3Q5RA

Crystal structure of bmrr bound to kanamycin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/rna/antibiotic
total genus 79
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5rA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5rA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5rA03
3D71A 4R4EA 1Q05A 3Q1MA 2BOWA 3IAOA 3E0HA 3GK6A 5KAUA 1EXIA 1Q09A 5I41B 2J5UA 5GQQA 3D70A 4WLSA 1JBGA 1Q0AA 5D8CA 4A1MA 5KAWA 3Q3DA 5KCBA 5E01A 3Q5RA 1R8DA 1DIPA 1BOWA 3R8JA 4WLWA 1R8EA 5KATA 5D90A 2VZ4A 3Q2YA 2HVAA 3D6ZA 3Q5SA 1JYHA 2ZHHA 2DG6A 3R8KA 3GP4A 3HH0A 3G9RA 4AYZB 3UCSA 3LURA 3D6YA 1Q08A 1D5YA 3T97B 3QAOA 1EXJA 5KAVA 1Q07A 5KAXA 2OQQA 2ZHGA 4R24B 2GOVA 3B49A 4J2NA 4R4MA 4AYZA 4B0YA 1Q06A 5I44A 2KCUA 4R4LA 3Q5PA 2JMLA 3GPVA 4R22B
chains in the Genus database with same CATH superfamily
4A7PA 3M91A 1KFMA 4U3FD 1N73A 1PFIA 2XKMA 1HGZA 2YMKA 3CXHH 2N1TD 4YXDC 3USSA 2BCCE 3L36A 2HVAA 2WWWA 3L70G 1EXJA 5AW4B 3GF7A 4WY4A 2D2CC 2FFDC 1IFIA 2GUVA 3A5TA 1VQ7P 5KJ7D 2E42A 2P7JA 4WBAA 2P2UA 1M8OB 1LX8A 5AW0B 2E75B 3C8VA 1PGOA 1PP9G 2GOVA 1LTJC 1Q06A 4W7YA 5AVTB 3B71A 1NAYA 2OGUA 2Q9IA 4GODA 1KQLA 3BCCJ 4WLWA 3D6ZA 3L70E 1OW6A 5AVSB 1BE3E 2K9JA 1L0ND 3CX5I 5AVXB 1EDJA 2QEXP 2L91A 2K9YA 1NTZJ 4JPZB 2QJPC 4CPGA 2ZYAA 3JCUH 1VPCA 2BCCD 5TISE 1WMKA 2DG6A 3EZ7A 3D6YA 3KZIH 1RE3A 4UB8H 4JYCA 1X79B 1SVFA 2ZAEB 4EI2A 2YKOA 1L0LG 5KAIE 4H13C 1YTZT 5DJTB 3BRVB 4GOFA 1VQMP 2OTLP 3BASA 2RH0A 4UB6H 3V2PA 2YMYA 3H1HG 1FAVA 5CBOA 5CCGA 2R5DA 1URQA 2IZ1A 2KNCA 4RKUJ 1BCCG 1P84H 1JNMA 2PFXA 2FYZA 3WU2E 3L70D 4D6TE 1SQBK 5AVQB 3T97B 2KI7B 3CCRP 3Q1MA 3IAOA 1JOCA 2IYOA 1DEEG 2AXTH 5KKZC 1DEBA 1PP9D 4IL6H 3CMAP 2YO3A 1YJWP 3TDKA 2VRSA 1KILE 2FYNC 2W83C 3A0BH 2ZT9C 1EZVG 3SFDC 1QL2A 4H0LB 2E75D 2YNYA 1SQPK 5KLVJ 3S9OA 2HFED 2UWJE 3H1IE 3MHVA 1LGHB 2JR8A 5AW7B 1L4AA 2O01N 1AVOA 2QIWA 2HG5D 3M0DC 1IFPA 1YJ9P 1FZBA 2KS1B 1FZCB 1M7LA 1SQXK 2Q3IA 3VMYA 4Y28J 1RF0A 3TSIA 2FYUG 3HE4A 3VP9A 4PJ0E 4J2NA 3TNUB 1VL2A 1SQVJ 1PGPA 1PV3A 4Y99B 1L0LD 1AFOA 3AE9C 3MTUE 3HD7A 1FZGA 1R8DA 4HKZH 1GW4A 2ZYDA 2LXCB 4AYZB 3H1HD 3MP7B 3KDPB 3MUDC 3CI9A 3RK2B 1NAFA 2XNXA 3VMZA 3I56P 2FYUE 2R44A 1LTSC 4RJTA 1H0TB 1NTKG 3H1JE 1JO5A 1Q05A 5CCGC 3SSUA 1LTBC 3BCCG 4U7JA 2FXOA 5AVVB 1YITP 1RY3A 3CCEP 3QH9A 3CMEP 4I1LA 3OJAB 2G8YA 2E74B 1NTZG 1FZEA 3IFMA 4OWFA 3L72E 1USDA 3CXHE 4WB4A 1M90Q 1YQ4C 5TISH 3L35A 3GP4A 1RQVA 3KQGA 2W27A 5KLIB 1Q07A 3AE1C 1BE3J 3N4XA 3CC4P 4DZOA 3FWLA 1SFCA 1GL2D 3H1KE 5CJ4A 1LNQA 2FYUD 3TGUJ 4BRYA 1AQTA 1L4AC 4LLHA 1SQBE 1ZR2A 4N6JA 2JWDA 1LTTC 1NTZE 3H1JD 1EXIA 1SQQK 2C0WA 2MJZA 4WLSA 2I8DA 3P8CE 1IFDA 2QJKC 3WU2H 4KHXA 2WZ7A 2A45G 1CW5A 3EZFA 3S1KA 3R2PA 1IK7A 3AE3C 3H32A 5H2FE 4IOIH 1S2EA 2B87B 3FX0A 1OVVA 1T2KD 3W68A 3JCUE 1LWUB 3PHLA 3CXHD 2J5UA 2NPSD 4H0LC 1FZAA 1KB9I 3MGNA 2K1AA 2QE7H 1FOSE 1IK9A 3R8JA 3Q5SA 2G3AA 3H6PA 2ZHHA 3RK2D 4YTPC 1PZQA 4D6TJ 4DCKA 2FFDA 3D71A 3SWFA 5KLVG 3BCCD 4ZMDA 2KXPB 2JJLA 3GF3A 1FZCC 3O6QB 4ASWA 1N7SA 3SWKA 1LTJA 1Q08A 2FBWC 1NTZD 1AJYA 5I44A 3RL0D 2W90A 1NHLA 1MFZA 1Q7YQ 1J2JB 2E5TA 3P8CD 3B5ND 3EWKA 2E74D 3H1IJ 3HUSB 2P10A 3CX5H 1CZQA 4AYCA 5GTHH 4NPEA 2ZHGA 4R24B 5KLVE 4PJ0H 4C46A 1JM0A 4R4EA 2HODA 2AXTE 2N1TA 2WPVB 4IFFA 2WMMA 1G1JA 2H43A 1JY3N 2KSJA 2LXBA 4RESB 4IFDK 5KAWA 5KCBA 3A0BE 2IBZI 2IZ0A 1NTME 3IN6A 4XA4A 2N9YB 1MKMA 2C0XA 1NYHA 1H88A 4OH8B 4LC1A 1JCCA 1SFCC 1VQPP 2XU6A 2BCCG 1YJNP 4XFJA 2WSCH 4EOTA 1SQVE 2JP3A 1RH5B 1CI6B 4ZKPA 1JY3P 3L74J 4JBZA 3FGAD 4N78E 1MZ9A 3L37A 3PH0A 1IFNA 1NJIQ 1QVGO 1DH3A 1LT9B 2HLOA 4GIFA 3C1LA 5KLVD 1HJBA 2WSCJ 2WPRA 1S4XA 4K35A 1QX8A 1KB9E 5KLIC 2QM8A 3H1JJ 1KFNA 3EQ2A 3L73E 3O8ZA 5AVZB 4C7NA 2JO1A 3N7NA 2IEFA 1FU1A 1A02F 1M57D 1J1DB 1BE3G 2ZVNB 2YKPA 3GPVA 2XZRA 1FC2C 4Z1MH 4I6MC 3GK6A 5CCHD 3G4SP 3HRNA 3VTPC 4I2LC 2M5AA 1VF5D 2YO2A 3P32A 3TGUG 3WUVA 2WQYC 3L72J 1MFTA 1K04A 3M0DA 2GUSA 1LP1B 1SQVD 4GT1A 1D5YA 5KAXA 1N7SC 2ZFCA 1DX7A 2C9NY 1UIXA 1S9KD 3MIWA 4L73A 3BVHA 5E79E 1WT6A 1S3JA 1K8AQ 2Q7CA 2H89C 5D8CA 2XDJA 3H1KJ 1AVYA 1H8AA 3MD0A 1Z56A 1SQBJ 1KB9D 1AA0A 4DOJA 1NU1K 3GHGB 5H2FH 3A0HE 2CPSA 1FDMA 3AEEC 2CK3H 3L73D 2WT7B 3TGUE 3KPEA 2N1TC 4I7ZB 3CL3D 1OXZA 1YYCA 2IBZE 4JYBA 1Q90D 1L2PA 4D6TG 3RBZA 3MUDA 1VQ8P 1BOWA 1EQ7A 1EZVI 3HE5B 5AVYB 5L8RJ 5KJ7C 1NO4A 1KILB 5APWA 1GK6A 2FKWB 2WSEH 1RF1B 1SQPJ 2OYHB 1PL5A 1T6AA 2QG4A 4TT3H 5K5GB 1KYOI 2WITA 1GU4A 4HJGH 3FXEA 1G2CB 2Q3EA 3HUSC 1HTLC 4NPDA 3FWNA 4M3LA 1ZRTE 2QJYC 2FXPA 3H25A 2NRGA 4WY4D 2AEFA 3L71E 2W6AA 2Y0CA 1QVFO 2WSEJ 3H1IG 1X0TA 2VZ4A 1BE3D 1NTKK 3VMAA 1T3UA 2R5BA 1OMIA 3GW6A 3KYQA 5KAFE 3A2AA 1FDIA 2POHA 2GA1A 3TGUD 3BATA 2PGDA 5EFWB 1YTZI 2HPCB 3V5BA 3U1AA 3U1CA 4R4LA 4OGQD 1IJDB 1M1JB 3VN0A 5BVZA 3CWBE 3HE4B 4IL6X 1QLED 1ZV8A 2R3SA 3LW5H 3VOPA 1FBMA 1LT9C 3H1LE 3L74G 1GL2B 4R22B 3T97A 2RKLA 3L71D 1GD2E 1DD4A 4NPFX 3BRTB 4DJGA 1NTMJ 4OVNF 4D6TD 3CX5E 5GTHE 3LW5J 1BSNA 2JWAA 4H44D 4XE5B 1RH6A 2XV5A 3OAKA 2QM7A 1KB9H 3H1JG 4PV1B 3CCMP 1URQD 1QEXA 5AVWB 5AW5B 1ZMEC 1JY2O 1IFJA 1EC5A 3AEGC 1KILD 5KAVA 3L74E 2NPSB 4ZNCA 3LIEA 2E75C 2V4HA 2NZ2A 1U7MA 3JSVC 2E76D 1NKNA 3H1ID 4JF7A 3AE6C 1KYOE 2KS1A 1FZCA 1NKZB 2KYVA 3L72G 1PGQA 3KXDA 3L73J 1ZOYC 2KZJA 2ZXEB 2OQQA 1N7LA 2OYIB 5KTBA 1BDDA 1Q2NA 1NU1E 3TNUA 2E5YA 5E79H 1SQQJ 1DD3A 2KB7P 3RBXA 3GHGC 3CX5D 3C9IA 2O01H 1GK4A 1HH0A 3H1KG 1JB0J 1KORA 3RL0B 4I7ZC 2A45I 1HJ0A 1SQBG 4AYZA 3B5NB 5M1BA 2OARA 3VP8A 1N2DC 3F89A 1PPJE 4PD4I 3A0HH 1VQ9P 3AECC 5B66H 4BXLA 3RK3E 1KQGB 2WSFH 2O01J 3HTKB 2FXMA 2OYHC 3L74D 3FXDA 4MN4C 1W2BO 4YXWH 3WMM0 2QRXA 1CSBA 2ZVOB 1H0TA 1MUUA 3M0AA 1LJ2A 2V7QH 2KLVA 2M3EA 1A02J 1DIPA 1HF9A 2N9BA 3HD7D 1FZFA 2WSFJ 1L0NK 3JC22 3WUTA 5I41B 2H8PD 3V4QA 3PTZA 5APXA 1OFCX 2L5GB 1M56D 2V7QJ 1PGJA 1JTHB 4PV1D 3HH0A 2AEJA 1AQ5A 1QL1A 1USEA 2M8RA 5KAFH 1X9VA 1D7MA 1SQPE 3L72D 2P58A 2A06E 3RK3D 1M1JC 1VQ4P 3L71J 2Y9YA 1OW7A 2YKQA 2ZYGA 3K5BA 2KP8A 1NWQA 3B8EB 1YHQP 1SQXE 3AEBC 1X22A 5GQQA 1EDIA 1GL2C 3H1KD 3CCVP 1Y8AA 2KVVA 1OVUA 5CBNA 1SQBD 2KZIA 2QJPB 3B49A 2PRRA 1VF5B 2OG0A 3CC7P 1S5LH 3L75J 2ITAA 4GOEA 3CCJP 2B87A 1NTMG 1KV4A 1Q86Q 4Y99C 3TF5A 1LWUA 1JCDA 3CWBJ 1NGMB 5AW1B 4PD4E 3ITKA 1SQVG 4H13B 1KC8Q 3U59A 1SQPD 1T2KC 3M06A 3H1LJ 5KAUA 2NPSC 2A06D 5GTIE 1HVVA 2KUBA 3M9HA 5KATA 3RK2C 5CJ0A 3O6QA 3UCSA 4GDOA 3E7KA 3PP5A 1KTMA 2WPQA 2CPBA 5APTA 5KJ7A 1K73Q 3W67A 1VQ5P 4U3FE 2W6BA 1KYOH 1OX3A 3L73G 2B88A 2LKMA 2P67A 3Q2YA 4ZKUA 2Z4EA 3P7KA 3AE2C 4AQRD 3HUSA 1RQUA 5KKZB 1HGVA 2BASA 3RL0C 1N73B 2IYPA 2D2CD 1L0LK 1YIJP 5TJHA 3B5NC 2E74C 1VQNP 4N3YB 5B5EE 1JMBA 1TU3F 3G3ZA 1GMJA 2I1KA 4WY4B 1ZR4A 1LTIC 1Y6UA 3SWYA 1Q81Q 1Q09A 5C39A 3F5HA 3D70A 1NU1J 1X8YA 3CD6P 2YXQB 1RE4A 2ZJSE 4YPCA 5BU5A 3TYYA 3ZDMA 2HYNA 2YIUB 1PM6A 4TLFA 2JMLA 1M1KQ 1SQQE 4RO0A 3IR9A 4BWNA 1CI6A 1NTMD 1Y9BA 1MV8A 2OTKE 1OW8A 2AXCA 3GMAA 3GLMA 2K9JB 5APVA 4OGQB 1KN7A 2FY8A 1LT9A 5APYA 3AE7C 2IBZG 1KMIZ 2KIKA 3IF4A 3CCUP 4N78D 4QMAA 1QGKB 2Y0EA 1VDFA 4H13D 3S4RA 3CC2P 1LWUC 1NVOA 1PIXA 3QAOA 2E43A 1NTKJ 2KCUA 1FJKA 1SLQA 1N86A 2K3RA 2JKVA 5B66E 3AEFC 3CCQP 2FYUK 3L71G 4H44B 2KK7A 5CHXA 1YI2P 3PRJA 3EFFK 1FDOA 5BU8B 2PP6A 1URQB 1LP1A 1SQQD 2KNCB 1VQ6P 3VMXA 3E0HA 5CCHC 2RN0A 1VF5C 1IZNB 1BSHA 1PP9E 3R8KA 2E76B 2M3BA 2YXRB 2I1JA 1HUCA 1FS0E 2IPPA 2GM4A 2KLUA 3PJSK 3A7OA 2ZT9D 3L75G 2K37A 1IO4A 2Z5IA 1BGYJ 2Y0DA 3GHGA 1S72P 1JBGA 1KZUB 1HBWA 1SQXJ 3CWBG 5DJUB 2WT7A 2A45H 4JQ0D 1J1EB 2IFMA 2B9BA 4PD4H 3H1LG 4ASVA 1L4AB 3HE5A 4WWIA 1KILA 5GTIH 3Q3DA 2AEMA 2DW3A 1RF1A 3II6A 3G6EP 2OYHA 1RE4C 2IBZD 1WRGA 3OA7A 1NTZK 2MKVA 3L75E 4R4MA 4C7RA 4HH2A 4KT0J 2IFNA 1G2CA 5APUA 2QJKB 5AW2B 1ZW0A 1KD1Q 1L0LE 5APQA 1YBKA 1N73C 1SP4A 1Q0AA 2OYOA 5CMZA 3CXHI 5AW6B 3P8MC 1XTCC 1IC2A 1GU5A 3H1HE 2KOGA 2O3JA 1ZRTD 1S5LE 1JMMA 1OVRA 2J58A 4WY4C 1G1IA 1BCCE 3M9QA 3HD7B 1T3JA 1N8RQ 3NMDA 5B5EH 1JY3O 4W7ZA 4U3FJ 1JUNA 2HPCA 1NH4A 2H7HA 2QSIA 3V6IA 2J59M 2YIUC 1YQ3C 1J1DC 4EDFA 1NU1G 1LTAC 3V2QA 5CCGD 1M1JA 2R32A 4L75A 4WVZA 3SFEC 1EZVE 3L75D 3AE5C 1KQSO 2SPZA 3QWOC 1EDKA 4OGQC 3Q5PA 3RK3B 4O9BA 1XTGB 1Y47A 4L76A 1GL2A 3CWBD 1FJPA 1GW3A 1PPJG 4DT0A 2ZXXA 4B86A 2WVRA 3MZWB 3M9BA 3H1LD 5AW8B 5KLVK 3CCLP 3PLNA 1RE3C 1W5CE 1L0NJ 1BCCD 2PAJA 3AEAC 2BEZF 3KHUA 1VQOP 3A3YB 3AEDC 1R8EA 2LR2A 1JYHA 1LT1A 2BCCJ 1L4AD 3I5CA 1H89A 4H44C 2WTYA 1GZLA 1OIPA 2NPSA 1NTMK 1SFCB 2BEQD 2R3CA 3RGUA 3LIDA 1URQC 3CCSP 4HYTB 4BRYB 1FE6A 3E1IA 1UIIA 1KILC 5D90A 1EZVD 1P84I 3V4WA 1RF1C 1SQVK 2WSSH 2E76C 1GDTA 2OYIA 1KYOD 2Y9ZA 2OTJP 1VQKP 1SQPG 4H0LD 1ZXGA 2A06G 2O1JA 4HB1A 4AUWA 1E5WA 1NTKE 3H32B 1FOSF 3L70J 1JEKA 4LGDE 5AW9B 1NU1D 3CLQA 1J1EC 2BOWA 3B5NA 3BCCE 1BGYG 1IFMA 2B89A 2JDIH 1SQXG 5KAIH 4W80A 1T8ZA 4A1MA 1OWAA 1PP9J 5AVRB 2D2CB 4KJMA 2FFDB 2C9LY 3HTKA 3TK1A 1E79H 1ZP0C 1PPJD 2IDBA 3UIAA 1KQFB 2HR3A 3NFQA 1VQLP 1N7SB 1RF0C 1LTJB 2K88A 3R4YA 3EZ2A 1K9MQ 1U57A 5AW3B 2Q6QA 1EDLA 3E1RA 1BGYE 3NTNA 4LHFA 1S1CX 2JEEA 3OW2O 3NXSA 5AVUB 2M0BA 3HD7C 4IFMA 1NTKD 2H88C 2W8ZA 4GKGA 1JTHA 3KZIE 3AE8C 3GG2A 3WUUA 4UB8E 1GTWA 2HODB 2N1TB 1W2EA 5APSA 3G71P 2WPSA 1AV1A 4L74A 2Q1KA 1ZN5A 4U3FG 1L0LJ 5E01A 2KSEA 4PV1C 1SFCD 2RMZA 3G9RA 4UB6E 1HWTC 3AE4C 4B0YA 4K3AA 2QVAA 1S5LX 1R5SA 3H1HJ 4DCZA 1R5LA 3RK3C 1P84E 1BCCJ 2QJYB 3EZ6A 3LURA 2Z5HA 4EIJA 1BDCA 4EYYQ 1BGYD 5CCHA 2P1JA 3B4SA 1SQXD 3V2RA 2OYIC 2W6JH 2Q5UA 3EZ9A 3VYIA 4IL6E 2QA4P 3V2NA 1U7JA 2O1KA 1L0NG 1LTGC 1SQQG 4C7NB 2IX7C 1JY2N 2FYNB 3L4FA 2ZT9B 3Q5RA 3RL0g 3ABVC 4PD4D 1N7SD 1SS1A 1ZLLA 3I55P 2M5AB 1OZHA 1S9KE 1Q82Q 1P84D 1NOHA 3EFGA 1K05A 2XNDH 3CPWO 2FYUJ 1RHZB 1JY2P 1L0NE
chains in the Genus database with same CATH topology
3D71A 2BOWA 4DCZA 3FGAD 3AEEC 4Y28J 1DD3A 3GF3A 2YMKA 4I7ZB 4IL6X 4H13C 4YXDC 4A1MA 4H13D 3Q3DA 1YQ4C 1JB0J 3Q2YA 2HVAA 3EZ6A 1KORA 4OGQD 1OW7A 1PIXA 3GP4A 1RQVA 3AE2C 1Q90D 2D2CB 4I7ZC 3LURA 1Q08A 2FBWC 3QAOA 1EXJA 1HJ0A 1Q07A 1RQUA 3AE1C 2MKVA 1AJYA 4J2NA 4R4MA 4AYZA 2WSCJ 5I44A 2KCUA 4KT0J 1BOWA 3GF7A 4R22B 1VL2A 5M1BA 1PV3A 2D2CC 1ZP0C 5KLIC 5L8RJ 2D2CD 2IDBA 3AEAC 3AEBC 1DD4A 3AECC 5GQQA 4RKUJ 2BEZF 3EZ9A 2E74C 1KQFB 3AE9C 3AEFC 3EWKA 2JO1A 1PL5A 2E74D 1Q0AA 2KVVA 3AEDC 1LX8A 4H44B 3RK3E 1R8DA 1KQGB 2E75B 2P10A 1R8EA 3C8VA 4TT3H 1TU3F 3R4YA 3EZ2A 2O01J 2IEFA 1GMJA 1JYHA 4AYZB 1FDOA 1U57A 3T97B 3LW5J 2ZHGA 4R24B 4H44C 2GOVA 3B49A 1Q06A 4H44D 1VF5B 1Y6UA 1EXIA 2OG0A 3GPVA 1ZRTE 2QJYC 2FXPA 4R4EA 3Q1MA 4Z1MH 3IAOA 3E0HA 3H25A 1RH6A 3B71A 3GK6A 2BEQD 4PV1B 2WPVB 4LHFA 1Q09A 1VF5C 5KKZC 3D70A 4WLSA 1VF5D 1S1CX 2WSEJ 2WQYC 2QJKC 1ZMEC 2ZT9B 3Q5RA 1DIPA 1HF9A 1K04A 4WLWA 3AEGC 5D90A 2VZ4A 3R8KA 2H88C 3D6ZA 1OW6A 2E76B 3RL0g 1KILE 2FYNC 3ABVC 2WSFJ 1D5YA 5KAVA 3AE8C 1NGMB 3EZFA 5KAWA 5KAXA 1PM6A 5KCBA 1OMIA 2ZT9C 3SFDC 2E75C 2ZT9D 1IK7A 2JMLA 3AE3C 2K9YA 2NZ2A 2E76C 2QSIA 1UIXA 2E75D 4H0LB 1FDIA 4H13B 1Q05A 2E76D 2QJPC 2YIUC 1Y9BA 3S9OA 3IN6A 1YQ3C 5KAUA 5I41B 1MKMA 2J5UA 1OW8A 3AE6C 3GMAA 4H0LC 1JBGA 1K05A 4H0LD 1NYHA 2H89C 4U7JA 3GLMA 3SFEC 2V7QJ 5D8CA 1WMKA 5E01A 3R8JA 4OGQB 4PV1C 5KATA 1ZOYC 2QIWA 3Q5SA 2G3AA 2ZHHA 2DG6A 3EZ7A 4PV1D 3HH0A 3G9RA 3O6QA 3UCSA 3AE4C 4GDOA 3D6YA 3AE5C 4XFJA 4YTPC 3AE7C 4B0YA 2JP3A 2OQQA 4OGQC 1KMIZ 1KTMA 1S5LX 2G8YA 4R4LA 3Q5PA 2E74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D71 A;  4R4E A;  1Q05 A;  3Q1M A;  2BOW A;  3IAO A;  3E0H A;  3GK6 A;  5KAU A;  1EXI A;  1Q09 A;  5I41 B;  2J5U A;  5GQQ A;  3D70 A;  4WLS A;  1JBG A;  1Q0A A;  5D8C A;  4A1M A;  5KAW A;  3Q3D A;  5KCB A;  5E01 A;  3Q5R A;  1R8D A;  1DIP A;  1BOW A;  3R8J A;  4WLW A;  1R8E A;  5KAT A;  5D90 A;  2VZ4 A;  3Q2Y A;  2HVA A;  3D6Z A;  3Q5S A;  1JYH A;  2ZHH A;  2DG6 A;  3R8K A;  3GP4 A;  3HH0 A;  3G9R A;  4AYZ B;  3UCS A;  3LUR A;  3D6Y A;  1Q08 A;  1D5Y A;  3T97 B;  3QAO A;  1EXJ A;  5KAV A;  1Q07 A;  5KAX A;  2OQQ A;  2ZHG A;  4R24 B;  2GOV A;  3B49 A;  4J2N A;  4R4M A;  4AYZ A;  4B0Y A;  1Q06 A;  5I44 A;  2KCU A;  4R4L A;  3Q5P A;  2JML A;  3GPV A;  4R22 B; 
#chains in the Genus database with same CATH topology
 4A7P A;  3M91 A;  1KFM A;  4U3F D;  1N73 A;  1PFI A;  2XKM A;  1HGZ A;  2YMK A;  3CXH H;  2N1T D;  4YXD C;  3USS A;  2BCC E;  3L36 A;  2HVA A;  2WWW A;  3L70 G;  1EXJ A;  5AW4 B;  3GF7 A;  4WY4 A;  2D2C C;  2FFD C;  1IFI A;  2GUV A;  3A5T A;  1VQ7 P;  5KJ7 D;  2E42 A;  2P7J A;  4WBA A;  2P2U A;  1M8O B;  1LX8 A;  5AW0 B;  2E75 B;  3C8V A;  1PGO A;  1PP9 G;  2GOV A;  1LTJ C;  1Q06 A;  4W7Y A;  5AVT B;  3B71 A;  1NAY A;  2OGU A;  2Q9I A;  4GOD A;  1KQL A;  3BCC J;  4WLW A;  3D6Z A;  3L70 E;  1OW6 A;  5AVS B;  1BE3 E;  2K9J A;  1L0N D;  3CX5 I;  5AVX B;  1EDJ A;  2QEX P;  2L91 A;  2K9Y A;  1NTZ J;  4JPZ B;  2QJP C;  4CPG A;  2ZYA A;  3JCU H;  1VPC A;  2BCC D;  5TIS E;  1WMK A;  2DG6 A;  3EZ7 A;  3D6Y A;  3KZI H;  1RE3 A;  4UB8 H;  4JYC A;  1X79 B;  1SVF A;  2ZAE B;  4EI2 A;  2YKO A;  1L0L G;  5KAI E;  4H13 C;  1YTZ T;  5DJT B;  3BRV B;  4GOF A;  1VQM P;  2OTL P;  3BAS A;  2RH0 A;  4UB6 H;  3V2P A;  2YMY A;  3H1H G;  1FAV A;  5CBO A;  5CCG A;  2R5D A;  1URQ A;  2IZ1 A;  2KNC A;  4RKU J;  1BCC G;  1P84 H;  1JNM A;  2PFX A;  2FYZ A;  3WU2 E;  3L70 D;  4D6T E;  1SQB K;  5AVQ B;  3T97 B;  2KI7 B;  3CCR P;  3Q1M A;  3IAO A;  1JOC A;  2IYO A;  1DEE G;  2AXT H;  5KKZ C;  1DEB A;  1PP9 D;  4IL6 H;  3CMA P;  2YO3 A;  1YJW P;  3TDK A;  2VRS A;  1KIL E;  2FYN C;  2W83 C;  3A0B H;  2ZT9 C;  1EZV G;  3SFD C;  1QL2 A;  4H0L B;  2E75 D;  2YNY A;  1SQP K;  5KLV J;  3S9O A;  2HFE D;  2UWJ E;  3H1I E;  3MHV A;  1LGH B;  2JR8 A;  5AW7 B;  1L4A A;  2O01 N;  1AVO A;  2QIW A;  2HG5 D;  3M0D C;  1IFP A;  1YJ9 P;  1FZB A;  2KS1 B;  1FZC B;  1M7L A;  1SQX K;  2Q3I A;  3VMY A;  4Y28 J;  1RF0 A;  3TSI A;  2FYU G;  3HE4 A;  3VP9 A;  4PJ0 E;  4J2N A;  3TNU B;  1VL2 A;  1SQV J;  1PGP A;  1PV3 A;  4Y99 B;  1L0L D;  1AFO A;  3AE9 C;  3MTU E;  3HD7 A;  1FZG A;  1R8D A;  4HKZ H;  1GW4 A;  2ZYD A;  2LXC B;  4AYZ B;  3H1H D;  3MP7 B;  3KDP B;  3MUD C;  3CI9 A;  3RK2 B;  1NAF A;  2XNX A;  3VMZ A;  3I56 P;  2FYU E;  2R44 A;  1LTS C;  4RJT A;  1H0T B;  1NTK G;  3H1J E;  1JO5 A;  1Q05 A;  5CCG C;  3SSU A;  1LTB C;  3BCC G;  4U7J A;  2FXO A;  5AVV B;  1YIT P;  1RY3 A;  3CCE P;  3QH9 A;  3CME P;  4I1L A;  3OJA B;  2G8Y A;  2E74 B;  1NTZ G;  1FZE A;  3IFM A;  4OWF A;  3L72 E;  1USD A;  3CXH E;  4WB4 A;  1M90 Q;  1YQ4 C;  5TIS H;  3L35 A;  3GP4 A;  1RQV A;  3KQG A;  2W27 A;  5KLI B;  1Q07 A;  3AE1 C;  1BE3 J;  3N4X A;  3CC4 P;  4DZO A;  3FWL A;  1SFC A;  1GL2 D;  3H1K E;  5CJ4 A;  1LNQ A;  2FYU D;  3TGU J;  4BRY A;  1AQT A;  1L4A C;  4LLH A;  1SQB E;  1ZR2 A;  4N6J A;  2JWD A;  1LTT C;  1NTZ E;  3H1J D;  1EXI A;  1SQQ K;  2C0W A;  2MJZ A;  4WLS A;  2I8D A;  3P8C E;  1IFD A;  2QJK C;  3WU2 H;  4KHX A;  2WZ7 A;  2A45 G;  1CW5 A;  3EZF A;  3S1K A;  3R2P A;  1IK7 A;  3AE3 C;  3H32 A;  5H2F E;  4IOI H;  1S2E A;  2B87 B;  3FX0 A;  1OVV A;  1T2K D;  3W68 A;  3JCU E;  1LWU B;  3PHL A;  3CXH D;  2J5U A;  2NPS D;  4H0L C;  1FZA A;  1KB9 I;  3MGN A;  2K1A A;  2QE7 H;  1FOS E;  1IK9 A;  3R8J A;  3Q5S A;  2G3A A;  3H6P A;  2ZHH A;  3RK2 D;  4YTP C;  1PZQ A;  4D6T J;  4DCK A;  2FFD A;  3D71 A;  3SWF A;  5KLV G;  3BCC D;  4ZMD A;  2KXP B;  2JJL A;  3GF3 A;  1FZC C;  3O6Q B;  4ASW A;  1N7S A;  3SWK A;  1LTJ A;  1Q08 A;  2FBW C;  1NTZ D;  1AJY A;  5I44 A;  3RL0 D;  2W90 A;  1NHL A;  1MFZ A;  1Q7Y Q;  1J2J B;  2E5T A;  3P8C D;  3B5N D;  3EWK A;  2E74 D;  3H1I J;  3HUS B;  2P10 A;  3CX5 H;  1CZQ A;  4AYC A;  5GTH H;  4NPE A;  2ZHG A;  4R24 B;  5KLV E;  4PJ0 H;  4C46 A;  1JM0 A;  4R4E A;  2HOD A;  2AXT E;  2N1T A;  2WPV B;  4IFF A;  2WMM A;  1G1J A;  2H43 A;  1JY3 N;  2KSJ A;  2LXB A;  4RES B;  4IFD K;  5KAW A;  5KCB A;  3A0B E;  2IBZ I;  2IZ0 A;  1NTM E;  3IN6 A;  4XA4 A;  2N9Y B;  1MKM A;  2C0X A;  1NYH A;  1H88 A;  4OH8 B;  4LC1 A;  1JCC A;  1SFC C;  1VQP P;  2XU6 A;  2BCC G;  1YJN P;  4XFJ A;  2WSC H;  4EOT A;  1SQV E;  2JP3 A;  1RH5 B;  1CI6 B;  4ZKP A;  1JY3 P;  3L74 J;  4JBZ A;  3FGA D;  4N78 E;  1MZ9 A;  3L37 A;  3PH0 A;  1IFN A;  1NJI Q;  1QVG O;  1DH3 A;  1LT9 B;  2HLO A;  4GIF A;  3C1L A;  5KLV D;  1HJB A;  2WSC J;  2WPR A;  1S4X A;  4K35 A;  1QX8 A;  1KB9 E;  5KLI C;  2QM8 A;  3H1J J;  1KFN A;  3EQ2 A;  3L73 E;  3O8Z A;  5AVZ B;  4C7N A;  2JO1 A;  3N7N A;  2IEF A;  1FU1 A;  1A02 F;  1M57 D;  1J1D B;  1BE3 G;  2ZVN B;  2YKP A;  3GPV A;  2XZR A;  1FC2 C;  4Z1M H;  4I6M C;  3GK6 A;  5CCH D;  3G4S P;  3HRN A;  3VTP C;  4I2L C;  2M5A A;  1VF5 D;  2YO2 A;  3P32 A;  3TGU G;  3WUV A;  2WQY C;  3L72 J;  1MFT A;  1K04 A;  3M0D A;  2GUS A;  1LP1 B;  1SQV D;  4GT1 A;  1D5Y A;  5KAX A;  1N7S C;  2ZFC A;  1DX7 A;  2C9N Y;  1UIX A;  1S9K D;  3MIW A;  4L73 A;  3BVH A;  5E79 E;  1WT6 A;  1S3J A;  1K8A Q;  2Q7C A;  2H89 C;  5D8C A;  2XDJ A;  3H1K J;  1AVY A;  1H8A A;  3MD0 A;  1Z56 A;  1SQB J;  1KB9 D;  1AA0 A;  4DOJ A;  1NU1 K;  3GHG B;  5H2F H;  3A0H E;  2CPS A;  1FDM A;  3AEE C;  2CK3 H;  3L73 D;  2WT7 B;  3TGU E;  3KPE A;  2N1T C;  4I7Z B;  3CL3 D;  1OXZ A;  1YYC A;  2IBZ E;  4JYB A;  1Q90 D;  1L2P A;  4D6T G;  3RBZ A;  3MUD A;  1VQ8 P;  1BOW A;  1EQ7 A;  1EZV I;  3HE5 B;  5AVY B;  5L8R J;  5KJ7 C;  1NO4 A;  1KIL B;  5APW A;  1GK6 A;  2FKW B;  2WSE H;  1RF1 B;  1SQP J;  2OYH B;  1PL5 A;  1T6A A;  2QG4 A;  4TT3 H;  5K5G B;  1KYO I;  2WIT A;  1GU4 A;  4HJG H;  3FXE A;  1G2C B;  2Q3E A;  3HUS C;  1HTL C;  4NPD A;  3FWN A;  4M3L A;  1ZRT E;  2QJY C;  2FXP A;  3H25 A;  2NRG A;  4WY4 D;  2AEF A;  3L71 E;  2W6A A;  2Y0C A;  1QVF O;  2WSE J;  3H1I G;  1X0T A;  2VZ4 A;  1BE3 D;  1NTK K;  3VMA A;  1T3U A;  2R5B A;  1OMI A;  3GW6 A;  3KYQ A;  5KAF E;  3A2A A;  1FDI A;  2POH A;  2GA1 A;  3TGU D;  3BAT A;  2PGD A;  5EFW B;  1YTZ I;  2HPC B;  3V5B A;  3U1A A;  3U1C A;  4R4L A;  4OGQ D;  1IJD B;  1M1J B;  3VN0 A;  5BVZ A;  3CWB E;  3HE4 B;  4IL6 X;  1QLE D;  1ZV8 A;  2R3S A;  3LW5 H;  3VOP A;  1FBM A;  1LT9 C;  3H1L E;  3L74 G;  1GL2 B;  4R22 B;  3T97 A;  2RKL A;  3L71 D;  1GD2 E;  1DD4 A;  4NPF X;  3BRT B;  4DJG A;  1NTM J;  4OVN F;  4D6T D;  3CX5 E;  5GTH E;  3LW5 J;  1BSN A;  2JWA A;  4H44 D;  4XE5 B;  1RH6 A;  2XV5 A;  3OAK A;  2QM7 A;  1KB9 H;  3H1J G;  4PV1 B;  3CCM P;  1URQ D;  1QEX A;  5AVW B;  5AW5 B;  1ZME C;  1JY2 O;  1IFJ A;  1EC5 A;  3AEG C;  1KIL D;  5KAV A;  3L74 E;  2NPS B;  4ZNC A;  3LIE A;  2E75 C;  2V4H A;  2NZ2 A;  1U7M A;  3JSV C;  2E76 D;  1NKN A;  3H1I D;  4JF7 A;  3AE6 C;  1KYO E;  2KS1 A;  1FZC A;  1NKZ B;  2KYV A;  3L72 G;  1PGQ A;  3KXD A;  3L73 J;  1ZOY C;  2KZJ A;  2ZXE B;  2OQQ A;  1N7L A;  2OYI B;  5KTB A;  1BDD A;  1Q2N A;  1NU1 E;  3TNU A;  2E5Y A;  5E79 H;  1SQQ J;  1DD3 A;  2KB7 P;  3RBX A;  3GHG C;  3CX5 D;  3C9I A;  2O01 H;  1GK4 A;  1HH0 A;  3H1K G;  1JB0 J;  1KOR A;  3RL0 B;  4I7Z C;  2A45 I;  1HJ0 A;  1SQB G;  4AYZ A;  3B5N B;  5M1B A;  2OAR A;  3VP8 A;  1N2D C;  3F89 A;  1PPJ E;  4PD4 I;  3A0H H;  1VQ9 P;  3AEC C;  5B66 H;  4BXL A;  3RK3 E;  1KQG B;  2WSF H;  2O01 J;  3HTK B;  2FXM A;  2OYH C;  3L74 D;  3FXD A;  4MN4 C;  1W2B O;  4YXW H;  3WMM 0;  2QRX A;  1CSB A;  2ZVO B;  1H0T A;  1MUU A;  3M0A A;  1LJ2 A;  2V7Q H;  2KLV A;  2M3E A;  1A02 J;  1DIP A;  1HF9 A;  2N9B A;  3HD7 D;  1FZF A;  2WSF J;  1L0N K;  3JC2 2;  3WUT A;  5I41 B;  2H8P D;  3V4Q A;  3PTZ A;  5APX A;  1OFC X;  2L5G B;  1M56 D;  2V7Q J;  1PGJ A;  1JTH B;  4PV1 D;  3HH0 A;  2AEJ A;  1AQ5 A;  1QL1 A;  1USE A;  2M8R A;  5KAF H;  1X9V A;  1D7M A;  1SQP E;  3L72 D;  2P58 A;  2A06 E;  3RK3 D;  1M1J C;  1VQ4 P;  3L71 J;  2Y9Y A;  1OW7 A;  2YKQ A;  2ZYG A;  3K5B A;  2KP8 A;  1NWQ A;  3B8E B;  1YHQ P;  1SQX E;  3AEB C;  1X22 A;  5GQQ A;  1EDI A;  1GL2 C;  3H1K D;  3CCV P;  1Y8A A;  2KVV A;  1OVU A;  5CBN A;  1SQB D;  2KZI A;  2QJP B;  3B49 A;  2PRR A;  1VF5 B;  2OG0 A;  3CC7 P;  1S5L H;  3L75 J;  2ITA A;  4GOE A;  3CCJ P;  2B87 A;  1NTM G;  1KV4 A;  1Q86 Q;  4Y99 C;  3TF5 A;  1LWU A;  1JCD A;  3CWB J;  1NGM B;  5AW1 B;  4PD4 E;  3ITK A;  1SQV G;  4H13 B;  1KC8 Q;  3U59 A;  1SQP D;  1T2K C;  3M06 A;  3H1L J;  5KAU A;  2NPS C;  2A06 D;  5GTI E;  1HVV A;  2KUB A;  3M9H A;  5KAT A;  3RK2 C;  5CJ0 A;  3O6Q A;  3UCS A;  4GDO A;  3E7K A;  3PP5 A;  1KTM A;  2WPQ A;  2CPB A;  5APT A;  5KJ7 A;  1K73 Q;  3W67 A;  1VQ5 P;  4U3F E;  2W6B A;  1KYO H;  1OX3 A;  3L73 G;  2B88 A;  2LKM A;  2P67 A;  3Q2Y A;  4ZKU A;  2Z4E A;  3P7K A;  3AE2 C;  4AQR D;  3HUS A;  1RQU A;  5KKZ B;  1HGV A;  2BAS A;  3RL0 C;  1N73 B;  2IYP A;  2D2C D;  1L0L K;  1YIJ P;  5TJH A;  3B5N C;  2E74 C;  1VQN P;  4N3Y B;  5B5E E;  1JMB A;  1TU3 F;  3G3Z A;  1GMJ A;  2I1K A;  4WY4 B;  1ZR4 A;  1LTI C;  1Y6U A;  3SWY A;  1Q81 Q;  1Q09 A;  5C39 A;  3F5H A;  3D70 A;  1NU1 J;  1X8Y A;  3CD6 P;  2YXQ B;  1RE4 A;  2ZJS E;  4YPC A;  5BU5 A;  3TYY A;  3ZDM A;  2HYN A;  2YIU B;  1PM6 A;  4TLF A;  2JML A;  1M1K Q;  1SQQ E;  4RO0 A;  3IR9 A;  4BWN A;  1CI6 A;  1NTM D;  1Y9B A;  1MV8 A;  2OTK E;  1OW8 A;  2AXC A;  3GMA A;  3GLM A;  2K9J B;  5APV A;  4OGQ B;  1KN7 A;  2FY8 A;  1LT9 A;  5APY A;  3AE7 C;  2IBZ G;  1KMI Z;  2KIK A;  3IF4 A;  3CCU P;  4N78 D;  4QMA A;  1QGK B;  2Y0E A;  1VDF A;  4H13 D;  3S4R A;  3CC2 P;  1LWU C;  1NVO A;  1PIX A;  3QAO A;  2E43 A;  1NTK J;  2KCU A;  1FJK A;  1SLQ A;  1N86 A;  2K3R A;  2JKV A;  5B66 E;  3AEF C;  3CCQ P;  2FYU K;  3L71 G;  4H44 B;  2KK7 A;  5CHX A;  1YI2 P;  3PRJ A;  3EFF K;  1FDO A;  5BU8 B;  2PP6 A;  1URQ B;  1LP1 A;  1SQQ D;  2KNC B;  1VQ6 P;  3VMX A;  3E0H A;  5CCH C;  2RN0 A;  1VF5 C;  1IZN B;  1BSH A;  1PP9 E;  3R8K A;  2E76 B;  2M3B A;  2YXR B;  2I1J A;  1HUC A;  1FS0 E;  2IPP A;  2GM4 A;  2KLU A;  3PJS K;  3A7O A;  2ZT9 D;  3L75 G;  2K37 A;  1IO4 A;  2Z5I A;  1BGY J;  2Y0D A;  3GHG A;  1S72 P;  1JBG A;  1KZU B;  1HBW A;  1SQX J;  3CWB G;  5DJU B;  2WT7 A;  2A45 H;  4JQ0 D;  1J1E B;  2IFM A;  2B9B A;  4PD4 H;  3H1L G;  4ASV A;  1L4A B;  3HE5 A;  4WWI A;  1KIL A;  5GTI H;  3Q3D A;  2AEM A;  2DW3 A;  1RF1 A;  3II6 A;  3G6E P;  2OYH A;  1RE4 C;  2IBZ D;  1WRG A;  3OA7 A;  1NTZ K;  2MKV A;  3L75 E;  4R4M A;  4C7R A;  4HH2 A;  4KT0 J;  2IFN A;  1G2C A;  5APU A;  2QJK B;  5AW2 B;  1ZW0 A;  1KD1 Q;  1L0L E;  5APQ A;  1YBK A;  1N73 C;  1SP4 A;  1Q0A A;  2OYO A;  5CMZ A;  3CXH I;  5AW6 B;  3P8M C;  1XTC C;  1IC2 A;  1GU5 A;  3H1H E;  2KOG A;  2O3J A;  1ZRT D;  1S5L E;  1JMM A;  1OVR A;  2J58 A;  4WY4 C;  1G1I A;  1BCC E;  3M9Q A;  3HD7 B;  1T3J A;  1N8R Q;  3NMD A;  5B5E H;  1JY3 O;  4W7Z A;  4U3F J;  1JUN A;  2HPC A;  1NH4 A;  2H7H A;  2QSI A;  3V6I A;  2J59 M;  2YIU C;  1YQ3 C;  1J1D C;  4EDF A;  1NU1 G;  1LTA C;  3V2Q A;  5CCG D;  1M1J A;  2R32 A;  4L75 A;  4WVZ A;  3SFE C;  1EZV E;  3L75 D;  3AE5 C;  1KQS O;  2SPZ A;  3QWO C;  1EDK A;  4OGQ C;  3Q5P A;  3RK3 B;  4O9B A;  1XTG B;  1Y47 A;  4L76 A;  1GL2 A;  3CWB D;  1FJP A;  1GW3 A;  1PPJ G;  4DT0 A;  2ZXX A;  4B86 A;  2WVR A;  3MZW B;  3M9B A;  3H1L D;  5AW8 B;  5KLV K;  3CCL P;  3PLN A;  1RE3 C;  1W5C E;  1L0N J;  1BCC D;  2PAJ A;  3AEA C;  2BEZ F;  3KHU A;  1VQO P;  3A3Y B;  3AED C;  1R8E A;  2LR2 A;  1JYH A;  1LT1 A;  2BCC J;  1L4A D;  3I5C A;  1H89 A;  4H44 C;  2WTY A;  1GZL A;  1OIP A;  2NPS A;  1NTM K;  1SFC B;  2BEQ D;  2R3C A;  3RGU A;  3LID A;  1URQ C;  3CCS P;  4HYT B;  4BRY B;  1FE6 A;  3E1I A;  1UII A;  1KIL C;  5D90 A;  1EZV D;  1P84 I;  3V4W A;  1RF1 C;  1SQV K;  2WSS H;  2E76 C;  1GDT A;  2OYI A;  1KYO D;  2Y9Z A;  2OTJ P;  1VQK P;  1SQP G;  4H0L D;  1ZXG A;  2A06 G;  2O1J A;  4HB1 A;  4AUW A;  1E5W A;  1NTK E;  3H32 B;  1FOS F;  3L70 J;  1JEK A;  4LGD E;  5AW9 B;  1NU1 D;  3CLQ A;  1J1E C;  2BOW A;  3B5N A;  3BCC E;  1BGY G;  1IFM A;  2B89 A;  2JDI H;  1SQX G;  5KAI H;  4W80 A;  1T8Z A;  4A1M A;  1OWA A;  1PP9 J;  5AVR B;  2D2C B;  4KJM A;  2FFD B;  2C9L Y;  3HTK A;  3TK1 A;  1E79 H;  1ZP0 C;  1PPJ D;  2IDB A;  3UIA A;  1KQF B;  2HR3 A;  3NFQ A;  1VQL P;  1N7S B;  1RF0 C;  1LTJ B;  2K88 A;  3R4Y A;  3EZ2 A;  1K9M Q;  1U57 A;  5AW3 B;  2Q6Q A;  1EDL A;  3E1R A;  1BGY E;  3NTN A;  4LHF A;  1S1C X;  2JEE A;  3OW2 O;  3NXS A;  5AVU B;  2M0B A;  3HD7 C;  4IFM A;  1NTK D;  2H88 C;  2W8Z A;  4GKG A;  1JTH A;  3KZI E;  3AE8 C;  3GG2 A;  3WUU A;  4UB8 E;  1GTW A;  2HOD B;  2N1T B;  1W2E A;  5APS A;  3G71 P;  2WPS A;  1AV1 A;  4L74 A;  2Q1K A;  1ZN5 A;  4U3F G;  1L0L J;  5E01 A;  2KSE A;  4PV1 C;  1SFC D;  2RMZ A;  3G9R A;  4UB6 E;  1HWT C;  3AE4 C;  4B0Y A;  4K3A A;  2QVA A;  1S5L X;  1R5S A;  3H1H J;  4DCZ A;  1R5L A;  3RK3 C;  1P84 E;  1BCC J;  2QJY B;  3EZ6 A;  3LUR A;  2Z5H A;  4EIJ A;  1BDC A;  4EYY Q;  1BGY D;  5CCH A;  2P1J A;  3B4S A;  1SQX D;  3V2R A;  2OYI C;  2W6J H;  2Q5U A;  3EZ9 A;  3VYI A;  4IL6 E;  2QA4 P;  3V2N A;  1U7J A;  2O1K A;  1L0N G;  1LTG C;  1SQQ G;  4C7N B;  2IX7 C;  1JY2 N;  2FYN B;  3L4F A;  2ZT9 B;  3Q5R A;  3RL0 g;  3ABV C;  4PD4 D;  1N7S D;  1SS1 A;  1ZLL A;  3I55 P;  2M5A B;  1OZH A;  1S9K E;  1Q82 Q;  1P84 D;  1NOH A;  3EFG A;  1K05 A;  2XND H;  3CPW O;  2FYU J;  1RHZ B;  1JY2 P;  1L0N E; 
#chains in the Genus database with same CATH homology
 3D71 A;  2BOW A;  4DCZ A;  3FGA D;  3AEE C;  4Y28 J;  1DD3 A;  3GF3 A;  2YMK A;  4I7Z B;  4IL6 X;  4H13 C;  4YXD C;  4A1M A;  4H13 D;  3Q3D A;  1YQ4 C;  1JB0 J;  3Q2Y A;  2HVA A;  3EZ6 A;  1KOR A;  4OGQ D;  1OW7 A;  1PIX A;  3GP4 A;  1RQV A;  3AE2 C;  1Q90 D;  2D2C B;  4I7Z C;  3LUR A;  1Q08 A;  2FBW C;  3QAO A;  1EXJ A;  1HJ0 A;  1Q07 A;  1RQU A;  3AE1 C;  2MKV A;  1AJY A;  4J2N A;  4R4M A;  4AYZ A;  2WSC J;  5I44 A;  2KCU A;  4KT0 J;  1BOW A;  3GF7 A;  4R22 B;  1VL2 A;  5M1B A;  1PV3 A;  2D2C C;  1ZP0 C;  5KLI C;  5L8R J;  2D2C D;  2IDB A;  3AEA C;  3AEB C;  1DD4 A;  3AEC C;  5GQQ A;  4RKU J;  2BEZ F;  3EZ9 A;  2E74 C;  1KQF B;  3AE9 C;  3AEF C;  3EWK A;  2JO1 A;  1PL5 A;  2E74 D;  1Q0A A;  2KVV A;  3AED C;  1LX8 A;  4H44 B;  3RK3 E;  1R8D A;  1KQG B;  2E75 B;  2P10 A;  1R8E A;  3C8V A;  4TT3 H;  1TU3 F;  3R4Y A;  3EZ2 A;  2O01 J;  2IEF A;  1GMJ A;  1JYH A;  4AYZ B;  1FDO A;  1U57 A;  3T97 B;  3LW5 J;  2ZHG A;  4R24 B;  4H44 C;  2GOV A;  3B49 A;  1Q06 A;  4H44 D;  1VF5 B;  1Y6U A;  1EXI A;  2OG0 A;  3GPV A;  1ZRT E;  2QJY C;  2FXP A;  4R4E A;  3Q1M A;  4Z1M H;  3IAO A;  3E0H A;  3H25 A;  1RH6 A;  3B71 A;  3GK6 A;  2BEQ D;  4PV1 B;  2WPV B;  4LHF A;  1Q09 A;  1VF5 C;  5KKZ C;  3D70 A;  4WLS A;  1VF5 D;  1S1C X;  2WSE J;  2WQY C;  2QJK C;  1ZME C;  2ZT9 B;  3Q5R A;  1DIP A;  1HF9 A;  1K04 A;  4WLW A;  3AEG C;  5D90 A;  2VZ4 A;  3R8K A;  2H88 C;  3D6Z A;  1OW6 A;  2E76 B;  3RL0 g;  1KIL E;  2FYN C;  3ABV C;  2WSF J;  1D5Y A;  5KAV A;  3AE8 C;  1NGM B;  3EZF A;  5KAW A;  5KAX A;  1PM6 A;  5KCB A;  1OMI A;  2ZT9 C;  3SFD C;  2E75 C;  2ZT9 D;  1IK7 A;  2JML A;  3AE3 C;  2K9Y A;  2NZ2 A;  2E76 C;  2QSI A;  1UIX A;  2E75 D;  4H0L B;  1FDI A;  4H13 B;  1Q05 A;  2E76 D;  2QJP C;  2YIU C;  1Y9B A;  3S9O A;  3IN6 A;  1YQ3 C;  5KAU A;  5I41 B;  1MKM A;  2J5U A;  1OW8 A;  3AE6 C;  3GMA A;  4H0L C;  1JBG A;  1K05 A;  4H0L D;  1NYH A;  2H89 C;  4U7J A;  3GLM A;  3SFE C;  2V7Q J;  5D8C A;  1WMK A;  5E01 A;  3R8J A;  4OGQ B;  4PV1 C;  5KAT A;  1ZOY C;  2QIW A;  3Q5S A;  2G3A A;  2ZHH A;  2DG6 A;  3EZ7 A;  4PV1 D;  3HH0 A;  3G9R A;  3O6Q A;  3UCS A;  3AE4 C;  4GDO A;  3D6Y A;  3AE5 C;  4XFJ A;  4YTP C;  3AE7 C;  4B0Y A;  2JP3 A;  2OQQ A;  4OGQ C;  1KMI Z;  1KTM A;  1S5L X;  2G8Y A;  4R4L A;  3Q5P A;  2E74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...