3Q5RA

Crystal structure of bmrr bound to kanamycin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/rna/antibiotic
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 79
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5rA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5rA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5rA03
4J2NA 1Q06A 4R24B 3UCSA 5D8CA 3Q3DA 4R4MA 5D90A 1R8DA 3GP4A 3Q5PA 4B0YA 2HVAA 5E01A 2OQQA 3D71A 2KCUA 5GQQA 2J5UA 1Q05A 3B49A 2GOVA 4WLWA 5KAWA 4R22B 5KATA 3IAOA 4WLSA 3D6ZA 3LURA 5I41B 1JYHA 1DIPA 4AYZA 3D6YA 3T97B 3D70A 1D5YA 3Q2YA 3G9RA 5I44A 2JMLA 3QAOA 3GK6A 3Q5SA 1EXJA 4A1MA 1Q07A 3GPVA 1Q09A 3Q5RA 2BOWA 3E0HA 3R8JA 2ZHGA 1Q0AA 1EXIA 2DG6A 1R8EA 4R4LA 5KCBA 2VZ4A 3R8KA 4AYZB 3Q1MA 1Q08A 2ZHHA 4R4EA 1JBGA 1BOWA 5KAUA 5KAXA 3HH0A 5KAVA
chains in the Genus database with same CATH superfamily
3GF7A 5KLVE 3CX5D 4C7NB 3L74J 2ZVOB 3H1KG 3CXHE 4IFDK 3GF3A 2ZT9C 1EDLA 4NPEA 3R8JA 3L71J 1U7JA 1EZVE 2IYOA 2N9YB 2YO3A 2Y0EA 3L71E 3RL0B 1R8DA 3W67A 2OYIB 1VF5C 5B66E 1LP1B 1N73C 3TGUE 1DD3A 2P7JA 2E5TA 1YITP 4HJGH 2J58A 3TGUJ 4W7ZA 1K9MQ 1KQFB 2H7HA 1RE4A 4TT3H 3R2PA 3EQ2A 3PH0A 1VQ9P 1JBGA 4IOIH 1YTZT 2WT7B 1SQPE 1KYOI 2Q3IA 4DCZA 2QRXA 3L73G 1KC8Q 3E1IA 2WSEH 1HF9A 3R8KA 3CWBG 1SQXE 4D6TJ 2KB7P 1SFCA 1BCCD 2LR2A 2B9BA 4D6TE 1SQBK 3LW5H 3H1HD 1SQVK 1VQKP 2H89C 1RQVA 3M9BA 2ZHGA 2A06G 2WSFH 1LT9A 1Y9BA 2JKVA 4PV1B 3OJAB 5DJTB 5KJ7A 1BE3D 2WSCJ 1KYOD 1X8YA 1BE3G 3BCCJ 5KAIH 4JF7A 2K1AA 1VQ7P 1BGYD 1BDCA 5BVZA 3BCCE 1L4AB 3H1JG 1NTMK 2R3SA 1AV1A 2OTLP 3K5BA 3H1JD 1ZLLA 1QL2A 3M0AA 2R5DA 1KMIZ 2WQYC 2WSCH 2WPSA 4AUWA 4R4MA 3M91A 3EZ9A 3HD7C 3EFFK 1DH3A 4H0LB 1ZW0A 5KLVK 2BASA 2E74D 1NKNA 1RF0C 1FJKA 4KHXA 3CCVP 1NTZE 3B5NB 2GUVA 3CWBJ 2LXBA 3WUTA 3L75J 2KK7A 4ZMDA 2QE7H 2QM7A 3B5NA 5TJHA 5CCHD 1NH4A 1LNQA 1KFNA 3A5TA 1HJ0A 1KILC 1NJIQ 1FDIA 2JWAA 3HD7A 2LKMA 2K3RA 3HE4B 2BCCD 1Z56A 2QJKB 3M0DC 2ZHHA 1NU1E 4I2LC 3H1LE 2WSEJ 2ZYDA 2HVAA 1CSBA 5APTA 2ZXXA 3IAOA 4OGQB 2BCCE 1SS1A 4OH8B 3SSUA 1GL2B 1Q08A 1RH5B 1VQOP 1Q82Q 1FE6A 1SQPG 4JQ0D 1OVRA 3D71A 2XV5A 4WLWA 1Q2NA 5KLIB 2H43A 1ZP0C 1N7SC 1KV4A 2YKPA 3HD7B 3GG2A 3MIWA 3CX5E 3SWFA 1ZR2A 1IC2A 1PP9E 5D90A 2NPSC 4EYYQ 1S5LX 3LIDA 5KTBA 2O1JA 1PP9J 4R22B 5KAWA 1SQQG 1X9VA 3N7NA 4N3YB 2A45I 2D2CD 3M0DA 3VP9A 1LT9C 5AVZB 3M9QA 3U1CA 3RK3C 5AW8B 2KS1A 2V4HA 2KLUA 3CLQA 1FC2C 1YBKA 1LTSC 3PP5A 2Y0CA 5AVQB 4WY4B 3SWYA 3A0HH 4H44C 3BATA 1RF1C 3H6PA 3VMAA 4DT0A 2R32A 4N6JA 1URQA 2E74B 2P2UA 1N7LA 5CCGC 5CCHA 2K37A 2ZJSE 2JWDA 1GK6A 5CJ0A 4IFFA 1YQ3C 4WWIA 2IZ1A 2QM8A 1SQVG 3RL0g 2KP8A 4IL6X 3MZWB 4NPDA 3CCQP 2HLOA 2J5UA 3HE4A 3FWLA 4W7YA 4C7NA 1EZVI 2FXOA 1JUNA 1OFCX 1NGMB 2M3BA 3KYQA 1URQC 5AW0B 4GKGA 1JB0J 1PL5A 1SQXK 3AE9C 2N9BA 1VQ8P 4JYBA 1KZUB 1R5LA 4WVZA 2WWWA 1H89A 3V2RA 1ZN5A 4Y99C 2FYUJ 1NHLA 4H0LC 1RF0A 1JY2N 2DW3A 2KI7B 2V7QH 1W5CE 2AEMA 3O8ZA 3GLMA 2GOVA 4WLSA 4OGQD 1USEA 2W6JH 2P10A 1LWUA 2QJPC 3HTKB 1N7SD 2YMYA 3F5HA 4B86A 1MFZA 1DX7A 2KZIA 2W6BA 3TGUG 4QMAA 4WB4A 2ITAA 1OW8A 1N86A 1SQBE 2KNCA 2R5BA 5KCBA 4U3FJ 1JY2O 2ZXEB 2FXPA 1HJBA 3V4WA 5CMZA 4U3FE 1LTJC 1FZAA 3RL0D 2KCUA 1FZCB 3MD0A 1W2BO 5KLVG 1KN7A 3L74G 1GMJA 3PHLA 3CMAP 3SFDC 3HE5B 2YNYA 5GTHE 1PV3A 1JY3O 1T6AA 3H1IJ 3H32B 1HUCA 4KT0J 1G2CA 4I7ZB 3II6A 3TNUA 3ZDMA 1ZRTE 1DIPA 2E75D 3L70G 1X79B 3L75G 3R4YA 2ZT9B 1WT6A 1M57D 3L70D 5KAUA 4UB8E 2KYVA 2XZRA 3LW5J 3L74E 4OVNF 2Z5HA 3Q2YA 1OMIA 1TU3F 3CXHH 3HUSA 4DCKA 3CCSP 1JY3P 2ZFCA 3KPEA 5GTIH 2H8PD 1BSHA 2WPVB 3M06A 4L75A 2E42A 4O9BA 1YJWP 3H1IG 3CPWO 3USSA 1EZVD 1JM0A 2RKLA 1L0LD 2O01J 3B49A 1HTLC 1JY2P 5BU8B 1KQGB 1H0TA 5B5EH 4L76A 1LTBC 1SQPD 2E75C 3EZ7A 3GHGC 1Q7YQ 1SQPJ 2G3AA 1U7MA 1PGOA 3HE5A 4LHFA 1XTGB 1PPJE 4C46A 3P8CE 4K35A 1GZLA 1S3JA 1OVUA 2KUBA 3PRJA 4C7RA 3TGUD 3L72J 2NPSB 2YXQB 2C9LY 1FBMA 2GM4A 1HH0A 3AE6C 3ITKA 2QA4P 1NYHA 5EFWB 1IK9A 5AW6B 1NTKE 4BWNA 1SQVE 5B5EE 1WRGA 3P32A 1OZHA 1VDFA 4H44D 1NTKJ 3AE5C 5AVVB 1VQ4P 3HRNA 5APWA 3BCCD 5KLVD 3S4RA 5E79H 1GL2C 3KZIH 3L73J 3G9RA 3AEAC 2E5YA 5AW4B 4ZKPA 1SFCC 3RK3D 1BGYE 3JC22 4EDFA 1M7LA 1JCCA 2K9JB 1SQQK 1RE4C 2N1TA 2HR3A 2KLVA 1KFMA 2AXCA 4Z1MH 2PP6A 2WSFJ 4R24B 1X0TA 4WY4A 5CBOA 2G8YA 3A0BE 1URQD 1RY3A 1S1CX 1KQSO 1NTMD 1FZFA 1LT1A 2C0WA 3RK3B 1KD1Q 1EDKA 5AVUB 1AVOA 3RK2B 2A45G 2J59M 1SP4A 1R8EA 3HUSC 4JBZA 1YHQP 1FDMA 2N1TC 3I55P 4L73A 2CPBA 1PPJG 3L73D 1JO5A 3WUVA 4AYCA 4HKZH 2HODB 4H44B 2P1JA 1PPJD 4PD4H 1PGPA 3EZFA 3VMXA 2WITA 3E7KA 4U3FD 4ZKUA 4UB8H 1M1JB 2IX7C 1RE3A 2H88C 1SQBD 2B87B 1LTTC 2XU6A 5AVYB 3B4SA 3VMZA 2GA1A 1PM6A 2Q3EA 1IFDA 4R4LA 4BRYB 1PGJA 1FJPA 1JTHB 3RL0C 2OYIC 2OARA 2NPSA 4EIJA 4ASVA 2OYHB 1URQB 1IJDB 1VQNP 3AEEC 3CCLP 2PFXA 2N1TB 4GIFA 1A02J 3GK6A 3CCEP 1KB9I 1PZQA 3AE3C 5CCGD 3OW2O 2HFED 4Y28J 2Y0DA 4H13B 2D2CC 4YTPC 5TISE 1Q90D 2NZ2A 3L70J 2IEFA 1N2DC 4RESB 2Q7CA 1J1DC 1NTZD 2OTJP 2FXMA 4AQRD 1VQMP 1M8OB 5AW5B 4H0LD 1NTZG 5KLIC 1D5YA 5M1BA 4TLFA 4WBAA 2OYHC 1L0LJ 3A3YB 2OGUA 3AEGC 3UCSA 2YMKA 2ZVNB 3H32A 2RN0A 3AECC 2Z4EA 5E79E 1LX8A 2IPPA 1SQXJ 5APYA 1J1EC 1Q07A 1FOSF 2BOWA 4KJMA 3FX0A 2IYPA 4UB6H 5KJ7D 1RH6A 4BXLA 1FZCC 1EDIA 2FYUK 1KORA 2GUSA 1SQBJ 3BASA 3H1HE 2YO2A 2E76D 1YIJP 4A1MA 1GD2E 1NTMJ 4W80A 3V6IA 3Q3DA 3QWOC 1SQPK 1X22A 1LGHB 2E76C 3GMAA 4N78D 4WY4C 3AE8C 1RF1A 1W2EA 3B5NC 4D6TD 3AE4C 3CI9A 1IFNA 1Q09A 3VYIA 4D6TG 1FZGA 3HD7D 1KB9D 5D8CA 3BVHA 1KYOH 1VF5D 3WMM0 1EQ7A 3C8VA 1LTJA 4DJGA 2WPRA 3WUUA 2AEFA 2FFDC 3RBZA 3V2NA 1JCDA 1MUUA 2I8DA 3H1LG 2JJLA 1ZRTD 3L4FA 1SFCD 3H1HG 1NTZJ 2WPQA 5H2FH 3NTNA 1L4AA 1JYHA 3CL3D 2M3EA 1AQ5A 4YPCA 1VQ5P 5H2FE 1KQLA 4GDOA 3L71G 1GL2D 3GHGB 2I1KA 4YXDC 3MUDA 1S5LE 2IBZD 3MTUE 3VTPC 5L8RJ 1M90Q 1GDTA 1QVFO 3NMDA 3H1LJ 4XFJA 1GU4A 1IFIA 1HBWA 2I1JA 1FAVA 1P84E 3GW6A 1N7SA 3L72D 1QEXA 5I41B 3OAKA 1LWUB 3T97B 1SVFA 2SPZA 1DEEG 1BE3J 2IDBA 2XNDH 1WMKA 4J2NA 1K05A 2NRGA 2HG5D 1XTCC 1IFJA 3GP4A 4RJTA 3HUSB 3N4XA 1S5LH 1VQLP 2A06E 1BCCJ 2KVVA 1IK7A 1FOSE 5APVA 2OG0A 1OVVA 1JTHA 4LGDE 4R4EA 2QG4A 2O01N 3CCMP 1L0NE 3I56P 3H25A 1PIXA 2M5AA 1GTWA 4PD4D 3LURA 2E76B 2XDJA 3D70A 2BCCG 4JYCA 3L73E 4OGQC 1NTZK 1KILE 3A0BH 3AEFC 3NXSA 1HGZA 5KAFH 2C9NY 1IZNB 1M1KQ 1VF5B 5AW7B 2UWJE 3G71P 2W83C 1NTKD 1L0LG 1KILB 1LTAC 5GTHH 2Y9ZA 1OW7A 2QJKC 4I1LA 2A45H 1M56D 3IFMA 3HH0A 4PV1C 2FFDB 2B88A 2M0BA 3ABVC 1LWUC 3FXDA 1NU1G 1NU1K 1SQXD 4BRYA 3KZIE 1P84I 3OA7A 1Q05A 2HODA 3CCUP 3BRTB 1FDOA 2VRSA 5KJ7C 3CXHI 2FFDA 1L2PA 1GL2A 3WU2E 2KS1B 5AW9B 2JDIH 2PRRA 1LTJB 2WZ7A 2BEZF 3L36A 1L0ND 2K88A 1QL1A 1L0NG 3LIEA 3H1KJ 2E75B 5GTIE 3E1RA 2B89A 4IFMA 3H1KE 4N78E 1N7SB 1Q86Q 1Q06A 1VQ6P 1BSNA 2W8ZA 3EWKA 1BGYG 3D6ZA 4DOJA 3A0HE 2E74C 2K9YA 3HTKA 3G6EP 1Y47A 3KDPB 3GPVA 1FZBA 3BCCG 2IFMA 3T97A 1YJNP 1N73B 1J1EB 2JR8A 5APXA 1PP9G 5DJUB 2IBZE 1OWAA 5AVSB 2Q9IA 1E79H 2L5GB 3PJSK 3UIAA 3JCUH 1KILA 1RE3C 3CX5I 2JP3A 5CBNA 1PGQA 1OXZA 2ZAEB 1BDDA 1JOCA 2HYNA 1CI6A 3V5BA 1SQQJ 1SQBG 1MFTA 3Q5PA 3CD6P 2KOGA 3U1AA 3L37A 1FU1A 3QH9A 1SQQE 2OTKE 4YXWH 3W68A 3NFQA 5B66H 4EOTA 3QAOA 1FZCA 4HYTB 2ZT9D 1EC5A 3BRVB 1PFIA 1G2CB 4NPFX 3TK1A 1S4XA 1QVGO 3U59A 2YKQA 3FGAD 2QEXP 1L0NK 3CX5H 3CC4P 1MV8A 3MGNA 1PP9D 3RBXA 1DD4A 2AEJA 4JPZB 1S9KD 3H1ID 1E5WA 3E0HA 3CCRP 1FS0E 1BOWA 5KAXA 4LLHA 1VPCA 1AFOA 5CJ4A 2JEEA 3IN6A 4ASWA 2WTYA 1QX8A 3FXEA 3MUDC 2RH0A 2MKVA 5KKZC 2OYHA 1ZMEC 3KXDA 1YI2P 1L4AD 1USDA 5KLVJ 3M9HA 1SLQA 3A7OA 3VOPA 2W90A 3CMEP 1NTME 3G4SP 2POHA 1KILD 2QJPB 4LC1A 3V2QA 3VMYA 3RK3E 3JCUE 2YIUB 2KSEA 1AVYA 5AVWB 5KATA 2CK3H 3C1LA 2YXRB 3S9OA 2FBWC 3KHUA 1RF1B 3GHGA 3L70E 3L74D 2OYIA 2WVRA 2NPSD 3Q5SA 2QSIA 1CI6B 1YQ4C 3H1KD 2FYUG 3IF4A 1NWQA 1Q81Q 2Q6QA 1S2EA 4DZOA 3MHVA 1KTMA 1IO4A 2P58A 2QJYB 3O6QB 3TDKA 1HVVA 1RQUA 4H13C 2IBZI 2KZJA 2OYOA 4IL6H 2W27A 1ZR4A 3CCJP 1ZXGA 2KNCB 3L72E 2KSJA 1LTGC 5C39A 1MKMA 3G3ZA 3V4QA 1SFCB 3CWBE 1JY3N 5KKZB 3V2PA 1KB9E 1NOHA 1D7MA 2R3CA 3Q1MA 1N8RQ 3SFEC 1U57A 3F89A 2WT7A 1LJ2A 1IFMA 1Y6UA 1NTKG 5AW2B 2R44A 5AW1B 3P8MC 1NAFA 3L35A 5APUA 2O1KA 4RKUJ 1NU1J 3H1LD 3MP7B 4U7JA 1NU1D 3PTZA 1SQXG 3RK2C 5APSA 2Y9YA 1BGYJ 2YKOA 3TYYA 3IR9A 2V7QJ 1IFPA 2KIKA 3H1IE 3JSVC 3EZ6A 3D6YA 1T8ZA 4H13D 3RGUA 1S9KE 1J2JB 4MN4C 1NVOA 2HPCB 4L74A 2D2CB 2DG6A 2QJYC 1NTKK 2JO1A 2O01H 5CCHC 4B0YA 3FWNA 3B71A 1JNMA 5AVTB 5KAIE 2PGDA 4EI2A 5GQQA 2MJZA 4UB6E 1H88A 1RHZB 1OX3A 1QGKB 1JMMA 2RMZA 2WMMA 1SQQD 2WSSH 1JEKA 1LTIC 1QLED 1EZVG 5AW3B 1GK4A 4GOFA 1Y8AA 2P67A 3L75E 5BU5A 2OQQA 4GODA 2B87A 1BCCG 4I7ZC 4CPGA 1DEBA 3AE1C 1HGVA 4HH2A 2K9JA 1EXIA 1Q0AA 5APQA 4GOEA 1UIIA 4ZNCA 1YYCA 5AVRB 2ZYAA 3P7KA 4U3FG 1EXJA 1AA0A 2VZ4A 1YTZI 3I5CA 2FKWB 2BCCJ 5KAVA 3EFGA 1N73A 4XE5B 1BE3E 1H8AA 1SQVD 4XA4A 2CPSA 2YIUC 3S1KA 2N1TD 1ZV8A 1VQPP 2IZ0A 1NTMG 2LXCB 3Q5RA 2M8RA 2Q1KA 4IL6E 1HWTC 1BCCE 1LP1A 3TNUB 4PJ0H 4M3LA 1M1JC 1MZ9A 5K5GB 1L0NJ 3CC7P 1L0LK 3P8CD 2BEQD 4HB1A 2QIWA 1UIXA 2HPCA 1SQVJ 1NO4A 2O3JA 1EDJA 3TSIA 2E43A 4AYZB 2AXTE 1OIPA 2QVAA 1H0TB 1KB9H 5CCGA 4RO0A 1M1JA 2Q5UA 3AE2C 2FYNC 1P84H 2M5AB 1AJYA 4AYZA 1S72P 1T3JA 2A06D 1L0LE 3SWKA 1T3UA 1NAYA 3B5ND 3L71D 3PLNA 1G1IA 2XKMA 1VL2A 3CC2P 4WY4D 1ZOYC 4Y99B 1T2KD 1K04A 4PD4E 2ZYGA 1GW3A 1P84D 3RK2D 3AE7C 1L4AC 4A7PA 1J1DB 4PJ0E 1GW4A 1R5SA 4I6MC 3L72G 1K73Q 3CWBD 1AQTA 2PAJA 3H1HJ 4PD4I 2FYZA 3WU2H 3TF5A 1CW5A 4K3AA 1JMBA 2L91A 5I44A 2XNXA 2FYUD 2AXTH 3A2AA 2KXPB 1G1JA 3O6QA 1FZEA 2IBZG 4PV1D 3H1JJ 5AVXB 1K8AQ 5KAFE 3L75D 3H1JE 1CZQA 2JMLA 4OWFA 1LT9B 3KQGA 3VP8A 2FYNB 4GT1A 3B8EB 1A02F 3AEDC 2IFNA 3C9IA 2FYUE 3AEBC 5E01A 2Z5IA 1T2KC 3CXHD 1KYOE 3VN0A 2W6AA 5TISH 1OW6A 2C0XA 1YJ9P 1GU5A 5CHXA 2FY8A 1NKZB 3EZ2A
chains in the Genus database with same CATH topology
1VL2A 3GF7A 3SFEC 1U57A 4H44C 1Y9BA 5KKZC 4YXDC 2WPVB 2WSEJ 2HVAA 1Y6UA 1RH6A 3AEAC 1ZOYC 4PV1B 1ZMEC 1KORA 1VF5B 3GF3A 2ZT9C 3IAOA 3AEEC 5L8RJ 2E74B 1K04A 2WSCJ 4OGQB 3G9RA 4RKUJ 2E76D 3GK6A 1OW8A 2JP3A 1EXJA 4A1MA 1OW7A 4XFJA 3R8JA 3AE3C 1YQ3C 3RK3E 2QJKC 4U7JA 3AE7C 5KCBA 2VZ4A 2O01J 1Q08A 4Z1MH 3B49A 3HH0A 2FXPA 4PV1C 3RL0g 3ABVC 5KAVA 5KATA 2WSFJ 4R24B 4IL6X 3Q3DA 3S9OA 1R8DA 2FBWC 3Q5PA 1VF5C 2G8YA 1KQGB 2E76C 3GMAA 3D71A 1DD3A 4Y28J 2KCUA 3AE8C 2V7QJ 1S1CX 2J5UA 1Q05A 2YIUC 4WLWA 2E75C 4H13B 2D2CC 4YTPC 3EZ7A 5I41B 1FDOA 3EZ6A 3D6YA 3T97B 4H13D 1GMJA 5I44A 3AE4C 3QAOA 1KQFB 2G3AA 1NGMB 3Q5SA 1ZP0C 2D2CB 4TT3H 1Q90D 4LHFA 1Q09A 3Q5RA 2ZT9D 3SFDC 2DG6A 1R8EA 1KMIZ 2QJYC 2QSIA 2WQYC 1JB0J 2IDBA 2NZ2A 1YQ4C 3O6QA 1JBGA 1WMKA 4J2NA 2JO1A 2IEFA 1K05A 1PL5A 1PV3A 5D8CA 3FGAD 4R4MA 3AE9C 5D90A 3GP4A 4B0YA 2BEZF 4PV1D 1KTMA 3B71A 3EZ9A 1S5LX 4KT0J 4I7ZB 5GQQA 4H0LB 1VF5D 1DD4A 4R22B 5KAWA 2BEQD 2E74D 4DCZA 1ZRTE 1UIXA 2QIWA 4H0LD 1RQUA 4H44B 5KLIC 1DIPA 1D5YA 3C8VA 2KVVA 3EZFA 2E75D 5M1BA 2JMLA 2E75B 4H13C 3R4YA 1IK7A 2ZT9B 2OG0A 2D2CD 1HF9A 3E0HA 3AE6C 4H0LC 3R8KA 4AYZB 4R4EA 1BOWA 5KAUA 1NYHA 5KAXA 3AEDC 1Q06A 3AEGC 3UCSA 2YMKA 3H25A 3AEBC 5E01A 2OQQA 1PIXA 1MKMA 3AECC 2H88C 3EWKA 3AE2C 2FYNC 3GLMA 4I7ZC 1HJ0A 2GOVA 1LX8A 3LW5J 3IN6A 4WLSA 3D6ZA 3AE1C 4H44D 4OGQD 2E76B 1AJYA 1JYHA 3LURA 4AYZA 3D70A 2E74C 2K9YA 2P10A 1FDIA 3AE5C 3Q2YA 2QJPC 4OGQC 1OW6A 1PM6A 2H89C 1Q07A 3GPVA 1OMIA 1RQVA 1TU3F 2BOWA 2ZHGA 1Q0AA 1EXIA 4R4LA 2MKVA 1KILE 3Q1MA 2ZHHA 3EZ2A 3AEFC 4GDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J2N A;  1Q06 A;  4R24 B;  3UCS A;  5D8C A;  3Q3D A;  4R4M A;  5D90 A;  1R8D A;  3GP4 A;  3Q5P A;  4B0Y A;  2HVA A;  5E01 A;  2OQQ A;  3D71 A;  2KCU A;  5GQQ A;  2J5U A;  1Q05 A;  3B49 A;  2GOV A;  4WLW A;  5KAW A;  4R22 B;  5KAT A;  3IAO A;  4WLS A;  3D6Z A;  3LUR A;  5I41 B;  1JYH A;  1DIP A;  4AYZ A;  3D6Y A;  3T97 B;  3D70 A;  1D5Y A;  3Q2Y A;  3G9R A;  5I44 A;  2JML A;  3QAO A;  3GK6 A;  3Q5S A;  1EXJ A;  4A1M A;  1Q07 A;  3GPV A;  1Q09 A;  3Q5R A;  2BOW A;  3E0H A;  3R8J A;  2ZHG A;  1Q0A A;  1EXI A;  2DG6 A;  1R8E A;  4R4L A;  5KCB A;  2VZ4 A;  3R8K A;  4AYZ B;  3Q1M A;  1Q08 A;  2ZHH A;  4R4E A;  1JBG A;  1BOW A;  5KAU A;  5KAX A;  3HH0 A;  5KAV A; 
#chains in the Genus database with same CATH topology
 3GF7 A;  5KLV E;  3CX5 D;  4C7N B;  3L74 J;  2ZVO B;  3H1K G;  3CXH E;  4IFD K;  3GF3 A;  2ZT9 C;  1EDL A;  4NPE A;  3R8J A;  3L71 J;  1U7J A;  1EZV E;  2IYO A;  2N9Y B;  2YO3 A;  2Y0E A;  3L71 E;  3RL0 B;  1R8D A;  3W67 A;  2OYI B;  1VF5 C;  5B66 E;  1LP1 B;  1N73 C;  3TGU E;  1DD3 A;  2P7J A;  2E5T A;  1YIT P;  4HJG H;  2J58 A;  3TGU J;  4W7Z A;  1K9M Q;  1KQF B;  2H7H A;  1RE4 A;  4TT3 H;  3R2P A;  3EQ2 A;  3PH0 A;  1VQ9 P;  1JBG A;  4IOI H;  1YTZ T;  2WT7 B;  1SQP E;  1KYO I;  2Q3I A;  4DCZ A;  2QRX A;  3L73 G;  1KC8 Q;  3E1I A;  2WSE H;  1HF9 A;  3R8K A;  3CWB G;  1SQX E;  4D6T J;  2KB7 P;  1SFC A;  1BCC D;  2LR2 A;  2B9B A;  4D6T E;  1SQB K;  3LW5 H;  3H1H D;  1SQV K;  1VQK P;  2H89 C;  1RQV A;  3M9B A;  2ZHG A;  2A06 G;  2WSF H;  1LT9 A;  1Y9B A;  2JKV A;  4PV1 B;  3OJA B;  5DJT B;  5KJ7 A;  1BE3 D;  2WSC J;  1KYO D;  1X8Y A;  1BE3 G;  3BCC J;  5KAI H;  4JF7 A;  2K1A A;  1VQ7 P;  1BGY D;  1BDC A;  5BVZ A;  3BCC E;  1L4A B;  3H1J G;  1NTM K;  2R3S A;  1AV1 A;  2OTL P;  3K5B A;  3H1J D;  1ZLL A;  1QL2 A;  3M0A A;  2R5D A;  1KMI Z;  2WQY C;  2WSC H;  2WPS A;  4AUW A;  4R4M A;  3M91 A;  3EZ9 A;  3HD7 C;  3EFF K;  1DH3 A;  4H0L B;  1ZW0 A;  5KLV K;  2BAS A;  2E74 D;  1NKN A;  1RF0 C;  1FJK A;  4KHX A;  3CCV P;  1NTZ E;  3B5N B;  2GUV A;  3CWB J;  2LXB A;  3WUT A;  3L75 J;  2KK7 A;  4ZMD A;  2QE7 H;  2QM7 A;  3B5N A;  5TJH A;  5CCH D;  1NH4 A;  1LNQ A;  1KFN A;  3A5T A;  1HJ0 A;  1KIL C;  1NJI Q;  1FDI A;  2JWA A;  3HD7 A;  2LKM A;  2K3R A;  3HE4 B;  2BCC D;  1Z56 A;  2QJK B;  3M0D C;  2ZHH A;  1NU1 E;  4I2L C;  3H1L E;  2WSE J;  2ZYD A;  2HVA A;  1CSB A;  5APT A;  2ZXX A;  3IAO A;  4OGQ B;  2BCC E;  1SS1 A;  4OH8 B;  3SSU A;  1GL2 B;  1Q08 A;  1RH5 B;  1VQO P;  1Q82 Q;  1FE6 A;  1SQP G;  4JQ0 D;  1OVR A;  3D71 A;  2XV5 A;  4WLW A;  1Q2N A;  5KLI B;  2H43 A;  1ZP0 C;  1N7S C;  1KV4 A;  2YKP A;  3HD7 B;  3GG2 A;  3MIW A;  3CX5 E;  3SWF A;  1ZR2 A;  1IC2 A;  1PP9 E;  5D90 A;  2NPS C;  4EYY Q;  1S5L X;  3LID A;  5KTB A;  2O1J A;  1PP9 J;  4R22 B;  5KAW A;  1SQQ G;  1X9V A;  3N7N A;  4N3Y B;  2A45 I;  2D2C D;  3M0D A;  3VP9 A;  1LT9 C;  5AVZ B;  3M9Q A;  3U1C A;  3RK3 C;  5AW8 B;  2KS1 A;  2V4H A;  2KLU A;  3CLQ A;  1FC2 C;  1YBK A;  1LTS C;  3PP5 A;  2Y0C A;  5AVQ B;  4WY4 B;  3SWY A;  3A0H H;  4H44 C;  3BAT A;  1RF1 C;  3H6P A;  3VMA A;  4DT0 A;  2R32 A;  4N6J A;  1URQ A;  2E74 B;  2P2U A;  1N7L A;  5CCG C;  5CCH A;  2K37 A;  2ZJS E;  2JWD A;  1GK6 A;  5CJ0 A;  4IFF A;  1YQ3 C;  4WWI A;  2IZ1 A;  2QM8 A;  1SQV G;  3RL0 g;  2KP8 A;  4IL6 X;  3MZW B;  4NPD A;  3CCQ P;  2HLO A;  2J5U A;  3HE4 A;  3FWL A;  4W7Y A;  4C7N A;  1EZV I;  2FXO A;  1JUN A;  1OFC X;  1NGM B;  2M3B A;  3KYQ A;  1URQ C;  5AW0 B;  4GKG A;  1JB0 J;  1PL5 A;  1SQX K;  3AE9 C;  2N9B A;  1VQ8 P;  4JYB A;  1KZU B;  1R5L A;  4WVZ A;  2WWW A;  1H89 A;  3V2R A;  1ZN5 A;  4Y99 C;  2FYU J;  1NHL A;  4H0L C;  1RF0 A;  1JY2 N;  2DW3 A;  2KI7 B;  2V7Q H;  1W5C E;  2AEM A;  3O8Z A;  3GLM A;  2GOV A;  4WLS A;  4OGQ D;  1USE A;  2W6J H;  2P10 A;  1LWU A;  2QJP C;  3HTK B;  1N7S D;  2YMY A;  3F5H A;  4B86 A;  1MFZ A;  1DX7 A;  2KZI A;  2W6B A;  3TGU G;  4QMA A;  4WB4 A;  2ITA A;  1OW8 A;  1N86 A;  1SQB E;  2KNC A;  2R5B A;  5KCB A;  4U3F J;  1JY2 O;  2ZXE B;  2FXP A;  1HJB A;  3V4W A;  5CMZ A;  4U3F E;  1LTJ C;  1FZA A;  3RL0 D;  2KCU A;  1FZC B;  3MD0 A;  1W2B O;  5KLV G;  1KN7 A;  3L74 G;  1GMJ A;  3PHL A;  3CMA P;  3SFD C;  3HE5 B;  2YNY A;  5GTH E;  1PV3 A;  1JY3 O;  1T6A A;  3H1I J;  3H32 B;  1HUC A;  4KT0 J;  1G2C A;  4I7Z B;  3II6 A;  3TNU A;  3ZDM A;  1ZRT E;  1DIP A;  2E75 D;  3L70 G;  1X79 B;  3L75 G;  3R4Y A;  2ZT9 B;  1WT6 A;  1M57 D;  3L70 D;  5KAU A;  4UB8 E;  2KYV A;  2XZR A;  3LW5 J;  3L74 E;  4OVN F;  2Z5H A;  3Q2Y A;  1OMI A;  1TU3 F;  3CXH H;  3HUS A;  4DCK A;  3CCS P;  1JY3 P;  2ZFC A;  3KPE A;  5GTI H;  2H8P D;  1BSH A;  2WPV B;  3M06 A;  4L75 A;  2E42 A;  4O9B A;  1YJW P;  3H1I G;  3CPW O;  3USS A;  1EZV D;  1JM0 A;  2RKL A;  1L0L D;  2O01 J;  3B49 A;  1HTL C;  1JY2 P;  5BU8 B;  1KQG B;  1H0T A;  5B5E H;  4L76 A;  1LTB C;  1SQP D;  2E75 C;  3EZ7 A;  3GHG C;  1Q7Y Q;  1SQP J;  2G3A A;  1U7M A;  1PGO A;  3HE5 A;  4LHF A;  1XTG B;  1PPJ E;  4C46 A;  3P8C E;  4K35 A;  1GZL A;  1S3J A;  1OVU A;  2KUB A;  3PRJ A;  4C7R A;  3TGU D;  3L72 J;  2NPS B;  2YXQ B;  2C9L Y;  1FBM A;  2GM4 A;  1HH0 A;  3AE6 C;  3ITK A;  2QA4 P;  1NYH A;  5EFW B;  1IK9 A;  5AW6 B;  1NTK E;  4BWN A;  1SQV E;  5B5E E;  1WRG A;  3P32 A;  1OZH A;  1VDF A;  4H44 D;  1NTK J;  3AE5 C;  5AVV B;  1VQ4 P;  3HRN A;  5APW A;  3BCC D;  5KLV D;  3S4R A;  5E79 H;  1GL2 C;  3KZI H;  3L73 J;  3G9R A;  3AEA C;  2E5Y A;  5AW4 B;  4ZKP A;  1SFC C;  3RK3 D;  1BGY E;  3JC2 2;  4EDF A;  1M7L A;  1JCC A;  2K9J B;  1SQQ K;  1RE4 C;  2N1T A;  2HR3 A;  2KLV A;  1KFM A;  2AXC A;  4Z1M H;  2PP6 A;  2WSF J;  4R24 B;  1X0T A;  4WY4 A;  5CBO A;  2G8Y A;  3A0B E;  1URQ D;  1RY3 A;  1S1C X;  1KQS O;  1NTM D;  1FZF A;  1LT1 A;  2C0W A;  3RK3 B;  1KD1 Q;  1EDK A;  5AVU B;  1AVO A;  3RK2 B;  2A45 G;  2J59 M;  1SP4 A;  1R8E A;  3HUS C;  4JBZ A;  1YHQ P;  1FDM A;  2N1T C;  3I55 P;  4L73 A;  2CPB A;  1PPJ G;  3L73 D;  1JO5 A;  3WUV A;  4AYC A;  4HKZ H;  2HOD B;  4H44 B;  2P1J A;  1PPJ D;  4PD4 H;  1PGP A;  3EZF A;  3VMX A;  2WIT A;  3E7K A;  4U3F D;  4ZKU A;  4UB8 H;  1M1J B;  2IX7 C;  1RE3 A;  2H88 C;  1SQB D;  2B87 B;  1LTT C;  2XU6 A;  5AVY B;  3B4S A;  3VMZ A;  2GA1 A;  1PM6 A;  2Q3E A;  1IFD A;  4R4L A;  4BRY B;  1PGJ A;  1FJP A;  1JTH B;  3RL0 C;  2OYI C;  2OAR A;  2NPS A;  4EIJ A;  4ASV A;  2OYH B;  1URQ B;  1IJD B;  1VQN P;  3AEE C;  3CCL P;  2PFX A;  2N1T B;  4GIF A;  1A02 J;  3GK6 A;  3CCE P;  1KB9 I;  1PZQ A;  3AE3 C;  5CCG D;  3OW2 O;  2HFE D;  4Y28 J;  2Y0D A;  4H13 B;  2D2C C;  4YTP C;  5TIS E;  1Q90 D;  2NZ2 A;  3L70 J;  2IEF A;  1N2D C;  4RES B;  2Q7C A;  1J1D C;  1NTZ D;  2OTJ P;  2FXM A;  4AQR D;  1VQM P;  1M8O B;  5AW5 B;  4H0L D;  1NTZ G;  5KLI C;  1D5Y A;  5M1B A;  4TLF A;  4WBA A;  2OYH C;  1L0L J;  3A3Y B;  2OGU A;  3AEG C;  3UCS A;  2YMK A;  2ZVN B;  3H32 A;  2RN0 A;  3AEC C;  2Z4E A;  5E79 E;  1LX8 A;  2IPP A;  1SQX J;  5APY A;  1J1E C;  1Q07 A;  1FOS F;  2BOW A;  4KJM A;  3FX0 A;  2IYP A;  4UB6 H;  5KJ7 D;  1RH6 A;  4BXL A;  1FZC C;  1EDI A;  2FYU K;  1KOR A;  2GUS A;  1SQB J;  3BAS A;  3H1H E;  2YO2 A;  2E76 D;  1YIJ P;  4A1M A;  1GD2 E;  1NTM J;  4W80 A;  3V6I A;  3Q3D A;  3QWO C;  1SQP K;  1X22 A;  1LGH B;  2E76 C;  3GMA A;  4N78 D;  4WY4 C;  3AE8 C;  1RF1 A;  1W2E A;  3B5N C;  4D6T D;  3AE4 C;  3CI9 A;  1IFN A;  1Q09 A;  3VYI A;  4D6T G;  1FZG A;  3HD7 D;  1KB9 D;  5D8C A;  3BVH A;  1KYO H;  1VF5 D;  3WMM 0;  1EQ7 A;  3C8V A;  1LTJ A;  4DJG A;  2WPR A;  3WUU A;  2AEF A;  2FFD C;  3RBZ A;  3V2N A;  1JCD A;  1MUU A;  2I8D A;  3H1L G;  2JJL A;  1ZRT D;  3L4F A;  1SFC D;  3H1H G;  1NTZ J;  2WPQ A;  5H2F H;  3NTN A;  1L4A A;  1JYH A;  3CL3 D;  2M3E A;  1AQ5 A;  4YPC A;  1VQ5 P;  5H2F E;  1KQL A;  4GDO A;  3L71 G;  1GL2 D;  3GHG B;  2I1K A;  4YXD C;  3MUD A;  1S5L E;  2IBZ D;  3MTU E;  3VTP C;  5L8R J;  1M90 Q;  1GDT A;  1QVF O;  3NMD A;  3H1L J;  4XFJ A;  1GU4 A;  1IFI A;  1HBW A;  2I1J A;  1FAV A;  1P84 E;  3GW6 A;  1N7S A;  3L72 D;  1QEX A;  5I41 B;  3OAK A;  1LWU B;  3T97 B;  1SVF A;  2SPZ A;  1DEE G;  1BE3 J;  2IDB A;  2XND H;  1WMK A;  4J2N A;  1K05 A;  2NRG A;  2HG5 D;  1XTC C;  1IFJ A;  3GP4 A;  4RJT A;  3HUS B;  3N4X A;  1S5L H;  1VQL P;  2A06 E;  1BCC J;  2KVV A;  1IK7 A;  1FOS E;  5APV A;  2OG0 A;  1OVV A;  1JTH A;  4LGD E;  4R4E A;  2QG4 A;  2O01 N;  3CCM P;  1L0N E;  3I56 P;  3H25 A;  1PIX A;  2M5A A;  1GTW A;  4PD4 D;  3LUR A;  2E76 B;  2XDJ A;  3D70 A;  2BCC G;  4JYC A;  3L73 E;  4OGQ C;  1NTZ K;  1KIL E;  3A0B H;  3AEF C;  3NXS A;  1HGZ A;  5KAF H;  2C9N Y;  1IZN B;  1M1K Q;  1VF5 B;  5AW7 B;  2UWJ E;  3G71 P;  2W83 C;  1NTK D;  1L0L G;  1KIL B;  1LTA C;  5GTH H;  2Y9Z A;  1OW7 A;  2QJK C;  4I1L A;  2A45 H;  1M56 D;  3IFM A;  3HH0 A;  4PV1 C;  2FFD B;  2B88 A;  2M0B A;  3ABV C;  1LWU C;  3FXD A;  1NU1 G;  1NU1 K;  1SQX D;  4BRY A;  3KZI E;  1P84 I;  3OA7 A;  1Q05 A;  2HOD A;  3CCU P;  3BRT B;  1FDO A;  2VRS A;  5KJ7 C;  3CXH I;  2FFD A;  1L2P A;  1GL2 A;  3WU2 E;  2KS1 B;  5AW9 B;  2JDI H;  2PRR A;  1LTJ B;  2WZ7 A;  2BEZ F;  3L36 A;  1L0N D;  2K88 A;  1QL1 A;  1L0N G;  3LIE A;  3H1K J;  2E75 B;  5GTI E;  3E1R A;  2B89 A;  4IFM A;  3H1K E;  4N78 E;  1N7S B;  1Q86 Q;  1Q06 A;  1VQ6 P;  1BSN A;  2W8Z A;  3EWK A;  1BGY G;  3D6Z A;  4DOJ A;  3A0H E;  2E74 C;  2K9Y A;  3HTK A;  3G6E P;  1Y47 A;  3KDP B;  3GPV A;  1FZB A;  3BCC G;  2IFM A;  3T97 A;  1YJN P;  1N73 B;  1J1E B;  2JR8 A;  5APX A;  1PP9 G;  5DJU B;  2IBZ E;  1OWA A;  5AVS B;  2Q9I A;  1E79 H;  2L5G B;  3PJS K;  3UIA A;  3JCU H;  1KIL A;  1RE3 C;  3CX5 I;  2JP3 A;  5CBN A;  1PGQ A;  1OXZ A;  2ZAE B;  1BDD A;  1JOC A;  2HYN A;  1CI6 A;  3V5B A;  1SQQ J;  1SQB G;  1MFT A;  3Q5P A;  3CD6 P;  2KOG A;  3U1A A;  3L37 A;  1FU1 A;  3QH9 A;  1SQQ E;  2OTK E;  4YXW H;  3W68 A;  3NFQ A;  5B66 H;  4EOT A;  3QAO A;  1FZC A;  4HYT B;  2ZT9 D;  1EC5 A;  3BRV B;  1PFI A;  1G2C B;  4NPF X;  3TK1 A;  1S4X A;  1QVG O;  3U59 A;  2YKQ A;  3FGA D;  2QEX P;  1L0N K;  3CX5 H;  3CC4 P;  1MV8 A;  3MGN A;  1PP9 D;  3RBX A;  1DD4 A;  2AEJ A;  4JPZ B;  1S9K D;  3H1I D;  1E5W A;  3E0H A;  3CCR P;  1FS0 E;  1BOW A;  5KAX A;  4LLH A;  1VPC A;  1AFO A;  5CJ4 A;  2JEE A;  3IN6 A;  4ASW A;  2WTY A;  1QX8 A;  3FXE A;  3MUD C;  2RH0 A;  2MKV A;  5KKZ C;  2OYH A;  1ZME C;  3KXD A;  1YI2 P;  1L4A D;  1USD A;  5KLV J;  3M9H A;  1SLQ A;  3A7O A;  3VOP A;  2W90 A;  3CME P;  1NTM E;  3G4S P;  2POH A;  1KIL D;  2QJP B;  4LC1 A;  3V2Q A;  3VMY A;  3RK3 E;  3JCU E;  2YIU B;  2KSE A;  1AVY A;  5AVW B;  5KAT A;  2CK3 H;  3C1L A;  2YXR B;  3S9O A;  2FBW C;  3KHU A;  1RF1 B;  3GHG A;  3L70 E;  3L74 D;  2OYI A;  2WVR A;  2NPS D;  3Q5S A;  2QSI A;  1CI6 B;  1YQ4 C;  3H1K D;  2FYU G;  3IF4 A;  1NWQ A;  1Q81 Q;  2Q6Q A;  1S2E A;  4DZO A;  3MHV A;  1KTM A;  1IO4 A;  2P58 A;  2QJY B;  3O6Q B;  3TDK A;  1HVV A;  1RQU A;  4H13 C;  2IBZ I;  2KZJ A;  2OYO A;  4IL6 H;  2W27 A;  1ZR4 A;  3CCJ P;  1ZXG A;  2KNC B;  3L72 E;  2KSJ A;  1LTG C;  5C39 A;  1MKM A;  3G3Z A;  3V4Q A;  1SFC B;  3CWB E;  1JY3 N;  5KKZ B;  3V2P A;  1KB9 E;  1NOH A;  1D7M A;  2R3C A;  3Q1M A;  1N8R Q;  3SFE C;  1U57 A;  3F89 A;  2WT7 A;  1LJ2 A;  1IFM A;  1Y6U A;  1NTK G;  5AW2 B;  2R44 A;  5AW1 B;  3P8M C;  1NAF A;  3L35 A;  5APU A;  2O1K A;  4RKU J;  1NU1 J;  3H1L D;  3MP7 B;  4U7J A;  1NU1 D;  3PTZ A;  1SQX G;  3RK2 C;  5APS A;  2Y9Y A;  1BGY J;  2YKO A;  3TYY A;  3IR9 A;  2V7Q J;  1IFP A;  2KIK A;  3H1I E;  3JSV C;  3EZ6 A;  3D6Y A;  1T8Z A;  4H13 D;  3RGU A;  1S9K E;  1J2J B;  4MN4 C;  1NVO A;  2HPC B;  4L74 A;  2D2C B;  2DG6 A;  2QJY C;  1NTK K;  2JO1 A;  2O01 H;  5CCH C;  4B0Y A;  3FWN A;  3B71 A;  1JNM A;  5AVT B;  5KAI E;  2PGD A;  4EI2 A;  5GQQ A;  2MJZ A;  4UB6 E;  1H88 A;  1RHZ B;  1OX3 A;  1QGK B;  1JMM A;  2RMZ A;  2WMM A;  1SQQ D;  2WSS H;  1JEK A;  1LTI C;  1QLE D;  1EZV G;  5AW3 B;  1GK4 A;  4GOF A;  1Y8A A;  2P67 A;  3L75 E;  5BU5 A;  2OQQ A;  4GOD A;  2B87 A;  1BCC G;  4I7Z C;  4CPG A;  1DEB A;  3AE1 C;  1HGV A;  4HH2 A;  2K9J A;  1EXI A;  1Q0A A;  5APQ A;  4GOE A;  1UII A;  4ZNC A;  1YYC A;  5AVR B;  2ZYA A;  3P7K A;  4U3F G;  1EXJ A;  1AA0 A;  2VZ4 A;  1YTZ I;  3I5C A;  2FKW B;  2BCC J;  5KAV A;  3EFG A;  1N73 A;  4XE5 B;  1BE3 E;  1H8A A;  1SQV D;  4XA4 A;  2CPS A;  2YIU C;  3S1K A;  2N1T D;  1ZV8 A;  1VQP P;  2IZ0 A;  1NTM G;  2LXC B;  3Q5R A;  2M8R A;  2Q1K A;  4IL6 E;  1HWT C;  1BCC E;  1LP1 A;  3TNU B;  4PJ0 H;  4M3L A;  1M1J C;  1MZ9 A;  5K5G B;  1L0N J;  3CC7 P;  1L0L K;  3P8C D;  2BEQ D;  4HB1 A;  2QIW A;  1UIX A;  2HPC A;  1SQV J;  1NO4 A;  2O3J A;  1EDJ A;  3TSI A;  2E43 A;  4AYZ B;  2AXT E;  1OIP A;  2QVA A;  1H0T B;  1KB9 H;  5CCG A;  4RO0 A;  1M1J A;  2Q5U A;  3AE2 C;  2FYN C;  1P84 H;  2M5A B;  1AJY A;  4AYZ A;  1S72 P;  1T3J A;  2A06 D;  1L0L E;  3SWK A;  1T3U A;  1NAY A;  3B5N D;  3L71 D;  3PLN A;  1G1I A;  2XKM A;  1VL2 A;  3CC2 P;  4WY4 D;  1ZOY C;  4Y99 B;  1T2K D;  1K04 A;  4PD4 E;  2ZYG A;  1GW3 A;  1P84 D;  3RK2 D;  3AE7 C;  1L4A C;  4A7P A;  1J1D B;  4PJ0 E;  1GW4 A;  1R5S A;  4I6M C;  3L72 G;  1K73 Q;  3CWB D;  1AQT A;  2PAJ A;  3H1H J;  4PD4 I;  2FYZ A;  3WU2 H;  3TF5 A;  1CW5 A;  4K3A A;  1JMB A;  2L91 A;  5I44 A;  2XNX A;  2FYU D;  2AXT H;  3A2A A;  2KXP B;  1G1J A;  3O6Q A;  1FZE A;  2IBZ G;  4PV1 D;  3H1J J;  5AVX B;  1K8A Q;  5KAF E;  3L75 D;  3H1J E;  1CZQ A;  2JML A;  4OWF A;  1LT9 B;  3KQG A;  3VP8 A;  2FYN B;  4GT1 A;  3B8E B;  1A02 F;  3AED C;  2IFN A;  3C9I A;  2FYU E;  3AEB C;  5E01 A;  2Z5I A;  1T2K C;  3CXH D;  1KYO E;  3VN0 A;  2W6A A;  5TIS H;  1OW6 A;  2C0X A;  1YJ9 P;  1GU5 A;  5CHX A;  2FY8 A;  1NKZ B;  3EZ2 A; 
#chains in the Genus database with same CATH homology
 1VL2 A;  3GF7 A;  3SFE C;  1U57 A;  4H44 C;  1Y9B A;  5KKZ C;  4YXD C;  2WPV B;  2WSE J;  2HVA A;  1Y6U A;  1RH6 A;  3AEA C;  1ZOY C;  4PV1 B;  1ZME C;  1KOR A;  1VF5 B;  3GF3 A;  2ZT9 C;  3IAO A;  3AEE C;  5L8R J;  2E74 B;  1K04 A;  2WSC J;  4OGQ B;  3G9R A;  4RKU J;  2E76 D;  3GK6 A;  1OW8 A;  2JP3 A;  1EXJ A;  4A1M A;  1OW7 A;  4XFJ A;  3R8J A;  3AE3 C;  1YQ3 C;  3RK3 E;  2QJK C;  4U7J A;  3AE7 C;  5KCB A;  2VZ4 A;  2O01 J;  1Q08 A;  4Z1M H;  3B49 A;  3HH0 A;  2FXP A;  4PV1 C;  3RL0 g;  3ABV C;  5KAV A;  5KAT A;  2WSF J;  4R24 B;  4IL6 X;  3Q3D A;  3S9O A;  1R8D A;  2FBW C;  3Q5P A;  1VF5 C;  2G8Y A;  1KQG B;  2E76 C;  3GMA A;  3D71 A;  1DD3 A;  4Y28 J;  2KCU A;  3AE8 C;  2V7Q J;  1S1C X;  2J5U A;  1Q05 A;  2YIU C;  4WLW A;  2E75 C;  4H13 B;  2D2C C;  4YTP C;  3EZ7 A;  5I41 B;  1FDO A;  3EZ6 A;  3D6Y A;  3T97 B;  4H13 D;  1GMJ A;  5I44 A;  3AE4 C;  3QAO A;  1KQF B;  2G3A A;  1NGM B;  3Q5S A;  1ZP0 C;  2D2C B;  4TT3 H;  1Q90 D;  4LHF A;  1Q09 A;  3Q5R A;  2ZT9 D;  3SFD C;  2DG6 A;  1R8E A;  1KMI Z;  2QJY C;  2QSI A;  2WQY C;  1JB0 J;  2IDB A;  2NZ2 A;  1YQ4 C;  3O6Q A;  1JBG A;  1WMK A;  4J2N A;  2JO1 A;  2IEF A;  1K05 A;  1PL5 A;  1PV3 A;  5D8C A;  3FGA D;  4R4M A;  3AE9 C;  5D90 A;  3GP4 A;  4B0Y A;  2BEZ F;  4PV1 D;  1KTM A;  3B71 A;  3EZ9 A;  1S5L X;  4KT0 J;  4I7Z B;  5GQQ A;  4H0L B;  1VF5 D;  1DD4 A;  4R22 B;  5KAW A;  2BEQ D;  2E74 D;  4DCZ A;  1ZRT E;  1UIX A;  2QIW A;  4H0L D;  1RQU A;  4H44 B;  5KLI C;  1DIP A;  1D5Y A;  3C8V A;  2KVV A;  3EZF A;  2E75 D;  5M1B A;  2JML A;  2E75 B;  4H13 C;  3R4Y A;  1IK7 A;  2ZT9 B;  2OG0 A;  2D2C D;  1HF9 A;  3E0H A;  3AE6 C;  4H0L C;  3R8K A;  4AYZ B;  4R4E A;  1BOW A;  5KAU A;  1NYH A;  5KAX A;  3AED C;  1Q06 A;  3AEG C;  3UCS A;  2YMK A;  3H25 A;  3AEB C;  5E01 A;  2OQQ A;  1PIX A;  1MKM A;  3AEC C;  2H88 C;  3EWK A;  3AE2 C;  2FYN C;  3GLM A;  4I7Z C;  1HJ0 A;  2GOV A;  1LX8 A;  3LW5 J;  3IN6 A;  4WLS A;  3D6Z A;  3AE1 C;  4H44 D;  4OGQ D;  2E76 B;  1AJY A;  1JYH A;  3LUR A;  4AYZ A;  3D70 A;  2E74 C;  2K9Y A;  2P10 A;  1FDI A;  3AE5 C;  3Q2Y A;  2QJP C;  4OGQ C;  1OW6 A;  1PM6 A;  2H89 C;  1Q07 A;  3GPV A;  1OMI A;  1RQV A;  1TU3 F;  2BOW A;  2ZHG A;  1Q0A A;  1EXI A;  4R4L A;  2MKV A;  1KIL E;  3Q1M A;  2ZHH A;  3EZ2 A;  3AEF C;  4GDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...