H1HJ 1FAVA 1BE3J 2E74D 1P84I 2KLUA 4WLSA 4OGQC 1M1JB 5AW6B 5KAXA 2KLVA 5KKZC 4TT3H 4GOFA 5BU5A 1FOSF 3A0HE 1GW4A 1LTTC 2IYPA 1VQ7P 2RMZA 1N7SC 1NTZD 5AW8B 4AQRD 1SLQA 1NWQA 2KNCA 4R4EA 1OZHA 2WQYC 3H32A 2DG6A 1SFCB 2V7QJ 1URQC 4WVZA 1BGYG 2YIUC 4I7ZB 3L73J 2H43A 2IBZD 1G2CA 4LHFA 3W68A 2KXPB 3AE9C 1L4AB 3CCUP 1D7MA 1AFOA 1OW7A 2FYZA 2QE7H 1OX3A 4W7YA 2K9YA 4IFDK 2B88A 3GG2A 4R4LA 2FXMA 5APYA 2Q9IA 5KAWA 1RE4C 3MP7B 3NMDA 2FYUJ 3H1IE 1SQXG 3V2RA 2WPSA 1Q2NA 3H1IG 2QM7A 4OH8B 5M1BA 3C1LA 2O01N 3O6QA 1RF1A 3JSVC 4ZKUA 3CCEP 3HE4A 2IEFA 5AW3B 4RO0A 3L74G 2D2CD 1FS0E 3CCLP 3LURA 1KFNA 1K9MQ 1LTIC 3AE5C 1SQPE 5TISE 1SQPG 3LW5H 5DJUB 3HD7B 3R4YA 5KLVD 1ZRTD 5DJTB 4PD4E 2HODB 2B89A 3CC7P 4H44D 5BVZA 1YIJP 2WZ7A 3GHGA 1S3JA 2HR3A 4PV1B 2IZ1A 3GLMA 1A02F 2XU6A 3V4WA 1KILE 5CCHA 5KAVA 1VQ6P 2LXCB 1T8ZA 2KSJA 1OFCX 1NTZJ 4LGDE 2R3CA 1SQXK 1S72P 1X0TA 4JBZA 1U57A 3CCQP 3TK1A 5APVA 2DW3A 3MD0A 4HH2A 3WMM0 5L8RJ 3H32B 2L5GB 4IOIH 1OVVA 2WSCH 2JKVA 3GMAA 2BCCG 1SQVK 1KQFB 3L70J 2FXOA 2AEFA 1LTJB 3M9BA 5AVUB 1H8AA 1L4AD 4YXWH 3FX0A 2POHA 2QRXA 3CCJP 3G71P 4N6JA 3KXDA 3CXHE 3EZ2A 1PP9D 3H1KE 1PFIA 3FWNA 1T3JA 2Y9YA 1ZOYC 3L71J 5KAFH 1Q05A 3A0HH 1YYCA 1EDJA 4H0LB 3L72G 4Y99C 3BCCJ 1OWAA 4EI2A 2Q5UA 2R5BA 5D8CA 1QL2A 5D90A 2A45G 3S1KA 2NPSB 2KS1B 1ZR2A 3EZ9A 1RE3A 1SQQE 2UWJE 1JO5A 2QJYB 3ABVC 3VOPA 5AW5B 1S5LH 2M3BA 1RF1C 3OA7A 4B86A 2P7JA 1L0NJ 2AEMA 3HD7D 3SFEC 1PL5A 2ZHGA 1OVRA 3CX5E 1KYOE 2FY8A 3H25A 1KQGB 4LC1A 4C7NA 3RL0g 1X79B 2WMMA 3GHGB 4N78D 4WB4A 1EC5A 4PV1D 1Y8AA 4DCZA 3GHGC 1NTMK 3SWYA 1YJWP 2IBZI 3L75E 3B4SA 2C9NY 3L75G 2XDJA 5CCHC 2E5YA 1JOCA 2HLOA 4I6MC 2Y9ZA 1Q82Q 2ZFCA 3BASA 2WVRA 4U3FD 3FWLA 2NRGA 3AEBC 3M0AA 3BATA 1BSHA 2Q1KA 4KT0J 5E01A 1NU1E 2KZIA 1FZCB 1LT9B 1UIIA 2JWDA 3NFQA 4OVNF 3P8MC 4GODA 2ZYAA 5KTBA 2ZVOB 3TGUE 4JYBA 2G8YA 2OTKE 2W27A 1PP9J 1JMBA 5CBOA 1NTKD 1GU4A 2W6BA 3EZ6A 2IX7C 3M9QA 5CMZA 1J1EC 3H1KD 1EDLA 4QMAA 5EFWB 5AVYB 5AVRB 1U7MA 4H0LD 1S9KE 3U59A 1AVOA 3WUUA 1M56D 1NKZB 3RK2C 3CCMP 2NPSD 3R8JA 4XE5B 1Q0AA 3RK3E 2ZXXA 3USSA 1FZGA 4NPEA 1SQQD 1SQPJ 1USDA 1RE3C 1W2EA 5AVQB 1L0LD 4NPFX 3T97A 1LTSC 5APWA 1JB0J 1NYHA 3E1IA 2ZVNB 1M1JA 3H1LG 4Y28J 1HJ0A 3B49A 2YXRB 1AVYA 2QJKC 1KB9I 3KPEA 2N9YB 1BE3D 3D6ZA 5H2FH 1GK4A 4C46A 3V2QA 1OXZA 4C7NB 1WT6A 2E74C 1X8YA 1JEKA 3CL3D 1XTCC 1R8EA 1J1DB 4I2LC 1WRGA 2WSSH 2H88C 5AW4B 2C0WA 3KDPB 1NH4A 1SQBK 1EXIA 1PZQA 4U3FJ 3BRVB 1VQPP 2QSIA 1ZV8A 3VP8A 1BCCG 2FYUK 1GDTA 1K04A 3MGNA 1DEEG 1QVFO 1GTWA 3A2AA 2YMYA 2R5DA 2K88A 3VMXA 1NU1D 1G1IA 4DT0A 3IFMA 4R22B 2FYNB 1IFDA 1Y9BA 2FYNC 2WPQA 3I56P 2XKMA 2JR8A 4AUWA 3TGUD 3H1JE 2Z4EA 3H1KJ 5CBNA 1PM6A 3GK6A 4L75A 2J5UA 5CJ4A 1OIPA 2J59M 1JY2N 2V7QH 4K3AA 2D2CB 4DOJA 3P32A 1ZXGA 2IYOA 3NTNA 4WBAA 1M90Q 3U1CA 1S9KD 2IZ0A 2D2CC 3HD7A 1SQQJ 2KP8A 2WPVB 2BEQD 3R2PA 2OYOA 3VYIA 2W6JH 1NTZK 1VL2A 1HTLC 1NO4A 1GL2B 1FJKA 3CC2P 3EQ2A 1PPJD 1DX7A 4WY4B 5C39A 4H44C 1NHLA 5APXA 1BSNA 4GIFA 2KYVA 4B0YA 3C8VA 1M1JC 1Q86Q 2R44A 5GTHE 1Q7YQ 2N9BA 1USEA 4EOTA 1CSBA 4JYCA 3AE2C 2JJLA 2PGDA 3L75J 1IK9A 1KFMA 3C9IA 4ZKPA 1EQ7A 1H0TB 1BGYE 3SWKA 1RF0A 2HPCB 1H88A 2AXTE 1KB9E 1RH6A 3CCSP 1GZLA 3GF7A 1EXJA 2Y0DA 1SFCC 2FKWB 4I7ZC 2K1AA 1QGKB 1LTJA 4NPDA 3N7NA 2W8ZA 1NU1J 3L70D 2W83C 3A0BE 2YKQA 5B66H 4RJTA 1L4AC 1SQXE 3LIEA 3TGUJ 5KLVK 3VMYA 1HH0A 3VMAA 2YMKA 3L71D 2KSEA 1LGHB 2OTJP 2OTLP 2NPSA 2KS1A 3BVHA 3VMZA 3H1JD 3L74E 3BCCD 1SQVE 2A06E 1SQVG 2O1JA 3V2NA 4ZNCA 3FXDA 2A06G 4BXLA 4L76A 3AE7C 2H8PD 1NKNA 1EDIA 2XNXA 1Q07A 1L0ND 1Q90D 1ZLLA 3HD7C 4JQ0D 1ZR4A 1GL2D 4ASVA 3GF3A 4WY4D 2K37A 4UB8E 5KAIE 4D6TG 1FDIA 2I8DA 2PRRA 1EZVE 1AQTA 1DD4A 4H13D 5KAUA 4YPCA 1EZVG 1N73B 1LJ2A 2WSFJ 2BASA 3GW6A 1NAYA 1LTGC 2HFED 2OQQA 2E75B 4PV1C 1HBWA 3Q3DA 1QEXA 1KILB 2ZYDA 5KLIB 5AVSB 3AE6C 4DCKA 1JMMA 4IL6E 2E76B 1P84E 1PGPA 3JCUE 3MZWB 3QAOA 2HG5D 4C7RA 2BCCE 3P8CE 1FZCA 2YO3A 1LT9A 1BGYD 1FC2C 2KK7A 1RF0C 1R8DA 5B5EE 3G6EP 3E7KA 2WWWA 2WT7B 1D5YA 2FFDB 1NTME 2JO1A 1W5CE 1AV1A 1LTJC 2YNYA 1NTMG 3AE1C 1T6AA 1Y6UA 1ZP0C 2JWAA 3KZIE 1T2KD 2RH0A 2H89C 3L72E 3KQGA 1X9VA 1YJ9P 1YI2P 3H1JJ 3BRTB 5KJ7D 3H1ID 2M5AB 1HJBA 3VP9A 1JYHA 1A02J 1YTZT 4H0LC 2OYHB 4UB6E 1VQ8P 4OWFA 5KATA 2AXTH 2QEXP 3L74D 2NPSC 3KHUA 3U1AA 2QJYC 2QIWA 3AE3C 3MHVA 3WU2E 1SQPD 2ITAA 1PGOA 1GW3A 1HVVA 1W2BO 2IPPA 4PD4D 2WTYA 1IZNB 3K5BA 5AVZB 2BEZF 4BRYB 3CWBE 1N8RQ 3HUSA 3M06A 3CWBG 3G3ZA 3TDKA 3H1HG 1OMIA 3Q5SA 2M3EA 3M91A 2E75D 2N1TD 2K9JA 1KILD 3H6PA 1YHQP 1KN7A 4I1LA 4GOEA 1PIXA 2AEJA 5I44A 1NTKK 2E76D 2QM8A 5TISH 1KQLA 1BGYJ 1KORA 3V4QA 5E79E 2Q6QA 1FDOA 3V2PA 3PH0A 1P84D 4PD4H 1FJPA 1N86A 1M7LA 2XNDH 3L73E 2BCCD 4AYZA 2FXPA 3L73G 1FZCC 1LT9C 1CI6A 1LP1B 5KAIH 3RBXA 4R24B 4BWNA 4HJGH 1FZAA 2ZHHA 3CMEP 1M1KQ 1YTZI 4JF7A 1SQBE 3B8EB 1S4XA 4GKGA 1SQBG 1L0LK 3LIDA 1SQXJ 2OGUA 3H1IJ 3CXHD 1K8AQ 2NZ2A 3V5BA 3WUVA 3KYQA 2IFMA 2FYUG 1LNQA 3L72D 1FOSE 4JPZB 3EWKA 1P84H 2FBWC 3L74J 2ZAEB 1JCCA 1MUUA 1WMKA 1SQVJ 2HYNA 2YKOA 1VQLP 2J58A 1Z56A 1YITP 4WLWA 5B5EH 4A1MA 3ITKA 3RK3B 3L36A 1GL2A 4EYYQ 3TF5A 3SWFA 1ZN5A 2LXBA 2VRSA 3O8ZA 4WY4A 3H1LE 2W90A 2PAJA 1TU3F 3II6A 3OAKA 2WITA 3D71A 3VN0A 3IR9A 3TNUB 3CX5D 2BOWA 3CXHH 5AW2B 1KYOD 5CCGD 3HUSB 2Y0CA 2KIKA 3EFFK 1JY3N 5TJHA 1RHZB 3HUSC 1NU1K 1NJIQ 2A45H 1J1DC 2V4HA 3HTKB 1BDCA 3PJSK 1H0TA 3AEDC 5APUA 1YJNP 3G9RA 2OYIA 2ZT9B 2HPCA 2K9JB 1DH3A 2PFXA 3L75D 1M57D 1BCCE 3HE5B 1NTZG 2Y0EA 1QVGO 1PGQA 3AE4C 1JCDA 4AYCA 2BCCJ 3RL0D 1AA0A 2IBZE 4LLHA 3CX5H 3G4SP 2IBZG 1KYOH 2E42A 1NVOA 4AYZB 3VTPC 1CI6B 3ZDMA 1NTMJ 5APTA 2QG4A 1RQUA 5KJ7A 2E43A 3I5CA 1UIXA 3RGUA 4YTPC 1VQOP 5APQA 5GTIE 3L72J 1KMIZ 1NOHA 4XFJA 3B5NB 2QJPB 4PD4I 3HH0A 1N2DC 1VQKP 2C9LY 1JNMA 2YO2A 3M0DA 1OVUA 1XTGB 3AEEC 1RQVA 2CPBA 3RK3D 2KB7P 4J2NA 5KLVE 1ZRTE 5AW7B 3TYYA 4KHXA 5KLVG 1Q08A 1N7LA 1VQ9P 1GL2C 4H13B 1BOWA 3H1LD 4TLFA 1N73A 4WY4C 2P58A 1FZBA 2AXCA 1H89A 4H13C 3CWBJ 2N1TA 4OGQB 5AVXB 2SPZA 1KILA 1VF5D 1JBGA 1SS1A 5KKZB 5AVWB 2WSEJ 3PTZA 3PLNA 5APSA 3OJAB 2ZT9D 1VDFA 1JY3P 1QLED 4K35A 2OYIB 2YXQB 1LX8A 1N7SB 5KAFE 5BU8B 2JMLA 5AVTB 1JY2O 2OYIC 4ZMDA 1LTBC 4IL6X 3S4RA 4PJ0E 1BCCD 1MV8A 3OW2O 3UCSA 1URQB 2WT7A 2YIUB 1LT1A 4W7ZA 2FFDA 3CXHI 3HRNA 1S5LE 2R3SA 1KZUB 5AW1B 1VPCA 2WSFH 3CPWO 3MUDA 3CD6P 3A5TA 3GPVA 2A45I 1L0NK 2O01J 1JM0A 4O9BA 3CLQA 4GT1A 3N4XA 2GA1A 3L35A 1SQBJ 1PP9E 3IF4A 2M5AA 1T2KC 1PP9G 1YBKA 1AJYA 2JEEA 2OYHA 2P2UA 5KJ7C 1IFIA 3B5ND 3A3YB 4DJGA 1VQMP 1JY2P 3SSUA 3CX5I 1KYOI 3FXEA 1HGZA 1MFZA 4KJMA 3D6YA 3M0DC 2K3RA 4D6TE 4BRYA 3H1LJ 1HGVA 3AEFC 5CCGA 2C0XA 1KD1Q 3E0HA 2RKLA 2JDIH 3M9HA 3Q2YA 5K5GB 4W80A 2HVAA 4OGQD 4N78E 1MFTA 3Q1MA 1N73C 2N1TB 1Y47A 5GTIH 2I1KA 2E75C 1IO4A 2Z5IA 3GP4A 2N1TC 4A7PA 3Q5RA 2CK3H 1KILC 1QL1A 5KLIC 1DEBA 1J2JB 1M8OB 3R8KA 1N7SD 2E76C 4U3FE 1BCCJ 3NXSA 1LWUA 2ZYGA 1KB9D 4U3FG 1URQD 3Q5PA 2Q7CA 1LP1A 4WWIA 2KNCB 3EZFA 1SFCD 3FGAD 4ASWA 3CC4P 2MKVA 4IFMA
chains in the Genus database with same CATH topology
4R24B 2ZHGA 3AECC 2GOVA 3GF3A 4H0LC 4H13B 1BOWA 2QJPC 2OG0A 2ZHHA 2KVVA 1S1CX 3AE9C 3IN6A 5KATA 1FDIA 4R22B 3LW5J 1DD4A 1OW7A 3H25A 4H13D 1KQGB 3R8JA 5KAUA 4H13C 3RL0g 4OGQB 3AE4C 1VF5B 2E74B 2K9YA 1U57A 1Y9BA 1Q09A 1Q0AA 2VZ4A 1PV3A 4Z1MH 2WSFJ 1RH6A 2QJYC 3RK3E 4R4LA 2KCUA 2FYNC 3GF7A 2QIWA 5KAWA 3AE3C 1EXJA 5L8RJ 4U7JA 4PV1D 1VF5D 2OQQA 2E75B 1JBGA 4PV1C 4I7ZC 3Q3DA 1VF5C 4DCZA 3D6YA 3IAOA 2WSEJ 2NZ2A 2P10A 1PM6A 3GMAA 1KTMA 1KQFB 3GK6A 3AE6C 1YQ4C 1JB0J 2J5UA 3AEFC 2ZT9D 5M1BA 1NYHA 4AYZB 5I41B 2ZT9C 4GDOA 3AEGC 4H44B 1K05A 3EWKA 1LX8A 1GMJA 3EZ7A 3O6QA 2FBWC 2D2CB 4Y28J 3E0HA 1HJ0A 3T97B 3B49A 2JMLA 2E76B 2BEZF 1WMKA 3Q2YA 2QJKC 2IEFA 1DIPA 3QAOA 4IL6X 2D2CD 3D6ZA 2HVAA 4OGQD 1RQUA 2D2CC 2E74D 3AEAC 3AEBC 4WLSA 4OGQC 3LURA 2E74C 3Q1MA 3UCSA 5GQQA 4WLWA 2WPVB 1OMIA 1UIXA 2BEQD 3Q5SA 3AE5C 4A1MA 3EZ2A 5KAXA 4YTPC 1R8EA 4KT0J 2E75D 1R8DA 2YMKA 5E01A 2E75C 2H88C 5KKZC 3GP4A 1ZOYC 3R4YA 4RKUJ 1Q05A 3Q5RA 1KMIZ 4TT3H 1VL2A 4YXDC 1TU3F 4XFJA 5KLIC 1D5YA 1IK7A 4H0LB 1OW6A 1S5LX 4R4MA 3D71A 4H44D 1HF9A 3R8KA 2JO1A 1NGMB 1PIXA 3HH0A 4H44C 2WSCJ 5D8CA 1EXIA 5D90A 3S9OA 3GPVA 5I44A 2BOWA 2E76D 3B71A 3AE1C 2E76C 2QSIA 2O01J 3EZ9A 1Y6UA 1KORA 2G8YA 4R4EA 3ABVC 3AE7C 3AEEC 2WQYC 2DG6A 1OW8A 1ZP0C 1FDOA 3Q5PA 1RQVA 4B0YA 3AE8C 3C8VA 5KCBA 2V7QJ 1ZMEC 2IDBA 1Q07A 1K04A 4PV1B 2YIUC 4I7ZB 2H89C 3GLMA 1YQ3C 4J2NA 3EZ6A 1ZRTE 1AJYA 1KILE 3EZFA 1Q90D 1MKMA 3FGAD 3SFEC 3AEDC 2MKVA 1Q08A 2FXPA 5KAVA 4AYZA 3SFDC 3AE2C 3G9RA 1Q06A 2JP3A 2ZT9B 2G3AA 4LHFA 3D70A 1DD3A 1JYHA 4H0LD 1PL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R24 B;  2ZHG A;  3Q5S A;  2GOV A;  4A1M A;  1BOW A;  3GK6 A;  5KAX A;  1R8E A;  4R4E A;  2ZHH A;  5KAT A;  1R8D A;  2J5U A;  5E01 A;  2DG6 A;  4R22 B;  4AYZ B;  5I41 B;  3Q5P A;  4B0Y A;  3GP4 A;  5GQQ A;  5KCB A;  1Q05 A;  1Q07 A;  3Q5R A;  5KAU A;  3R8J A;  3E0H A;  1Q09 A;  1Q0A A;  4J2N A;  2VZ4 A;  3T97 B;  2JML A;  3B49 A;  5KAV A;  1D5Y A;  3Q1M A;  4R4L A;  3Q2Y A;  2KCU A;  4R4M A;  1DIP A;  5KAW A;  1EXJ A;  3QAO A;  3D71 A;  3R8K A;  4AYZ A;  1Q08 A;  3LUR A;  3D6Z A;  3HH0 A;  1JBG A;  2OQQ A;  3G9R A;  1Q06 A;  5D8C A;  5D90 A;  3Q3D A;  1EXI A;  3GPV A;  4WLS A;  5I44 A;  3IAO A;  3D6Y A;  3D70 A;  2BOW A;  3UCS A;  2HVA A;  1JYH A;  4WLW A; 
#chains in the Genus database with same CATH topology
 2IFN A;  2FFD C;  1G2C B;  5GTH H;  3LW5 J;  1R5S A;  3CMA P;  2CPS A;  1SQP K;  1BDD A;  1RH5 B;  1Q09 A;  2VZ4 A;  3MUD C;  1NTK E;  1E5W A;  2KCU A;  2P67 A;  1SQX D;  3MIW A;  3RBZ A;  1NTK G;  3F5H A;  2Q3I A;  5H2F E;  4EDF A;  2P10 A;  3CCV P;  3W67 A;  2WPR A;  1KV4 A;  1KB9 H;  3H1K G;  4Y99 B;  5I41 B;  1IFM A;  4GDO A;  3AEG C;  2OYH C;  1SQV D;  4IFF A;  1DIP A;  2A06 D;  2PP6 A;  1LTA C;  4PJ0 H;  3L37 A;  3O6Q B;  1RF1 B;  2I1J A;  3PHL A;  1RY3 A;  3MTU E;  1ZW0 A;  3HE4 B;  3F89 A;  3A0B H;  1L0L E;  1SQQ G;  2QA4 P;  3TNU A;  5KLV J;  1L0L G;  4YXD C;  3PRJ A;  2KZJ A;  2LKM A;  1CZQ A;  1CW5 A;  1FZE A;  3JC2 2;  1OW6 A;  2O1K A;  1HF9 A;  4D6T D;  1NGM B;  1IFJ A;  4HKZ H;  2WSC J;  3H1H E;  1SP4 A;  2LR2 A;  1BE3 E;  2GUS A;  5AW9 B;  1EZV D;  5CCG C;  1BE3 G;  3HTK A;  3AE8 C;  1ZME C;  2IDB A;  1VQ4 P;  2Q3E A;  1IJD B;  2XV5 A;  1MKM A;  3CCR P;  1KQS O;  3HE5 A;  1DD3 A;  1NAF A;  3AEC C;  1IFN A;  1AQ5 A;  4CPG A;  3IN6 A;  1L2P A;  3RL0 B;  1PV3 A;  1LWU B;  1S2E A;  3P8C D;  1VQN P;  3RL0 C;  4MN4 C;  4M3L A;  1LWU C;  1VQ5 P;  4UB8 H;  1YQ4 C;  4EIJ A;  5AVV B;  1FU1 A;  2ZXE B;  1NU1 G;  1K05 A;  1GMJ A;  3EZ7 A;  1SQQ K;  1NTM D;  4HB1 A;  1FZF A;  3P7K A;  1GK6 A;  2B87 A;  5GQQ A;  1X22 A;  1FBM A;  4L74 A;  2FYU E;  3B5N A;  2KOG A;  3TGU G;  3WUT A;  1J1E B;  4IL6 H;  4RKU J;  3QWO C;  3JCU H;  5CHX A;  1IK7 A;  1SVF A;  2W6A A;  4R4M A;  1FE6 A;  3V6I A;  3UIA A;  3RK2 B;  3B71 A;  4RES B;  1OW8 A;  1MZ9 A;  5KCB A;  3RK3 C;  2Z5H A;  1EDK A;  2L91 A;  2B9B A;  1JTH A;  4DZO A;  3L4F A;  1Q06 A;  2G3A A;  4D6T J;  1PPJ E;  2GOV A;  1PPJ G;  2OG0 A;  1R5L A;  4N3Y B;  3KZI H;  2ZJS E;  2QJK B;  2MJZ A;  3CWB D;  1VF5 B;  2E74 B;  5B66 E;  3H1H D;  4U7J A;  2RN0 A;  1VF5 C;  1Q81 Q;  2H7H A;  1N7S A;  4UB6 H;  1KTM A;  1NTZ E;  5AW0 B;  2ZT9 C;  2GUV A;  2P1J A;  5CCH D;  1IC2 A;  1URQ A;  1K73 Q;  2M8R A;  3WU2 H;  1SFC A;  3AEA C;  3EFG A;  2QVA A;  1T3U A;  2GM4 A;  3L70 E;  1U7J A;  3L73 D;  3L70 G;  4HYT B;  1S5L X;  4XA4 A;  1L4A A;  3CI9 A;  3S9O A;  1RE4 A;  3TSI A;  2XZR A;  2WSE H;  2B87 B;  1SQB D;  2OAR A;  1FDM A;  1NTK J;  1YQ3 C;  3L71 E;  1E79 H;  2M0B A;  3QH9 A;  3L71 G;  1JUN A;  1HUC A;  2FYU D;  1JY3 O;  3SFD C;  2E5T A;  2JP3 A;  3D70 A;  3BCC E;  3B5N C;  3H1J G;  5E79 H;  2KUB A;  2QJP C;  3BCC G;  2R32 A;  2KVV A;  1S1C X;  1HWT C;  5CJ0 A;  3RK2 D;  2YKP A;  4L73 A;  3A7O A;  4Z1M H;  1GD2 E;  1EZV I;  1GU5 A;  3E1R A;  1L0N E;  2KI7 B;  3PP5 A;  1L0N G;  3IAO A;  1KC8 Q;  1G1J A;  1PGJ A;  2HOD A;  2O01 H;  1L0L J;  1IFP A;  1JTH B;  3I55 P;  1QX8 A;  4H44 B;  2O3J A;  3T97 B;  3H1H J;  1FAV A;  1BE3 J;  2E74 D;  1P84 I;  2KLU A;  4WLS A;  4OGQ C;  1M1J B;  5AW6 B;  5KAX A;  2KLV A;  5KKZ C;  4TT3 H;  4GOF A;  5BU5 A;  1FOS F;  3A0H E;  1GW4 A;  1LTT C;  2IYP A;  1VQ7 P;  2RMZ A;  1N7S C;  1NTZ D;  5AW8 B;  4AQR D;  1SLQ A;  1NWQ A;  2KNC A;  4R4E A;  1OZH A;  2WQY C;  3H32 A;  2DG6 A;  1SFC B;  2V7Q J;  1URQ C;  4WVZ A;  1BGY G;  2YIU C;  4I7Z B;  3L73 J;  2H43 A;  2IBZ D;  1G2C A;  4LHF A;  3W68 A;  2KXP B;  3AE9 C;  1L4A B;  3CCU P;  1D7M A;  1AFO A;  1OW7 A;  2FYZ A;  2QE7 H;  1OX3 A;  4W7Y A;  2K9Y A;  4IFD K;  2B88 A;  3GG2 A;  4R4L A;  2FXM A;  5APY A;  2Q9I A;  5KAW A;  1RE4 C;  3MP7 B;  3NMD A;  2FYU J;  3H1I E;  1SQX G;  3V2R A;  2WPS A;  1Q2N A;  3H1I G;  2QM7 A;  4OH8 B;  5M1B A;  3C1L A;  2O01 N;  3O6Q A;  1RF1 A;  3JSV C;  4ZKU A;  3CCE P;  3HE4 A;  2IEF A;  5AW3 B;  4RO0 A;  3L74 G;  2D2C D;  1FS0 E;  3CCL P;  3LUR A;  1KFN A;  1K9M Q;  1LTI C;  3AE5 C;  1SQP E;  5TIS E;  1SQP G;  3LW5 H;  5DJU B;  3HD7 B;  3R4Y A;  5KLV D;  1ZRT D;  5DJT B;  4PD4 E;  2HOD B;  2B89 A;  3CC7 P;  4H44 D;  5BVZ A;  1YIJ P;  2WZ7 A;  3GHG A;  1S3J A;  2HR3 A;  4PV1 B;  2IZ1 A;  3GLM A;  1A02 F;  2XU6 A;  3V4W A;  1KIL E;  5CCH A;  5KAV A;  1VQ6 P;  2LXC B;  1T8Z A;  2KSJ A;  1OFC X;  1NTZ J;  4LGD E;  2R3C A;  1SQX K;  1S72 P;  1X0T A;  4JBZ A;  1U57 A;  3CCQ P;  3TK1 A;  5APV A;  2DW3 A;  3MD0 A;  4HH2 A;  3WMM 0;  5L8R J;  3H32 B;  2L5G B;  4IOI H;  1OVV A;  2WSC H;  2JKV A;  3GMA A;  2BCC G;  1SQV K;  1KQF B;  3L70 J;  2FXO A;  2AEF A;  1LTJ B;  3M9B A;  5AVU B;  1H8A A;  1L4A D;  4YXW H;  3FX0 A;  2POH A;  2QRX A;  3CCJ P;  3G71 P;  4N6J A;  3KXD A;  3CXH E;  3EZ2 A;  1PP9 D;  3H1K E;  1PFI A;  3FWN A;  1T3J A;  2Y9Y A;  1ZOY C;  3L71 J;  5KAF H;  1Q05 A;  3A0H H;  1YYC A;  1EDJ A;  4H0L B;  3L72 G;  4Y99 C;  3BCC J;  1OWA A;  4EI2 A;  2Q5U A;  2R5B A;  5D8C A;  1QL2 A;  5D90 A;  2A45 G;  3S1K A;  2NPS B;  2KS1 B;  1ZR2 A;  3EZ9 A;  1RE3 A;  1SQQ E;  2UWJ E;  1JO5 A;  2QJY B;  3ABV C;  3VOP A;  5AW5 B;  1S5L H;  2M3B A;  1RF1 C;  3OA7 A;  4B86 A;  2P7J A;  1L0N J;  2AEM A;  3HD7 D;  3SFE C;  1PL5 A;  2ZHG A;  1OVR A;  3CX5 E;  1KYO E;  2FY8 A;  3H25 A;  1KQG B;  4LC1 A;  4C7N A;  3RL0 g;  1X79 B;  2WMM A;  3GHG B;  4N78 D;  4WB4 A;  1EC5 A;  4PV1 D;  1Y8A A;  4DCZ A;  3GHG C;  1NTM K;  3SWY A;  1YJW P;  2IBZ I;  3L75 E;  3B4S A;  2C9N Y;  3L75 G;  2XDJ A;  5CCH C;  2E5Y A;  1JOC A;  2HLO A;  4I6M C;  2Y9Z A;  1Q82 Q;  2ZFC A;  3BAS A;  2WVR A;  4U3F D;  3FWL A;  2NRG A;  3AEB C;  3M0A A;  3BAT A;  1BSH A;  2Q1K A;  4KT0 J;  5E01 A;  1NU1 E;  2KZI A;  1FZC B;  1LT9 B;  1UII A;  2JWD A;  3NFQ A;  4OVN F;  3P8M C;  4GOD A;  2ZYA A;  5KTB A;  2ZVO B;  3TGU E;  4JYB A;  2G8Y A;  2OTK E;  2W27 A;  1PP9 J;  1JMB A;  5CBO A;  1NTK D;  1GU4 A;  2W6B A;  3EZ6 A;  2IX7 C;  3M9Q A;  5CMZ A;  1J1E C;  3H1K D;  1EDL A;  4QMA A;  5EFW B;  5AVY B;  5AVR B;  1U7M A;  4H0L D;  1S9K E;  3U59 A;  1AVO A;  3WUU A;  1M56 D;  1NKZ B;  3RK2 C;  3CCM P;  2NPS D;  3R8J A;  4XE5 B;  1Q0A A;  3RK3 E;  2ZXX A;  3USS A;  1FZG A;  4NPE A;  1SQQ D;  1SQP J;  1USD A;  1RE3 C;  1W2E A;  5AVQ B;  1L0L D;  4NPF X;  3T97 A;  1LTS C;  5APW A;  1JB0 J;  1NYH A;  3E1I A;  2ZVN B;  1M1J A;  3H1L G;  4Y28 J;  1HJ0 A;  3B49 A;  2YXR B;  1AVY A;  2QJK C;  1KB9 I;  3KPE A;  2N9Y B;  1BE3 D;  3D6Z A;  5H2F H;  1GK4 A;  4C46 A;  3V2Q A;  1OXZ A;  4C7N B;  1WT6 A;  2E74 C;  1X8Y A;  1JEK A;  3CL3 D;  1XTC C;  1R8E A;  1J1D B;  4I2L C;  1WRG A;  2WSS H;  2H88 C;  5AW4 B;  2C0W A;  3KDP B;  1NH4 A;  1SQB K;  1EXI A;  1PZQ A;  4U3F J;  3BRV B;  1VQP P;  2QSI A;  1ZV8 A;  3VP8 A;  1BCC G;  2FYU K;  1GDT A;  1K04 A;  3MGN A;  1DEE G;  1QVF O;  1GTW A;  3A2A A;  2YMY A;  2R5D A;  2K88 A;  3VMX A;  1NU1 D;  1G1I A;  4DT0 A;  3IFM A;  4R22 B;  2FYN B;  1IFD A;  1Y9B A;  2FYN C;  2WPQ A;  3I56 P;  2XKM A;  2JR8 A;  4AUW A;  3TGU D;  3H1J E;  2Z4E A;  3H1K J;  5CBN A;  1PM6 A;  3GK6 A;  4L75 A;  2J5U A;  5CJ4 A;  1OIP A;  2J59 M;  1JY2 N;  2V7Q H;  4K3A A;  2D2C B;  4DOJ A;  3P32 A;  1ZXG A;  2IYO A;  3NTN A;  4WBA A;  1M90 Q;  3U1C A;  1S9K D;  2IZ0 A;  2D2C C;  3HD7 A;  1SQQ J;  2KP8 A;  2WPV B;  2BEQ D;  3R2P A;  2OYO A;  3VYI A;  2W6J H;  1NTZ K;  1VL2 A;  1HTL C;  1NO4 A;  1GL2 B;  1FJK A;  3CC2 P;  3EQ2 A;  1PPJ D;  1DX7 A;  4WY4 B;  5C39 A;  4H44 C;  1NHL A;  5APX A;  1BSN A;  4GIF A;  2KYV A;  4B0Y A;  3C8V A;  1M1J C;  1Q86 Q;  2R44 A;  5GTH E;  1Q7Y Q;  2N9B A;  1USE A;  4EOT A;  1CSB A;  4JYC A;  3AE2 C;  2JJL A;  2PGD A;  3L75 J;  1IK9 A;  1KFM A;  3C9I A;  4ZKP A;  1EQ7 A;  1H0T B;  1BGY E;  3SWK A;  1RF0 A;  2HPC B;  1H88 A;  2AXT E;  1KB9 E;  1RH6 A;  3CCS P;  1GZL A;  3GF7 A;  1EXJ A;  2Y0D A;  1SFC C;  2FKW B;  4I7Z C;  2K1A A;  1QGK B;  1LTJ A;  4NPD A;  3N7N A;  2W8Z A;  1NU1 J;  3L70 D;  2W83 C;  3A0B E;  2YKQ A;  5B66 H;  4RJT A;  1L4A C;  1SQX E;  3LIE A;  3TGU J;  5KLV K;  3VMY A;  1HH0 A;  3VMA A;  2YMK A;  3L71 D;  2KSE A;  1LGH B;  2OTJ P;  2OTL P;  2NPS A;  2KS1 A;  3BVH A;  3VMZ A;  3H1J D;  3L74 E;  3BCC D;  1SQV E;  2A06 E;  1SQV G;  2O1J A;  3V2N A;  4ZNC A;  3FXD A;  2A06 G;  4BXL A;  4L76 A;  3AE7 C;  2H8P D;  1NKN A;  1EDI A;  2XNX A;  1Q07 A;  1L0N D;  1Q90 D;  1ZLL A;  3HD7 C;  4JQ0 D;  1ZR4 A;  1GL2 D;  4ASV A;  3GF3 A;  4WY4 D;  2K37 A;  4UB8 E;  5KAI E;  4D6T G;  1FDI A;  2I8D A;  2PRR A;  1EZV E;  1AQT A;  1DD4 A;  4H13 D;  5KAU A;  4YPC A;  1EZV G;  1N73 B;  1LJ2 A;  2WSF J;  2BAS A;  3GW6 A;  1NAY A;  1LTG C;  2HFE D;  2OQQ A;  2E75 B;  4PV1 C;  1HBW A;  3Q3D A;  1QEX A;  1KIL B;  2ZYD A;  5KLI B;  5AVS B;  3AE6 C;  4DCK A;  1JMM A;  4IL6 E;  2E76 B;  1P84 E;  1PGP A;  3JCU E;  3MZW B;  3QAO A;  2HG5 D;  4C7R A;  2BCC E;  3P8C E;  1FZC A;  2YO3 A;  1LT9 A;  1BGY D;  1FC2 C;  2KK7 A;  1RF0 C;  1R8D A;  5B5E E;  3G6E P;  3E7K A;  2WWW A;  2WT7 B;  1D5Y A;  2FFD B;  1NTM E;  2JO1 A;  1W5C E;  1AV1 A;  1LTJ C;  2YNY A;  1NTM G;  3AE1 C;  1T6A A;  1Y6U A;  1ZP0 C;  2JWA A;  3KZI E;  1T2K D;  2RH0 A;  2H89 C;  3L72 E;  3KQG A;  1X9V A;  1YJ9 P;  1YI2 P;  3H1J J;  3BRT B;  5KJ7 D;  3H1I D;  2M5A B;  1HJB A;  3VP9 A;  1JYH A;  1A02 J;  1YTZ T;  4H0L C;  2OYH B;  4UB6 E;  1VQ8 P;  4OWF A;  5KAT A;  2AXT H;  2QEX P;  3L74 D;  2NPS C;  3KHU A;  3U1A A;  2QJY C;  2QIW A;  3AE3 C;  3MHV A;  3WU2 E;  1SQP D;  2ITA A;  1PGO A;  1GW3 A;  1HVV A;  1W2B O;  2IPP A;  4PD4 D;  2WTY A;  1IZN B;  3K5B A;  5AVZ B;  2BEZ F;  4BRY B;  3CWB E;  1N8R Q;  3HUS A;  3M06 A;  3CWB G;  3G3Z A;  3TDK A;  3H1H G;  1OMI A;  3Q5S A;  2M3E A;  3M91 A;  2E75 D;  2N1T D;  2K9J A;  1KIL D;  3H6P A;  1YHQ P;  1KN7 A;  4I1L A;  4GOE A;  1PIX A;  2AEJ A;  5I44 A;  1NTK K;  2E76 D;  2QM8 A;  5TIS H;  1KQL A;  1BGY J;  1KOR A;  3V4Q A;  5E79 E;  2Q6Q A;  1FDO A;  3V2P A;  3PH0 A;  1P84 D;  4PD4 H;  1FJP A;  1N86 A;  1M7L A;  2XND H;  3L73 E;  2BCC D;  4AYZ A;  2FXP A;  3L73 G;  1FZC C;  1LT9 C;  1CI6 A;  1LP1 B;  5KAI H;  3RBX A;  4R24 B;  4BWN A;  4HJG H;  1FZA A;  2ZHH A;  3CME P;  1M1K Q;  1YTZ I;  4JF7 A;  1SQB E;  3B8E B;  1S4X A;  4GKG A;  1SQB G;  1L0L K;  3LID A;  1SQX J;  2OGU A;  3H1I J;  3CXH D;  1K8A Q;  2NZ2 A;  3V5B A;  3WUV A;  3KYQ A;  2IFM A;  2FYU G;  1LNQ A;  3L72 D;  1FOS E;  4JPZ B;  3EWK A;  1P84 H;  2FBW C;  3L74 J;  2ZAE B;  1JCC A;  1MUU A;  1WMK A;  1SQV J;  2HYN A;  2YKO A;  1VQL P;  2J58 A;  1Z56 A;  1YIT P;  4WLW A;  5B5E H;  4A1M A;  3ITK A;  3RK3 B;  3L36 A;  1GL2 A;  4EYY Q;  3TF5 A;  3SWF A;  1ZN5 A;  2LXB A;  2VRS A;  3O8Z A;  4WY4 A;  3H1L E;  2W90 A;  2PAJ A;  1TU3 F;  3II6 A;  3OAK A;  2WIT A;  3D71 A;  3VN0 A;  3IR9 A;  3TNU B;  3CX5 D;  2BOW A;  3CXH H;  5AW2 B;  1KYO D;  5CCG D;  3HUS B;  2Y0C A;  2KIK A;  3EFF K;  1JY3 N;  5TJH A;  1RHZ B;  3HUS C;  1NU1 K;  1NJI Q;  2A45 H;  1J1D C;  2V4H A;  3HTK B;  1BDC A;  3PJS K;  1H0T A;  3AED C;  5APU A;  1YJN P;  3G9R A;  2OYI A;  2ZT9 B;  2HPC A;  2K9J B;  1DH3 A;  2PFX A;  3L75 D;  1M57 D;  1BCC E;  3HE5 B;  1NTZ G;  2Y0E A;  1QVG O;  1PGQ A;  3AE4 C;  1JCD A;  4AYC A;  2BCC J;  3RL0 D;  1AA0 A;  2IBZ E;  4LLH A;  3CX5 H;  3G4S P;  2IBZ G;  1KYO H;  2E42 A;  1NVO A;  4AYZ B;  3VTP C;  1CI6 B;  3ZDM A;  1NTM J;  5APT A;  2QG4 A;  1RQU A;  5KJ7 A;  2E43 A;  3I5C A;  1UIX A;  3RGU A;  4YTP C;  1VQO P;  5APQ A;  5GTI E;  3L72 J;  1KMI Z;  1NOH A;  4XFJ A;  3B5N B;  2QJP B;  4PD4 I;  3HH0 A;  1N2D C;  1VQK P;  2C9L Y;  1JNM A;  2YO2 A;  3M0D A;  1OVU A;  1XTG B;  3AEE C;  1RQV A;  2CPB A;  3RK3 D;  2KB7 P;  4J2N A;  5KLV E;  1ZRT E;  5AW7 B;  3TYY A;  4KHX A;  5KLV G;  1Q08 A;  1N7L A;  1VQ9 P;  1GL2 C;  4H13 B;  1BOW A;  3H1L D;  4TLF A;  1N73 A;  4WY4 C;  2P58 A;  1FZB A;  2AXC A;  1H89 A;  4H13 C;  3CWB J;  2N1T A;  4OGQ B;  5AVX B;  2SPZ A;  1KIL A;  1VF5 D;  1JBG A;  1SS1 A;  5KKZ B;  5AVW B;  2WSE J;  3PTZ A;  3PLN A;  5APS A;  3OJA B;  2ZT9 D;  1VDF A;  1JY3 P;  1QLE D;  4K35 A;  2OYI B;  2YXQ B;  1LX8 A;  1N7S B;  5KAF E;  5BU8 B;  2JML A;  5AVT B;  1JY2 O;  2OYI C;  4ZMD A;  1LTB C;  4IL6 X;  3S4R A;  4PJ0 E;  1BCC D;  1MV8 A;  3OW2 O;  3UCS A;  1URQ B;  2WT7 A;  2YIU B;  1LT1 A;  4W7Z A;  2FFD A;  3CXH I;  3HRN A;  1S5L E;  2R3S A;  1KZU B;  5AW1 B;  1VPC A;  2WSF H;  3CPW O;  3MUD A;  3CD6 P;  3A5T A;  3GPV A;  2A45 I;  1L0N K;  2O01 J;  1JM0 A;  4O9B A;  3CLQ A;  4GT1 A;  3N4X A;  2GA1 A;  3L35 A;  1SQB J;  1PP9 E;  3IF4 A;  2M5A A;  1T2K C;  1PP9 G;  1YBK A;  1AJY A;  2JEE A;  2OYH A;  2P2U A;  5KJ7 C;  1IFI A;  3B5N D;  3A3Y B;  4DJG A;  1VQM P;  1JY2 P;  3SSU A;  3CX5 I;  1KYO I;  3FXE A;  1HGZ A;  1MFZ A;  4KJM A;  3D6Y A;  3M0D C;  2K3R A;  4D6T E;  4BRY A;  3H1L J;  1HGV A;  3AEF C;  5CCG A;  2C0X A;  1KD1 Q;  3E0H A;  2RKL A;  2JDI H;  3M9H A;  3Q2Y A;  5K5G B;  4W80 A;  2HVA A;  4OGQ D;  4N78 E;  1MFT A;  3Q1M A;  1N73 C;  2N1T B;  1Y47 A;  5GTI H;  2I1K A;  2E75 C;  1IO4 A;  2Z5I A;  3GP4 A;  2N1T C;  4A7P A;  3Q5R A;  2CK3 H;  1KIL C;  1QL1 A;  5KLI C;  1DEB A;  1J2J B;  1M8O B;  3R8K A;  1N7S D;  2E76 C;  4U3F E;  1BCC J;  3NXS A;  1LWU A;  2ZYG A;  1KB9 D;  4U3F G;  1URQ D;  3Q5P A;  2Q7C A;  1LP1 A;  4WWI A;  2KNC B;  3EZF A;  1SFC D;  3FGA D;  4ASW A;  3CC4 P;  2MKV A;  4IFM A; 
#chains in the Genus database with same CATH homology
 4R24 B;  2ZHG A;  3AEC C;  2GOV A;  3GF3 A;  4H0L C;  4H13 B;  1BOW A;  2QJP C;  2OG0 A;  2ZHH A;  2KVV A;  1S1C X;  3AE9 C;  3IN6 A;  5KAT A;  1FDI A;  4R22 B;  3LW5 J;  1DD4 A;  1OW7 A;  3H25 A;  4H13 D;  1KQG B;  3R8J A;  5KAU A;  4H13 C;  3RL0 g;  4OGQ B;  3AE4 C;  1VF5 B;  2E74 B;  2K9Y A;  1U57 A;  1Y9B A;  1Q09 A;  1Q0A A;  2VZ4 A;  1PV3 A;  4Z1M H;  2WSF J;  1RH6 A;  2QJY C;  3RK3 E;  4R4L A;  2KCU A;  2FYN C;  3GF7 A;  2QIW A;  5KAW A;  3AE3 C;  1EXJ A;  5L8R J;  4U7J A;  4PV1 D;  1VF5 D;  2OQQ A;  2E75 B;  1JBG A;  4PV1 C;  4I7Z C;  3Q3D A;  1VF5 C;  4DCZ A;  3D6Y A;  3IAO A;  2WSE J;  2NZ2 A;  2P10 A;  1PM6 A;  3GMA A;  1KTM A;  1KQF B;  3GK6 A;  3AE6 C;  1YQ4 C;  1JB0 J;  2J5U A;  3AEF C;  2ZT9 D;  5M1B A;  1NYH A;  4AYZ B;  5I41 B;  2ZT9 C;  4GDO A;  3AEG C;  4H44 B;  1K05 A;  3EWK A;  1LX8 A;  1GMJ A;  3EZ7 A;  3O6Q A;  2FBW C;  2D2C B;  4Y28 J;  3E0H A;  1HJ0 A;  3T97 B;  3B49 A;  2JML A;  2E76 B;  2BEZ F;  1WMK A;  3Q2Y A;  2QJK C;  2IEF A;  1DIP A;  3QAO A;  4IL6 X;  2D2C D;  3D6Z A;  2HVA A;  4OGQ D;  1RQU A;  2D2C C;  2E74 D;  3AEA C;  3AEB C;  4WLS A;  4OGQ C;  3LUR A;  2E74 C;  3Q1M A;  3UCS A;  5GQQ A;  4WLW A;  2WPV B;  1OMI A;  1UIX A;  2BEQ D;  3Q5S A;  3AE5 C;  4A1M A;  3EZ2 A;  5KAX A;  4YTP C;  1R8E A;  4KT0 J;  2E75 D;  1R8D A;  2YMK A;  5E01 A;  2E75 C;  2H88 C;  5KKZ C;  3GP4 A;  1ZOY C;  3R4Y A;  4RKU J;  1Q05 A;  3Q5R A;  1KMI Z;  4TT3 H;  1VL2 A;  4YXD C;  1TU3 F;  4XFJ A;  5KLI C;  1D5Y A;  1IK7 A;  4H0L B;  1OW6 A;  1S5L X;  4R4M A;  3D71 A;  4H44 D;  1HF9 A;  3R8K A;  2JO1 A;  1NGM B;  1PIX A;  3HH0 A;  4H44 C;  2WSC J;  5D8C A;  1EXI A;  5D90 A;  3S9O A;  3GPV A;  5I44 A;  2BOW A;  2E76 D;  3B71 A;  3AE1 C;  2E76 C;  2QSI A;  2O01 J;  3EZ9 A;  1Y6U A;  1KOR A;  2G8Y A;  4R4E A;  3ABV C;  3AE7 C;  3AEE C;  2WQY C;  2DG6 A;  1OW8 A;  1ZP0 C;  1FDO A;  3Q5P A;  1RQV A;  4B0Y A;  3AE8 C;  3C8V A;  5KCB A;  2V7Q J;  1ZME C;  2IDB A;  1Q07 A;  1K04 A;  4PV1 B;  2YIU C;  4I7Z B;  2H89 C;  3GLM A;  1YQ3 C;  4J2N A;  3EZ6 A;  1ZRT E;  1AJY A;  1KIL E;  3EZF A;  1Q90 D;  1MKM A;  3FGA D;  3SFE C;  3AED C;  2MKV A;  1Q08 A;  2FXP A;  5KAV A;  4AYZ A;  3SFD C;  3AE2 C;  3G9R A;  1Q06 A;  2JP3 A;  2ZT9 B;  2G3A A;  4LHF A;  3D70 A;  1DD3 A;  1JYH A;  4H0L D;  1PL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...