1EXIA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exiA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exiA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exiA01
1D5YA 4WLSA 4R4LA 3UCSA 3D6ZA 4J2NA 2DG6A 5KCBA 3E0HA 4AYZB 3T97B 3D70A 3GK6A 5KAWA 3Q5RA 2J5UA 5D8CA 3QAOA 5GQQA 5E01A 4R4EA 2BOWA 3D71A 1R8DA 4WLWA 4R22B 3Q5PA 1Q0AA 5I41B 1R8EA 2OQQA 1BOWA 3Q2YA 3B49A 5KAVA 1EXJA 3GPVA 3D6YA 3IAOA 5KATA 5KAXA 5KAUA 3R8KA 2VZ4A 1JYHA 2JMLA 5D90A 2ZHGA 3Q3DA 1EXIA 3LURA 1Q06A 3HH0A 1DIPA 3GP4A 1Q05A 1JBGA 4B0YA 2ZHHA 5I44A 2HVAA 4R24B 2GOVA 2KCUA 4A1MA 3G9RA 1Q08A 3Q1MA 4R4MA 3R8JA 3Q5SA 4AYZA 1Q07A 1Q09A
chains in the Genus database with same CATH superfamily
2R5DA 1ZR4A 1SQQJ 4I2LC 1USDA 4WY4D 5GTHH 1VL2A 1QL2A 1NTMJ 4OGQC 3H25A 1M7LA 1KB9D 2FXMA 1SQVG 5KLVJ 2JWDA 5KAUA 3PRJA 1RF0A 3KPEA 1HJ0A 3VMYA 4A1MA 2KCUA 3R8JA 1YJ9P 3H1IJ 2R44A 1H8AA 1N73B 3NTNA 1DD4A 3M9HA 3HUSC 1S5LX 3FX0A 3D71A 1S4XA 1SQXE 3WUUA 2JMLA 4R24B 1SQPE 4KHXA 3G3ZA 1LT1A 1D7MA 3L70J 1VQ6P 1L0NG 5KJ7D 2HPCB 2LKMA 1KYOE 1OVRA 3RL0D 1NU1J 4TT3H 2H89C 1KORA 1KC8Q 3CX5I 4WY4B 4DJGA 2K9YA 1KZUB 4XA4A 1RE4C 3A0HH 2ZYDA 1MFZA 4C46A 3CXHD 2WSFH 4KJMA 3MD0A 5AW0B 2WITA 3RBXA 3LURA 1DIPA 4WVZA 2IBZE 2E74C 1ZXGA 3TF5A 3I56P 3SWKA 2QJYC 1VQLP 2ZYAA 1FZCB 3PTZA 3H1KE 1PV3A 3CPWO 4DZOA 2XU6A 4IL6X 3G4SP 3BVHA 2J58A 1FJPA 4K35A 2KLVA 3H32A 1LTIC 1VQ8P 1L0LD 2QE7H 1DH3A 1H0TB 2QJPC 5AW6B 3L71J 5AW4B 3N7NA 1J1EC 4W7YA 3Q3DA 5H2FH 1N7SB 3NXSA 3IN6A 3HE4B 1OVVA 3KDPB 4PJ0E 4N78E 5AVWB 2W6AA 3LW5J 1EQ7A 3CCVP 1JUNA 2J5UA 1W2BO 3W67A 2PFXA 3CCJP 3RL0B 1Q86Q 2FKWB 1P84I 1PP9E 1RE3A 1BE3E 4GKGA 1N8RQ 5CCGC 4H44C 1QGKB 3BCCD 3K5BA 1Q08A 5APYA 1Q07A 1FZGA 2AXTE 2IFNA 2OTLP 1SQBK 1UIIA 4PD4D 5I41B 1L0NJ 4H0LD 4L73A 1WT6A 1VQ9P 1BSHA 1SFCC 1LTGC 2QSIA 3H1LG 4PV1C 2BCCJ 1NWQA 4GDOA 4C7RA 1RQVA 1NYHA 2H8PD 1AQ5A 1OW7A 1NTZK 1RE3C 1JY2O 1Q05A 1NTMD 5CCHA 1RF1A 1YJWP 2IX7C 1EDLA 1NJIQ 2FY8A 1HGVA 5KLVD 1FS0E 3V5BA 5C39A 2YO3A 1ZN5A 3L73G 3L37A 1QL1A 5APVA 5APXA 2FBWC 4U3FG 3H1ID 1FZFA 1IFMA 1L4AD 1KILE 3QAOA 5KAIH 1SQXK 4HKZH 1VQMP 3L72E 2W83C 1XTCC 1HGZA 1SQPK 3AEDC 2IYOA 3L70D 1ZRTE 2Q1KA 3SFEC 3CCQP 3AE6C 1LNQA 2LXCB 1NU1D 4DCKA 3O6QB 3H1HE 5CJ0A 3AECC 3CXHE 1USEA 1JY2N 4H13D 4M3LA 3EQ2A 2R3SA 5B66E 1NTKJ 2FYUE 2YMKA 3I5CA 5KLIC 1WMKA 1DEBA 5KATA 1PL5A 2AEJA 1M8OB 1A02F 1CW5A 2YKPA 2H43A 3Q5SA 2QIWA 1GZLA 1OW8A 4RO0A 3TGUG 4CPGA 1L2PA 1UIXA 1KB9H 1QVGO 4XFJA 1JM0A 1KTMA 4QMAA 5AVXB 3CI9A 5KAVA 2GUSA 1M90Q 3HRNA 1FDIA 2V7QJ 1L0LE 2HODA 4JYBA 4WY4C 3M0DA 3TDKA 2E43A 1KILA 4UB6E 3L71D 1LT9A 2ZJSE 3C8VA 3L72J 5BU8B 2KZJA 1IC2A 3WU2E 4ASWA 3L73J 5BVZA 4W7ZA 1G2CA 3ZDMA 3RGUA 3D6ZA 3E0HA 1NH4A 3BCCE 1FZCC 1KYOD 2QRXA 3M06A 1AA0A 1NAYA 3H1HJ 3GPVA 4H13B 1BGYJ 1VQNP 4PD4E 4DCZA 2YKOA 1ZOYC 3M0DC 4DT0A 2D2CB 5APUA 1LTJA 4BRYA 1KQFB 1BCCJ 1SQQE 1BSNA 1T3JA 1N7SC 1KQLA 1YQ3C 2Q5UA 1JEKA 1Y47A 3O8ZA 5AW2B 1MFTA 2BCCD 3M9BA 1XTGB 2DG6A 2A06D 5KJ7C 3H1KD 1NTME 3H32B 3CWBG 3RL0C 1YBKA 3AEAC 5CCHD 2FYNB 2Q3EA 3P32A 5KLVE 2WSSH 2W90A 1JCCA 4RJTA 2PGDA 4JBZA 2LXBA 1EZVG 3EZ6A 1URQD 1LTJC 3H1IE 4ZKUA 1OW6A 2KYVA 2ZHGA 2KSJA 1JBGA 3WMM0 1T2KD 2B9BA 3U1CA 3MHVA 2KUBA 2YIUB 1SQBG 2WTYA 2P10A 2N9YB 5KKZB 3L70E 4GODA 3RBZA 4IL6H 4IOIH 1S72P 3A7OA 3SWFA 3L74E 2BASA 1JY3P 5E79E 1OMIA 1NU1E 3JCUH 3UCSA 3EZ7A 2ZT9D 4OH8B 3TNUA 4NPDA 1PGJA 1NTZG 3GHGA 3O6QA 2J59M 3A0BH 4D6TG 2WVRA 3AE8C 1NTKD 1HWTC 2MJZA 1KQGB 4JQ0D 4AYZB 1RF1B 4XE5B 2GA1A 2XDJA 1OZHA 1JY3N 1T3UA 1ZW0A 3G9RA 5CBNA 4Z1MH 1URQB 3M91A 2IDBA 3V2QA 1SQXG 3CL3D 1X22A 5APTA 4R4EA 2PP6A 2E76B 3GHGC 5AVVB 1SQPG 3R2PA 5KLIB 1ZR2A 1L0LK 1L4AA 3AEGC 4U7JA 3L71E 1QX8A 5GTIE 3JC22 1KILD 1Y8AA 3RK2D 4WLSA 2L5GB 1VF5D 4L76A 1X8YA 4NPEA 3I55P 4C7NA 2HLOA 4OWFA 3L72D 1WRGA 2LR2A 2OYHA 3MP7B 3L74J 1FE6A 1P84D 1RF0C 2JO1A 3L75J 1ZRTD 3MUDA 3TK1A 3S9OA 2NZ2A 1W5CE 1NVOA 1Z56A 3AE7C 3H1HD 4BWNA 5AW3B 3H1JJ 2W6BA 1BGYD 2IBZG 2FYUD 1L0NE 3S4RA 1L4AC 1LGHB 1DX7A 1RHZB 2OG0A 3F89A 3VMXA 1M56D 1PPJG 3MIWA 1BCCD 1GD2E 2BCCE 5KAWA 3U59A 1NTZJ 2BOWA 2A06E 3A5TA 1FOSF 1ZLLA 4HYTB 2FFDA 2WPQA 2P7JA 2Z5IA 1KB9I 2HODB 1YTZT 3MUDC 1D5YA 2WSEH 2Q7CA 1NTMK 1BDCA 3CCUP 5AW1B 5GQQA 1SQVJ 4H13C 2XZRA 5KLVK 1KILB 1LT9B 4LGDE 3EWKA 2FXPA 1VF5B 4ZKPA 1JCDA 2ZYGA 3VTPC 2D2CC 2AXCA 3ITKA 1HVVA 1G2CB 1PP9G 4I7ZB 1BE3G 2CPSA 3EZ2A 2R5BA 1MV8A 1OVUA 2HVAA 1YIJP 2C9NY 3MGNA 2KS1A 4W80A 3P8CD 1LWUA 2YXQB 1KYOH 3GK6A 4AQRD 1GK6A 5AW8B 2FYNC 1MZ9A 4R22B 1LTJB 4BRYB 3AEBC 3G6EP 3M9QA 5AVZB 1DEEG 3CX5E 5TISE 3CCSP 2QG4A 3KHUA 2XNDH 2YMYA 1NU1K 1AVYA 3LIDA 2KSEA 1SQQD 2MKVA 1EC5A 1NTKE 2R3CA 2M0BA 3SWYA 5AW9B 2HR3A 1GL2A 1SLQA 5APSA 1VQ7P 4AYZA 1AV1A 2YIUC 3W68A 1NHLA 5KKZC 2WSCH 2GUVA 4UB8E 3B4SA 3P7KA 2L91A 5KAFE 2A45G 3BRTB 3PLNA 1URQA 1K04A 2XNXA 1LJ2A 3EFFK 4R4MA 3CC7P 1FOSE 2Q6QA 2FXOA 1S1CX 2KXPB 3M0AA 3CMAP 4PJ0H 3FWNA 3L73E 1IK9A 2NPSA 5CCHC 1RF1C 4U3FE 2JP3A 1P84E 4JF7A 3GLMA 1GDTA 3L74D 4H0LB 3TNUB 2KI7B 1Q90D 3D6YA 1VDFA 1ZP0C 2YXRB 3VYIA 1EXIA 2YKQA 2AXTH 3GHGB 3L75D 3HH0A 1URQC 1E5WA 1M1JA 1QEXA 1BGYE 4HJGH 3EFGA 4PD4I 1GW3A 5BU5A 4ZMDA 4EYYQ 2E76C 3FXEA 1LTTC 3H1JD 5B5EE 1T2KC 1S5LE 2P2UA 2Q9IA 1BCCE 2OYOA 1L0NK 5D90A 4JPZB 1NAFA 3OW2O 3VN0A 3H1LJ 5DJUB 3B5ND 4GOFA 2ZXEB 5AVUB 3HD7A 1G1IA 1J1DB 1L0LG 2XV5A 4AUWA 3CC4P 1J2JB 1KD1Q 3V2PA 1L4AB 1KQSO 4WB4A 4H44D 5AVQB 1SQVD 1HTLC 1K05A 1IJDB 2A45H 1R8DA 4C7NB 4DOJA 1K73Q 3BRVB 2QA4P 2OYHB 4RESB 2IZ0A 1EZVI 2E75D 3BCCG 4U3FJ 3P8MC 2JWAA 5KCBA 3WUVA 2N1TA 1S3JA 2O01H 2OYIB 1SFCD 5K5GB 1JMMA 2ZFCA 1FJKA 3P8CE 1EXJA 1X9VA 2P58A 3TYYA 2N9BA 3VMZA 4AYCA 4K3AA 3V2RA 5I44A 2GOVA 1HUCA 3ABVC 3LIEA 2WMMA 2YO2A 5AVRB 2KIKA 4KT0J 1LP1A 3KZIE 3G71P 1IFPA 2WPRA 1L0ND 2WT7A 2OQQA 3CXHH 3Q5PA 1KILC 4A7PA 1LT9C 5CMZA 5B66H 3RK2C 5TJHA 1VF5C 5GTHE 2P67A 1AFOA 1KMIZ 1DD3A 1MUUA 3KXDA 1OWAA 4TLFA 1AJYA 2W6JH 3B5NB 2K37A 2VRSA 1NTMG 1Q09A 2Y0CA 2FFDB 1JO5A 1GL2D 3A2AA 4I7ZC 1NTKK 2DW3A 4WBAA 2PRRA 3FGAD 3L36A 2G8YA 5KLVG 2WPSA 3Q2YA 4I6MC 4O9BA 1M1KQ 1JTHA 1PIXA 1PFIA 3H1IG 2JKVA 3TGUJ 3HE5A 2AEMA 2RMZA 3CLQA 2WQYC 1OIPA 1JY3O 2E5YA 3CWBE 2H7HA 1HBWA 1IFDA 2E75B 3CC2P 1IFIA 3TSIA 2W27A 3AEFC 3E1RA 4UB6H 1YITP 2WWWA 3L70G 3WU2H 1OXZA 3RK3D 2KS1B 2I8DA 1LWUB 1HH0A 1NGMB 2NPSD 1KFMA 3PJSK 2QVAA 2JDIH 1NU1G 1R5SA 3SFDC 4B0YA 2I1JA 1PM6A 1M57D 4ZNCA 1T6AA 2ZXXA 1KYOI 4IFFA 3L75E 5AVYB 1FDOA 3CX5D 4PD4H 2K9JB 3VOPA 3H1JE 3A0HE 1VPCA 2FYZA 1GL2B 2SPZA 1GMJA 2FYUK 1YYCA 2IBZI 3HUSA 1E79H 2KNCA 1Y9BA 1NTZE 1PGOA 4GIFA 4RKUJ 3H1LD 3HD7D 4D6TE 3AE2C 1Q82Q 3VP8A 2I1KA 2XKMA 4H0LC 3D70A 3CCLP 2KZIA 3CWBJ 2KOGA 3CD6P 3SSUA 3L71G 3A3YB 1IFJA 1KV4A 1SQVE 1JYHA 2B87A 3B8EB 3E1IA 1K9MQ 2AEFA 1A02J 3RK3B 4R4LA 5H2FE 1PGPA 3V4QA 3PH0A 1RE4A 1VQ4P 2NPSB 3WUTA 3AE3C 1VQ5P 1YI2P 1YJNP 3AE9C 1Q0AA 3L73D 1CI6A 2IFMA 2KB7P 1H89A 2N1TD 3HTKA 3OA7A 4U3FD 2GM4A 2M3EA 1GU4A 2ZT9B 1N7SD 3T97B 3R4YA 1LX8A 2OYIA 1QVFO 1M1JB 2HYNA 2WZ7A 1SQBJ 3E7KA 1J1DC 4BXLA 3EZ9A 5E79H 3L35A 3GG2A 2WSFJ 1JOCA 3USSA 1SVFA 2BCCG 2Y9ZA 2A06G 3H1KG 4HH2A 1SQQK 1TU3F 1VQOP 1EDJA 2OYHC 4Y28J 1LTAC 3HD7B 3B5NA 4D6TJ 1FZAA 1FU1A 1U7MA 1OX3A 1U7JA 3Q1MA 2OYIC 4HB1A 4OVNF 2WSEJ 2ZAEB 3OAKA 3U1AA 1PPJE 3GF7A 5KAXA 3KQGA 2QM7A 3IAOA 5CCGA 1SS1A 4GOEA 2B88A 3RK2B 2QEXP 3AE1C 3TGUD 1VQKP 1LTSC 5M1BA 3UIAA 1SQXJ 2A45I 2M8RA 2N1TB 5GTIH 1CSBA 1SQPJ 1NOHA 3RK3E 2Y0EA 3B5NC 1LTBC 1SFCA 3LW5H 5KAIE 3CMEP 2FFDC 4GT1A 2K3RA 1FZEA 3AEEC 2M5AA 5CHXA 3MZWB 4N6JA 3C9IA 2POHA 5APQA 1BOWA 1LP1B 4OGQD 2WT7B 1NKNA 3V4WA 1IFNA 1IZNB 1NTKG 2E5TA 3QH9A 3AE5C 1EDKA 3BASA 5AW5B 3CXHI 2K9JA 1HF9A 2E75C 2Z4EA 5L8RJ 2C0XA 1YTZI 3H6PA 3CCEP 3VP9A 2H88C 2RN0A 3PHLA 1FBMA 2K1AA 4EIJA 1CZQA 1JTHB 5AVTB 1LWUC 4Y99B 3H1LE 3H1KJ 2CPBA 2WSCJ 1N7LA 3HE5B 1T8ZA 1JB0J 1KB9E 3V6IA 2VZ4A 2IPPA 1AQTA 2QJKB 3KYQA 1RQUA 2M3BA 3CWBD 3GF3A 3L72G 1H88A 2BEQD 3B71A 1OFCX 1SQVK 2CK3H 1GL2C 4I1LA 4YTPC 2KP8A 4L74A 4EOTA 3NMDA 1S9KD 1N73A 2P1JA 1EZVD 1JY2P 1ZV8A 1BDDA 4OGQB 1PP9J 2OGUA 1BE3J 2E74D 3H1HG 5KTBA 1BGYG 3T97A 3F5HA 2FYUG 4LHFA 4IFDK 1JNMA 2Y0DA 2C9LY 3BATA 1GK4A 1JMBA 1SQBD 3CX5H 5TISH 2HPCA 4L75A 3CCMP 1BCCG 4YXWH 2OTJP 1R8EA 3HUSB 3R8KA 2O01N 2KNCB 1N2DC 4WY4A 4NPFX 3RK3C 3VMAA 2K88A 1N73C 3IFMA 3JSVC 2NPSC 1KN7A 1ZMEC 1NTZD 2D2CD 2IEFA 1Q7YQ 4D6TD 3NFQA 2Z5HA 1U57A 2ZT9C 3GP4A 4UB8H 2R32A 2ZHHA 5DJTB 1NO4A 1M1JC 2B87B 1YHQP 5KAFH 5CCGD 1FZCA 1R5LA 2PAJA 1W2EA 3TGUE 3FWLA 2Q3IA 4MN4C 2C0WA 3L4FA 2V7QH 3RL0g 3B49A 2ITAA 1AVOA 1IK7A 4ASVA 3EZFA 3FXDA 1CI6B 1X0TA 2ZVNB 3HTKB 4J2NA 1SQXD 1FZBA 2E74B 1H0TA 4JYCA 5D8CA 2IYPA 1GU5A 2O01J 4PV1D 5APWA 2QJYB 1SQPD 3HD7C 1N7SA 2JEEA 5AVSB 3HE4A 1P84H 1GW4A 1PGQA 4IL6E 4LC1A 4B86A 3GW6A 2O3JA 5KJ7A 1S2EA 3QWOC 1SQQG 3II6A 2KVVA 2G3AA 2Y9YA 3JCUE 4N3YB 1GTWA 4YPCA 1G1JA 1FDMA 4YXDC 2QJPB 1MKMA 2YNYA 4LLHA 1J1EB 4WWIA 2FYUJ 3PP5A 1KFNA 5B5EH 1Y6UA 1IO4A 2HFED 2O1JA 1S5LH 3A0BE 1YQ4C 2W8ZA 2N1TC 2WPVB 3S1KA 1Q81Q 3GMAA 2OARA 2V4HA 2IBZD 2KK7A 1HJBA 1RH6A 4EDFA 4H44B 3CCRP 1X79B 2OTKE 4EI2A 1PPJD 2UWJE 1FC2C 3Q5RA 2KLUA 3IR9A 5CBOA 3C1LA 4WLWA 1L0LJ 2BEZF 1RH5B 2IZ1A 2JJLA 2E42A 2HG5D 5CJ4A 1PZQA 1Q2NA 1QLED 1VQPP 1SFCB 2RH0A 2JR8A 4PV1B 3MTUE 2B89A 1S9KE 2M5AB 1EZVE 5E01A 3L74G 1RY3A 3V2NA 2QM8A 2ZVOB 1FAVA 4N78D 2E76D 1Q06A 5AW7B 3L75G 2O1KA 3BCCJ 1SP4A 4Y99C 4IFMA 3N4XA 1PP9D 1BE3D 3AE4C 3H1JG 1SQBE 3IF4A 2QJKC 5EFWB 2NRGA 3KZIH 2RKLA 1NKZB 3OJAB 1K8AQ 1N86A 1EDIA
chains in the Genus database with same CATH topology
4WLSA 3D6ZA 1VF5D 2K9YA 4H44D 3E0HA 4H0LC 1S1CX 1YQ4C 3D70A 1ZRTE 1ZMEC 2WPVB 2WSEJ 2P10A 3SFEC 2D2CD 4I7ZB 1K05A 1VL2A 2WQYC 2IEFA 2WSCJ 3GMAA 3GF7A 1R8DA 3AE6C 5KAXA 5I41B 1JB0J 4H0LD 3EZ2A 3GPVA 3IAOA 2E75B 2VZ4A 1JYHA 4H13B 3LURA 1RH6A 1U57A 2ZT9C 1DIPA 3GP4A 3AECC 3AEFC 2ZHHA 2HVAA 2JO1A 2E75D 3AE1C 4DCZA 2QSIA 1OMIA 4H13D 4H44B 1ZOYC 4PV1C 2E74C 4GDOA 2YMKA 4R4LA 3UCSA 3S9OA 3EZ7A 4OGQC 5KCBA 2ZT9D 2D2CB 5M1BA 3B49A 3H25A 1RQUA 1RQVA 1NYHA 2JP3A 2NZ2A 3GK6A 3GF3A 2QJYC 3AE3C 3GLMA 3Q5RA 4H0LB 1KQFB 3AE7C 2FYNC 5KLIC 1WMKA 1Q90D 4WLWA 4R22B 2BEQD 1Q0AA 3AE9C 3B71A 3O6QA 2BEZF 3RL0g 3AEBC 1NGMB 1EXJA 3D6YA 1OW7A 1PV3A 1ZP0C 5KATA 3RK3E 1IK7A 5KAUA 1PL5A 1EXIA 3SFDC 1YQ3C 4IL6X 3HH0A 1HJ0A 1Q05A 3EZFA 4YTPC 4B0YA 5I44A 3AE8C 2GOVA 2KCUA 3ABVC 1PM6A 4A1MA 3R8JA 2ZT9B 3Q5SA 2OG0A 2QIWA 3AEEC 1OW8A 3T97B 3R4YA 1KQGB 1LX8A 4J2NA 2DG6A 2MKVA 4AYZB 1UIXA 4KT0J 4PV1B 4XFJA 2E74B 1DD4A 1FDOA 4OGQB 5KAWA 2E76C 1KTMA 3EZ9A 5D8CA 1S5LX 2O01J 5E01A 3AEAC 4PV1D 2BOWA 3D71A 2OQQA 2E74D 1BOWA 3Q5PA 5KAVA 2QJPC 4OGQD 1FDIA 1VF5C 2E76D 2JMLA 5D90A 3Q3DA 2V7QJ 1Q06A 2WSFJ 1KMIZ 4LHFA 1DD3A 1AJYA 4R24B 3IN6A 2FBWC 3G9RA 1GMJA 4Z1MH 4AYZA 1Q09A 2YIUC 3LW5J 1D5YA 2IDBA 3AE5C 4I7ZC 5KKZC 3EZ6A 1KILE 2KVVA 2G3AA 2J5UA 3FGAD 3QAOA 2G8YA 5GQQA 4R4EA 3AE4C 1HF9A 1TU3F 2E76B 2E75C 3C8VA 5L8RJ 1R8EA 1Y9BA 4H13C 3Q2YA 4Y28J 1OW6A 2QJKC 4YXDC 3R8KA 2ZHGA 1MKMA 3AEGC 4U7JA 4TT3H 2H89C 3EWKA 1JBGA 4H44C 1K04A 1KORA 2FXPA 1VF5B 3AEDC 1Q08A 3Q1MA 2H88C 4R4MA 4RKUJ 2D2CC 1Q07A 1Y6UA 1PIXA 3AE2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5Y A;  4WLS A;  4R4L A;  3UCS A;  3D6Z A;  4J2N A;  2DG6 A;  5KCB A;  3E0H A;  4AYZ B;  3T97 B;  3D70 A;  3GK6 A;  5KAW A;  3Q5R A;  2J5U A;  5D8C A;  3QAO A;  5GQQ A;  5E01 A;  4R4E A;  2BOW A;  3D71 A;  1R8D A;  4WLW A;  4R22 B;  3Q5P A;  1Q0A A;  5I41 B;  1R8E A;  2OQQ A;  1BOW A;  3Q2Y A;  3B49 A;  5KAV A;  1EXJ A;  3GPV A;  3D6Y A;  3IAO A;  5KAT A;  5KAX A;  5KAU A;  3R8K A;  2VZ4 A;  1JYH A;  2JML A;  5D90 A;  2ZHG A;  3Q3D A;  1EXI A;  3LUR A;  1Q06 A;  3HH0 A;  1DIP A;  3GP4 A;  1Q05 A;  1JBG A;  4B0Y A;  2ZHH A;  5I44 A;  2HVA A;  4R24 B;  2GOV A;  2KCU A;  4A1M A;  3G9R A;  1Q08 A;  3Q1M A;  4R4M A;  3R8J A;  3Q5S A;  4AYZ A;  1Q07 A;  1Q09 A; 
#chains in the Genus database with same CATH topology
 2R5D A;  1ZR4 A;  1SQQ J;  4I2L C;  1USD A;  4WY4 D;  5GTH H;  1VL2 A;  1QL2 A;  1NTM J;  4OGQ C;  3H25 A;  1M7L A;  1KB9 D;  2FXM A;  1SQV G;  5KLV J;  2JWD A;  5KAU A;  3PRJ A;  1RF0 A;  3KPE A;  1HJ0 A;  3VMY A;  4A1M A;  2KCU A;  3R8J A;  1YJ9 P;  3H1I J;  2R44 A;  1H8A A;  1N73 B;  3NTN A;  1DD4 A;  3M9H A;  3HUS C;  1S5L X;  3FX0 A;  3D71 A;  1S4X A;  1SQX E;  3WUU A;  2JML A;  4R24 B;  1SQP E;  4KHX A;  3G3Z A;  1LT1 A;  1D7M A;  3L70 J;  1VQ6 P;  1L0N G;  5KJ7 D;  2HPC B;  2LKM A;  1KYO E;  1OVR A;  3RL0 D;  1NU1 J;  4TT3 H;  2H89 C;  1KOR A;  1KC8 Q;  3CX5 I;  4WY4 B;  4DJG A;  2K9Y A;  1KZU B;  4XA4 A;  1RE4 C;  3A0H H;  2ZYD A;  1MFZ A;  4C46 A;  3CXH D;  2WSF H;  4KJM A;  3MD0 A;  5AW0 B;  2WIT A;  3RBX A;  3LUR A;  1DIP A;  4WVZ A;  2IBZ E;  2E74 C;  1ZXG A;  3TF5 A;  3I56 P;  3SWK A;  2QJY C;  1VQL P;  2ZYA A;  1FZC B;  3PTZ A;  3H1K E;  1PV3 A;  3CPW O;  4DZO A;  2XU6 A;  4IL6 X;  3G4S P;  3BVH A;  2J58 A;  1FJP A;  4K35 A;  2KLV A;  3H32 A;  1LTI C;  1VQ8 P;  1L0L D;  2QE7 H;  1DH3 A;  1H0T B;  2QJP C;  5AW6 B;  3L71 J;  5AW4 B;  3N7N A;  1J1E C;  4W7Y A;  3Q3D A;  5H2F H;  1N7S B;  3NXS A;  3IN6 A;  3HE4 B;  1OVV A;  3KDP B;  4PJ0 E;  4N78 E;  5AVW B;  2W6A A;  3LW5 J;  1EQ7 A;  3CCV P;  1JUN A;  2J5U A;  1W2B O;  3W67 A;  2PFX A;  3CCJ P;  3RL0 B;  1Q86 Q;  2FKW B;  1P84 I;  1PP9 E;  1RE3 A;  1BE3 E;  4GKG A;  1N8R Q;  5CCG C;  4H44 C;  1QGK B;  3BCC D;  3K5B A;  1Q08 A;  5APY A;  1Q07 A;  1FZG A;  2AXT E;  2IFN A;  2OTL P;  1SQB K;  1UII A;  4PD4 D;  5I41 B;  1L0N J;  4H0L D;  4L73 A;  1WT6 A;  1VQ9 P;  1BSH A;  1SFC C;  1LTG C;  2QSI A;  3H1L G;  4PV1 C;  2BCC J;  1NWQ A;  4GDO A;  4C7R A;  1RQV A;  1NYH A;  2H8P D;  1AQ5 A;  1OW7 A;  1NTZ K;  1RE3 C;  1JY2 O;  1Q05 A;  1NTM D;  5CCH A;  1RF1 A;  1YJW P;  2IX7 C;  1EDL A;  1NJI Q;  2FY8 A;  1HGV A;  5KLV D;  1FS0 E;  3V5B A;  5C39 A;  2YO3 A;  1ZN5 A;  3L73 G;  3L37 A;  1QL1 A;  5APV A;  5APX A;  2FBW C;  4U3F G;  3H1I D;  1FZF A;  1IFM A;  1L4A D;  1KIL E;  3QAO A;  5KAI H;  1SQX K;  4HKZ H;  1VQM P;  3L72 E;  2W83 C;  1XTC C;  1HGZ A;  1SQP K;  3AED C;  2IYO A;  3L70 D;  1ZRT E;  2Q1K A;  3SFE C;  3CCQ P;  3AE6 C;  1LNQ A;  2LXC B;  1NU1 D;  4DCK A;  3O6Q B;  3H1H E;  5CJ0 A;  3AEC C;  3CXH E;  1USE A;  1JY2 N;  4H13 D;  4M3L A;  3EQ2 A;  2R3S A;  5B66 E;  1NTK J;  2FYU E;  2YMK A;  3I5C A;  5KLI C;  1WMK A;  1DEB A;  5KAT A;  1PL5 A;  2AEJ A;  1M8O B;  1A02 F;  1CW5 A;  2YKP A;  2H43 A;  3Q5S A;  2QIW A;  1GZL A;  1OW8 A;  4RO0 A;  3TGU G;  4CPG A;  1L2P A;  1UIX A;  1KB9 H;  1QVG O;  4XFJ A;  1JM0 A;  1KTM A;  4QMA A;  5AVX B;  3CI9 A;  5KAV A;  2GUS A;  1M90 Q;  3HRN A;  1FDI A;  2V7Q J;  1L0L E;  2HOD A;  4JYB A;  4WY4 C;  3M0D A;  3TDK A;  2E43 A;  1KIL A;  4UB6 E;  3L71 D;  1LT9 A;  2ZJS E;  3C8V A;  3L72 J;  5BU8 B;  2KZJ A;  1IC2 A;  3WU2 E;  4ASW A;  3L73 J;  5BVZ A;  4W7Z A;  1G2C A;  3ZDM A;  3RGU A;  3D6Z A;  3E0H A;  1NH4 A;  3BCC E;  1FZC C;  1KYO D;  2QRX A;  3M06 A;  1AA0 A;  1NAY A;  3H1H J;  3GPV A;  4H13 B;  1BGY J;  1VQN P;  4PD4 E;  4DCZ A;  2YKO A;  1ZOY C;  3M0D C;  4DT0 A;  2D2C B;  5APU A;  1LTJ A;  4BRY A;  1KQF B;  1BCC J;  1SQQ E;  1BSN A;  1T3J A;  1N7S C;  1KQL A;  1YQ3 C;  2Q5U A;  1JEK A;  1Y47 A;  3O8Z A;  5AW2 B;  1MFT A;  2BCC D;  3M9B A;  1XTG B;  2DG6 A;  2A06 D;  5KJ7 C;  3H1K D;  1NTM E;  3H32 B;  3CWB G;  3RL0 C;  1YBK A;  3AEA C;  5CCH D;  2FYN B;  2Q3E A;  3P32 A;  5KLV E;  2WSS H;  2W90 A;  1JCC A;  4RJT A;  2PGD A;  4JBZ A;  2LXB A;  1EZV G;  3EZ6 A;  1URQ D;  1LTJ C;  3H1I E;  4ZKU A;  1OW6 A;  2KYV A;  2ZHG A;  2KSJ A;  1JBG A;  3WMM 0;  1T2K D;  2B9B A;  3U1C A;  3MHV A;  2KUB A;  2YIU B;  1SQB G;  2WTY A;  2P10 A;  2N9Y B;  5KKZ B;  3L70 E;  4GOD A;  3RBZ A;  4IL6 H;  4IOI H;  1S72 P;  3A7O A;  3SWF A;  3L74 E;  2BAS A;  1JY3 P;  5E79 E;  1OMI A;  1NU1 E;  3JCU H;  3UCS A;  3EZ7 A;  2ZT9 D;  4OH8 B;  3TNU A;  4NPD A;  1PGJ A;  1NTZ G;  3GHG A;  3O6Q A;  2J59 M;  3A0B H;  4D6T G;  2WVR A;  3AE8 C;  1NTK D;  1HWT C;  2MJZ A;  1KQG B;  4JQ0 D;  4AYZ B;  1RF1 B;  4XE5 B;  2GA1 A;  2XDJ A;  1OZH A;  1JY3 N;  1T3U A;  1ZW0 A;  3G9R A;  5CBN A;  4Z1M H;  1URQ B;  3M91 A;  2IDB A;  3V2Q A;  1SQX G;  3CL3 D;  1X22 A;  5APT A;  4R4E A;  2PP6 A;  2E76 B;  3GHG C;  5AVV B;  1SQP G;  3R2P A;  5KLI B;  1ZR2 A;  1L0L K;  1L4A A;  3AEG C;  4U7J A;  3L71 E;  1QX8 A;  5GTI E;  3JC2 2;  1KIL D;  1Y8A A;  3RK2 D;  4WLS A;  2L5G B;  1VF5 D;  4L76 A;  1X8Y A;  4NPE A;  3I55 P;  4C7N A;  2HLO A;  4OWF A;  3L72 D;  1WRG A;  2LR2 A;  2OYH A;  3MP7 B;  3L74 J;  1FE6 A;  1P84 D;  1RF0 C;  2JO1 A;  3L75 J;  1ZRT D;  3MUD A;  3TK1 A;  3S9O A;  2NZ2 A;  1W5C E;  1NVO A;  1Z56 A;  3AE7 C;  3H1H D;  4BWN A;  5AW3 B;  3H1J J;  2W6B A;  1BGY D;  2IBZ G;  2FYU D;  1L0N E;  3S4R A;  1L4A C;  1LGH B;  1DX7 A;  1RHZ B;  2OG0 A;  3F89 A;  3VMX A;  1M56 D;  1PPJ G;  3MIW A;  1BCC D;  1GD2 E;  2BCC E;  5KAW A;  3U59 A;  1NTZ J;  2BOW A;  2A06 E;  3A5T A;  1FOS F;  1ZLL A;  4HYT B;  2FFD A;  2WPQ A;  2P7J A;  2Z5I A;  1KB9 I;  2HOD B;  1YTZ T;  3MUD C;  1D5Y A;  2WSE H;  2Q7C A;  1NTM K;  1BDC A;  3CCU P;  5AW1 B;  5GQQ A;  1SQV J;  4H13 C;  2XZR A;  5KLV K;  1KIL B;  1LT9 B;  4LGD E;  3EWK A;  2FXP A;  1VF5 B;  4ZKP A;  1JCD A;  2ZYG A;  3VTP C;  2D2C C;  2AXC A;  3ITK A;  1HVV A;  1G2C B;  1PP9 G;  4I7Z B;  1BE3 G;  2CPS A;  3EZ2 A;  2R5B A;  1MV8 A;  1OVU A;  2HVA A;  1YIJ P;  2C9N Y;  3MGN A;  2KS1 A;  4W80 A;  3P8C D;  1LWU A;  2YXQ B;  1KYO H;  3GK6 A;  4AQR D;  1GK6 A;  5AW8 B;  2FYN C;  1MZ9 A;  4R22 B;  1LTJ B;  4BRY B;  3AEB C;  3G6E P;  3M9Q A;  5AVZ B;  1DEE G;  3CX5 E;  5TIS E;  3CCS P;  2QG4 A;  3KHU A;  2XND H;  2YMY A;  1NU1 K;  1AVY A;  3LID A;  2KSE A;  1SQQ D;  2MKV A;  1EC5 A;  1NTK E;  2R3C A;  2M0B A;  3SWY A;  5AW9 B;  2HR3 A;  1GL2 A;  1SLQ A;  5APS A;  1VQ7 P;  4AYZ A;  1AV1 A;  2YIU C;  3W68 A;  1NHL A;  5KKZ C;  2WSC H;  2GUV A;  4UB8 E;  3B4S A;  3P7K A;  2L91 A;  5KAF E;  2A45 G;  3BRT B;  3PLN A;  1URQ A;  1K04 A;  2XNX A;  1LJ2 A;  3EFF K;  4R4M A;  3CC7 P;  1FOS E;  2Q6Q A;  2FXO A;  1S1C X;  2KXP B;  3M0A A;  3CMA P;  4PJ0 H;  3FWN A;  3L73 E;  1IK9 A;  2NPS A;  5CCH C;  1RF1 C;  4U3F E;  2JP3 A;  1P84 E;  4JF7 A;  3GLM A;  1GDT A;  3L74 D;  4H0L B;  3TNU B;  2KI7 B;  1Q90 D;  3D6Y A;  1VDF A;  1ZP0 C;  2YXR B;  3VYI A;  1EXI A;  2YKQ A;  2AXT H;  3GHG B;  3L75 D;  3HH0 A;  1URQ C;  1E5W A;  1M1J A;  1QEX A;  1BGY E;  4HJG H;  3EFG A;  4PD4 I;  1GW3 A;  5BU5 A;  4ZMD A;  4EYY Q;  2E76 C;  3FXE A;  1LTT C;  3H1J D;  5B5E E;  1T2K C;  1S5L E;  2P2U A;  2Q9I A;  1BCC E;  2OYO A;  1L0N K;  5D90 A;  4JPZ B;  1NAF A;  3OW2 O;  3VN0 A;  3H1L J;  5DJU B;  3B5N D;  4GOF A;  2ZXE B;  5AVU B;  3HD7 A;  1G1I A;  1J1D B;  1L0L G;  2XV5 A;  4AUW A;  3CC4 P;  1J2J B;  1KD1 Q;  3V2P A;  1L4A B;  1KQS O;  4WB4 A;  4H44 D;  5AVQ B;  1SQV D;  1HTL C;  1K05 A;  1IJD B;  2A45 H;  1R8D A;  4C7N B;  4DOJ A;  1K73 Q;  3BRV B;  2QA4 P;  2OYH B;  4RES B;  2IZ0 A;  1EZV I;  2E75 D;  3BCC G;  4U3F J;  3P8M C;  2JWA A;  5KCB A;  3WUV A;  2N1T A;  1S3J A;  2O01 H;  2OYI B;  1SFC D;  5K5G B;  1JMM A;  2ZFC A;  1FJK A;  3P8C E;  1EXJ A;  1X9V A;  2P58 A;  3TYY A;  2N9B A;  3VMZ A;  4AYC A;  4K3A A;  3V2R A;  5I44 A;  2GOV A;  1HUC A;  3ABV C;  3LIE A;  2WMM A;  2YO2 A;  5AVR B;  2KIK A;  4KT0 J;  1LP1 A;  3KZI E;  3G71 P;  1IFP A;  2WPR A;  1L0N D;  2WT7 A;  2OQQ A;  3CXH H;  3Q5P A;  1KIL C;  4A7P A;  1LT9 C;  5CMZ A;  5B66 H;  3RK2 C;  5TJH A;  1VF5 C;  5GTH E;  2P67 A;  1AFO A;  1KMI Z;  1DD3 A;  1MUU A;  3KXD A;  1OWA A;  4TLF A;  1AJY A;  2W6J H;  3B5N B;  2K37 A;  2VRS A;  1NTM G;  1Q09 A;  2Y0C A;  2FFD B;  1JO5 A;  1GL2 D;  3A2A A;  4I7Z C;  1NTK K;  2DW3 A;  4WBA A;  2PRR A;  3FGA D;  3L36 A;  2G8Y A;  5KLV G;  2WPS A;  3Q2Y A;  4I6M C;  4O9B A;  1M1K Q;  1JTH A;  1PIX A;  1PFI A;  3H1I G;  2JKV A;  3TGU J;  3HE5 A;  2AEM A;  2RMZ A;  3CLQ A;  2WQY C;  1OIP A;  1JY3 O;  2E5Y A;  3CWB E;  2H7H A;  1HBW A;  1IFD A;  2E75 B;  3CC2 P;  1IFI A;  3TSI A;  2W27 A;  3AEF C;  3E1R A;  4UB6 H;  1YIT P;  2WWW A;  3L70 G;  3WU2 H;  1OXZ A;  3RK3 D;  2KS1 B;  2I8D A;  1LWU B;  1HH0 A;  1NGM B;  2NPS D;  1KFM A;  3PJS K;  2QVA A;  2JDI H;  1NU1 G;  1R5S A;  3SFD C;  4B0Y A;  2I1J A;  1PM6 A;  1M57 D;  4ZNC A;  1T6A A;  2ZXX A;  1KYO I;  4IFF A;  3L75 E;  5AVY B;  1FDO A;  3CX5 D;  4PD4 H;  2K9J B;  3VOP A;  3H1J E;  3A0H E;  1VPC A;  2FYZ A;  1GL2 B;  2SPZ A;  1GMJ A;  2FYU K;  1YYC A;  2IBZ I;  3HUS A;  1E79 H;  2KNC A;  1Y9B A;  1NTZ E;  1PGO A;  4GIF A;  4RKU J;  3H1L D;  3HD7 D;  4D6T E;  3AE2 C;  1Q82 Q;  3VP8 A;  2I1K A;  2XKM A;  4H0L C;  3D70 A;  3CCL P;  2KZI A;  3CWB J;  2KOG A;  3CD6 P;  3SSU A;  3L71 G;  3A3Y B;  1IFJ A;  1KV4 A;  1SQV E;  1JYH A;  2B87 A;  3B8E B;  3E1I A;  1K9M Q;  2AEF A;  1A02 J;  3RK3 B;  4R4L A;  5H2F E;  1PGP A;  3V4Q A;  3PH0 A;  1RE4 A;  1VQ4 P;  2NPS B;  3WUT A;  3AE3 C;  1VQ5 P;  1YI2 P;  1YJN P;  3AE9 C;  1Q0A A;  3L73 D;  1CI6 A;  2IFM A;  2KB7 P;  1H89 A;  2N1T D;  3HTK A;  3OA7 A;  4U3F D;  2GM4 A;  2M3E A;  1GU4 A;  2ZT9 B;  1N7S D;  3T97 B;  3R4Y A;  1LX8 A;  2OYI A;  1QVF O;  1M1J B;  2HYN A;  2WZ7 A;  1SQB J;  3E7K A;  1J1D C;  4BXL A;  3EZ9 A;  5E79 H;  3L35 A;  3GG2 A;  2WSF J;  1JOC A;  3USS A;  1SVF A;  2BCC G;  2Y9Z A;  2A06 G;  3H1K G;  4HH2 A;  1SQQ K;  1TU3 F;  1VQO P;  1EDJ A;  2OYH C;  4Y28 J;  1LTA C;  3HD7 B;  3B5N A;  4D6T J;  1FZA A;  1FU1 A;  1U7M A;  1OX3 A;  1U7J A;  3Q1M A;  2OYI C;  4HB1 A;  4OVN F;  2WSE J;  2ZAE B;  3OAK A;  3U1A A;  1PPJ E;  3GF7 A;  5KAX A;  3KQG A;  2QM7 A;  3IAO A;  5CCG A;  1SS1 A;  4GOE A;  2B88 A;  3RK2 B;  2QEX P;  3AE1 C;  3TGU D;  1VQK P;  1LTS C;  5M1B A;  3UIA A;  1SQX J;  2A45 I;  2M8R A;  2N1T B;  5GTI H;  1CSB A;  1SQP J;  1NOH A;  3RK3 E;  2Y0E A;  3B5N C;  1LTB C;  1SFC A;  3LW5 H;  5KAI E;  3CME P;  2FFD C;  4GT1 A;  2K3R A;  1FZE A;  3AEE C;  2M5A A;  5CHX A;  3MZW B;  4N6J A;  3C9I A;  2POH A;  5APQ A;  1BOW A;  1LP1 B;  4OGQ D;  2WT7 B;  1NKN A;  3V4W A;  1IFN A;  1IZN B;  1NTK G;  2E5T A;  3QH9 A;  3AE5 C;  1EDK A;  3BAS A;  5AW5 B;  3CXH I;  2K9J A;  1HF9 A;  2E75 C;  2Z4E A;  5L8R J;  2C0X A;  1YTZ I;  3H6P A;  3CCE P;  3VP9 A;  2H88 C;  2RN0 A;  3PHL A;  1FBM A;  2K1A A;  4EIJ A;  1CZQ A;  1JTH B;  5AVT B;  1LWU C;  4Y99 B;  3H1L E;  3H1K J;  2CPB A;  2WSC J;  1N7L A;  3HE5 B;  1T8Z A;  1JB0 J;  1KB9 E;  3V6I A;  2VZ4 A;  2IPP A;  1AQT A;  2QJK B;  3KYQ A;  1RQU A;  2M3B A;  3CWB D;  3GF3 A;  3L72 G;  1H88 A;  2BEQ D;  3B71 A;  1OFC X;  1SQV K;  2CK3 H;  1GL2 C;  4I1L A;  4YTP C;  2KP8 A;  4L74 A;  4EOT A;  3NMD A;  1S9K D;  1N73 A;  2P1J A;  1EZV D;  1JY2 P;  1ZV8 A;  1BDD A;  4OGQ B;  1PP9 J;  2OGU A;  1BE3 J;  2E74 D;  3H1H G;  5KTB A;  1BGY G;  3T97 A;  3F5H A;  2FYU G;  4LHF A;  4IFD K;  1JNM A;  2Y0D A;  2C9L Y;  3BAT A;  1GK4 A;  1JMB A;  1SQB D;  3CX5 H;  5TIS H;  2HPC A;  4L75 A;  3CCM P;  1BCC G;  4YXW H;  2OTJ P;  1R8E A;  3HUS B;  3R8K A;  2O01 N;  2KNC B;  1N2D C;  4WY4 A;  4NPF X;  3RK3 C;  3VMA A;  2K88 A;  1N73 C;  3IFM A;  3JSV C;  2NPS C;  1KN7 A;  1ZME C;  1NTZ D;  2D2C D;  2IEF A;  1Q7Y Q;  4D6T D;  3NFQ A;  2Z5H A;  1U57 A;  2ZT9 C;  3GP4 A;  4UB8 H;  2R32 A;  2ZHH A;  5DJT B;  1NO4 A;  1M1J C;  2B87 B;  1YHQ P;  5KAF H;  5CCG D;  1FZC A;  1R5L A;  2PAJ A;  1W2E A;  3TGU E;  3FWL A;  2Q3I A;  4MN4 C;  2C0W A;  3L4F A;  2V7Q H;  3RL0 g;  3B49 A;  2ITA A;  1AVO A;  1IK7 A;  4ASV A;  3EZF A;  3FXD A;  1CI6 B;  1X0T A;  2ZVN B;  3HTK B;  4J2N A;  1SQX D;  1FZB A;  2E74 B;  1H0T A;  4JYC A;  5D8C A;  2IYP A;  1GU5 A;  2O01 J;  4PV1 D;  5APW A;  2QJY B;  1SQP D;  3HD7 C;  1N7S A;  2JEE A;  5AVS B;  3HE4 A;  1P84 H;  1GW4 A;  1PGQ A;  4IL6 E;  4LC1 A;  4B86 A;  3GW6 A;  2O3J A;  5KJ7 A;  1S2E A;  3QWO C;  1SQQ G;  3II6 A;  2KVV A;  2G3A A;  2Y9Y A;  3JCU E;  4N3Y B;  1GTW A;  4YPC A;  1G1J A;  1FDM A;  4YXD C;  2QJP B;  1MKM A;  2YNY A;  4LLH A;  1J1E B;  4WWI A;  2FYU J;  3PP5 A;  1KFN A;  5B5E H;  1Y6U A;  1IO4 A;  2HFE D;  2O1J A;  1S5L H;  3A0B E;  1YQ4 C;  2W8Z A;  2N1T C;  2WPV B;  3S1K A;  1Q81 Q;  3GMA A;  2OAR A;  2V4H A;  2IBZ D;  2KK7 A;  1HJB A;  1RH6 A;  4EDF A;  4H44 B;  3CCR P;  1X79 B;  2OTK E;  4EI2 A;  1PPJ D;  2UWJ E;  1FC2 C;  3Q5R A;  2KLU A;  3IR9 A;  5CBO A;  3C1L A;  4WLW A;  1L0L J;  2BEZ F;  1RH5 B;  2IZ1 A;  2JJL A;  2E42 A;  2HG5 D;  5CJ4 A;  1PZQ A;  1Q2N A;  1QLE D;  1VQP P;  1SFC B;  2RH0 A;  2JR8 A;  4PV1 B;  3MTU E;  2B89 A;  1S9K E;  2M5A B;  1EZV E;  5E01 A;  3L74 G;  1RY3 A;  3V2N A;  2QM8 A;  2ZVO B;  1FAV A;  4N78 D;  2E76 D;  1Q06 A;  5AW7 B;  3L75 G;  2O1K A;  3BCC J;  1SP4 A;  4Y99 C;  4IFM A;  3N4X A;  1PP9 D;  1BE3 D;  3AE4 C;  3H1J G;  1SQB E;  3IF4 A;  2QJK C;  5EFW B;  2NRG A;  3KZI H;  2RKL A;  1NKZ B;  3OJA B;  1K8A Q;  1N86 A;  1EDI A; 
#chains in the Genus database with same CATH homology
 4WLS A;  3D6Z A;  1VF5 D;  2K9Y A;  4H44 D;  3E0H A;  4H0L C;  1S1C X;  1YQ4 C;  3D70 A;  1ZRT E;  1ZME C;  2WPV B;  2WSE J;  2P10 A;  3SFE C;  2D2C D;  4I7Z B;  1K05 A;  1VL2 A;  2WQY C;  2IEF A;  2WSC J;  3GMA A;  3GF7 A;  1R8D A;  3AE6 C;  5KAX A;  5I41 B;  1JB0 J;  4H0L D;  3EZ2 A;  3GPV A;  3IAO A;  2E75 B;  2VZ4 A;  1JYH A;  4H13 B;  3LUR A;  1RH6 A;  1U57 A;  2ZT9 C;  1DIP A;  3GP4 A;  3AEC C;  3AEF C;  2ZHH A;  2HVA A;  2JO1 A;  2E75 D;  3AE1 C;  4DCZ A;  2QSI A;  1OMI A;  4H13 D;  4H44 B;  1ZOY C;  4PV1 C;  2E74 C;  4GDO A;  2YMK A;  4R4L A;  3UCS A;  3S9O A;  3EZ7 A;  4OGQ C;  5KCB A;  2ZT9 D;  2D2C B;  5M1B A;  3B49 A;  3H25 A;  1RQU A;  1RQV A;  1NYH A;  2JP3 A;  2NZ2 A;  3GK6 A;  3GF3 A;  2QJY C;  3AE3 C;  3GLM A;  3Q5R A;  4H0L B;  1KQF B;  3AE7 C;  2FYN C;  5KLI C;  1WMK A;  1Q90 D;  4WLW A;  4R22 B;  2BEQ D;  1Q0A A;  3AE9 C;  3B71 A;  3O6Q A;  2BEZ F;  3RL0 g;  3AEB C;  1NGM B;  1EXJ A;  3D6Y A;  1OW7 A;  1PV3 A;  1ZP0 C;  5KAT A;  3RK3 E;  1IK7 A;  5KAU A;  1PL5 A;  1EXI A;  3SFD C;  1YQ3 C;  4IL6 X;  3HH0 A;  1HJ0 A;  1Q05 A;  3EZF A;  4YTP C;  4B0Y A;  5I44 A;  3AE8 C;  2GOV A;  2KCU A;  3ABV C;  1PM6 A;  4A1M A;  3R8J A;  2ZT9 B;  3Q5S A;  2OG0 A;  2QIW A;  3AEE C;  1OW8 A;  3T97 B;  3R4Y A;  1KQG B;  1LX8 A;  4J2N A;  2DG6 A;  2MKV A;  4AYZ B;  1UIX A;  4KT0 J;  4PV1 B;  4XFJ A;  2E74 B;  1DD4 A;  1FDO A;  4OGQ B;  5KAW A;  2E76 C;  1KTM A;  3EZ9 A;  5D8C A;  1S5L X;  2O01 J;  5E01 A;  3AEA C;  4PV1 D;  2BOW A;  3D71 A;  2OQQ A;  2E74 D;  1BOW A;  3Q5P A;  5KAV A;  2QJP C;  4OGQ D;  1FDI A;  1VF5 C;  2E76 D;  2JML A;  5D90 A;  3Q3D A;  2V7Q J;  1Q06 A;  2WSF J;  1KMI Z;  4LHF A;  1DD3 A;  1AJY A;  4R24 B;  3IN6 A;  2FBW C;  3G9R A;  1GMJ A;  4Z1M H;  4AYZ A;  1Q09 A;  2YIU C;  3LW5 J;  1D5Y A;  2IDB A;  3AE5 C;  4I7Z C;  5KKZ C;  3EZ6 A;  1KIL E;  2KVV A;  2G3A A;  2J5U A;  3FGA D;  3QAO A;  2G8Y A;  5GQQ A;  4R4E A;  3AE4 C;  1HF9 A;  1TU3 F;  2E76 B;  2E75 C;  3C8V A;  5L8R J;  1R8E A;  1Y9B A;  4H13 C;  3Q2Y A;  4Y28 J;  1OW6 A;  2QJK C;  4YXD C;  3R8K A;  2ZHG A;  1MKM A;  3AEG C;  4U7J A;  4TT3 H;  2H89 C;  3EWK A;  1JBG A;  4H44 C;  1K04 A;  1KOR A;  2FXP A;  1VF5 B;  3AED C;  1Q08 A;  3Q1M A;  2H88 C;  4R4M A;  4RKU J;  2D2C C;  1Q07 A;  1Y6U A;  1PIX A;  3AE2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...