1EXIA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
b'ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exiA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exiA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exiA01
4R4LA 1EXIA 3GP4A 5KAVA 1Q06A 5KCBA 3Q1MA 4WLSA 4WLWA 3D70A 1Q0AA 4R24B 3Q2YA 3D6YA 2ZHGA 3B49A 5I44A 3HH0A 1R8EA 2GOVA 4R4EA 2DG6A 1DIPA 5GQQA 2ZHHA 2BOWA 1Q09A 1JYHA 2VZ4A 3Q5RA 3IAOA 2JMLA 4B0YA 3GPVA 4A1MA 5I41B 2OQQA 3UCSA 1Q05A 3GK6A 4J2NA 3D6ZA 2J5UA 5KATA 3Q5SA 5KAWA 5D8CA 2HVAA 3D71A 3Q5PA 2KCUA 1Q07A 3E0HA 5KAUA 1JBGA 1Q08A 4AYZB 1R8DA 3R8JA 1D5YA 5D90A 3T97B 3QAOA 4R4MA 5KAXA 3LURA 3Q3DA 1EXJA 1BOWA 3R8KA 4AYZA 3G9RA 5E01A 4R22B
chains in the Genus database with same CATH superfamily
2NPSD 2ZXEB 1WRGA 4JQ0D 2P7JA 2ZJSE 1YJWP 4BXLA 1OVVA 1ZMEC 3CD6P 1IC2A 3GHGB 1FDIA 3CI9A 4RO0A 1SQXJ 2PAJA 4L74A 2QM8A 3SFDC 4H0LD 2AEMA 3L70G 2QM7A 2JKVA 1BGYD 3AE6C 1Q81Q 3GP4A 1XTCC 2YXQB 3AE8C 1USDA 1DEBA 4GOFA 1KC8Q 2IBZD 2JWAA 3EZ6A 1NTME 5AVRB 3CXHD 5KAVA 1NU1J 2C9LY 1G2CB 4PJ0H 3B49A 1MUUA 1NTMD 5E79H 4GOEA 1SQVE 2QG4A 1FJPA 2QRXA 2J59M 3CCEP 4JYBA 4CPGA 1SQQJ 4WY4A 3CCLP 3M0DA 1M1JA 3PLNA 1KYOI 3B71A 4PV1D 3S9OA 1RE3C 3RK3B 2WT7B 4D6TG 3HE4B 3VMYA 1SQVJ 2N1TA 1FC2C 2P58A 4NPEA 3PTZA 1S4XA 2KZIA 2YO3A 3T97A 1NKNA 1VQNP 2IDBA 1L0LD 1JYHA 3GMAA 1HJ0A 1BE3E 3CWBJ 5GTIE 1RF1B 3TGUD 3FX0A 1BE3D 1X22A 1YHQP 2KS1B 2K9YA 4L76A 4EI2A 4KT0J 2XZRA 1SQXK 5I44A 1RF0A 3RK2C 3L71D 2VZ4A 3L35A 2WSFH 1P84H 4ASVA 3A0BE 5TISH 1SQPG 3L74D 2AXCA 1CW5A 1LTTC 5APSA 3NTNA 4H13C 4EOTA 1YTZI 3L72E 1U57A 1Y8AA 1FZEA 1GL2C 1QEXA 4WWIA 3V2RA 4JF7A 5KKZB 3L72D 5CCGA 1QGKB 1EDIA 1NU1K 1PP9E 4DZOA 2LXCB 4H44B 3G9RA 1M1JC 2NPSB 2OYIA 2FXMA 1PP9D 4DJGA 1Q09A 3IR9A 2N1TC 2P67A 5KTBA 1JY3P 3GHGA 3B5ND 1G1IA 4H0LB 4AYZB 1SQQK 1EDJA 4NPDA 2AXTE 2H89C 5EFWB 3V6IA 2E74C 2JJLA 1L2PA 2R32A 4OWFA 2OTJP 1SQVK 2Q5UA 2XKMA 3A3YB 1FU1A 3LURA 2IZ0A 1BSNA 3KXDA 1Y9BA 1EZVI 1G2CA 1OIPA 1Q05A 1NVOA 2Y0DA 1OW8A 3WUVA 2LKMA 2QJYB 1QL1A 3H32A 3CL3D 1YJNP 2NZ2A 4H13D 1HBWA 1W5CE 4ZMDA 1X8YA 2VRSA 3TNUB 2YIUB 1FOSE 1JTHB 4PV1B 2Z5IA 1NAYA 2WPRA 3BCCG 5AVXB 2B89A 1KZUB 2G3AA 1ZP0C 2WT7A 1H8AA 3HE4A 4W7ZA 1KN7A 3U1AA 1SQXG 2OYIC 1JEKA 3KYQA 4Y99B 3VYIA 1URQC 3H1IE 2W8ZA 1X0TA 1SFCC 2N9YB 2OARA 2WPVB 1KTMA 2K1AA 3L75J 3H1ID 2KCUA 1PGOA 1RQUA 1RF1A 3LIEA 2E74D 3BRTB 3H1LE 5AW5B 2KOGA 1U7JA 4WLWA 2QSIA 1BCCE 2WQYC 4U3FJ 1FJKA 4HYTB 2ZFCA 3CXHH 1NU1G 4PJ0E 1VQLP 1FZFA 1L0NJ 1J2JB 1E5WA 2I1JA 2YO2A 4PD4D 5AVZB 5K5GB 3H1LJ 2XU6A 1D7MA 2G8YA 1LT9A 1NKZB 1OZHA 1Q0AA 3MD0A 1J1DC 3V2QA 4Y28J 3M0AA 1SQQG 2POHA 3H1KE 1DD3A 4KJMA 2A45H 3A7OA 4OH8B 1FZBA 1PGJA 2QEXP 1FAVA 1LTJB 3SFEC 1EDKA 5CJ0A 3RGUA 3G6EP 4NPFX 4IL6X 2FYNC 1UIXA 3H1KJ 1MFTA 4W7YA 1S9KE 3B5NB 3RL0g 3CWBG 2B87B 1NWQA 1WMKA 4AYZA 2ZVOB 1URQD 2JR8A 1S9KD 1SFCD 2OTLP 1JOCA 3CC4P 5GQQA 2K88A 1W2BO 2I8DA 1T2KC 2IFNA 5AVWB 3CCVP 3A5TA 3VOPA 2QE7H 3P8MC 3S4RA 2R5DA 4R4LA 2WSEH 4XE5B 4DCZA 3A0BH 1JY3O 1E79H 1VQ9P 4AUWA 1SQPD 5I41B 1EZVG 3E7KA 2W27A 1Y47A 1JNMA 2WSFJ 3KQGA 1NAFA 4Z1MH 1KORA 1VF5C 4I6MC 1LT9C 2Q3IA 1L4AA 1N7LA 3G71P 2XDJA 5KJ7D 1L0NK 5APUA 3TNUA 2OYHB 4A1MA 1JTHA 4TLFA 5KLVJ 4J2NA 3F89A 4HB1A 1USEA 4U7JA 1NGMB 3H1JE 3GLMA 2W83C 3VMXA 5APQA 1LWUA 2GOVA 4I7ZC 2CPBA 3H1JD 2FXOA 4AYCA 2E76D 2O3JA 1TU3F 1A02F 2AXTH 1AQ5A 1FZCB 4R22B 3I56P 1JO5A 1IFNA 2HODB 3BRVB 2RN0A 3VTPC 1MV8A 2WZ7A 1HF9A 3PH0A 3AE2C 2E75C 5C39A 2L5GB 1ZRTE 3D6ZA 3CX5E 2R3SA 4IL6E 2C9NY 1LJ2A 2IZ1A 2QVAA 2Y0EA 2PRRA 3ZDMA 1P84I 1ZRTD 3I55P 1W2EA 3CX5D 3AEAC 1NTZJ 3O8ZA 4YXWH 1GTWA 1QL2A 3HD7C 1LGHB 1BSHA 2BEZF 3FGAD 3H1HJ 1M90Q 2YKOA 5KLIB 2M3EA 1JBGA 1GK4A 4EIJA 1KB9E 1L4AC 2WSSH 1N73C 4C46A 1OW6A 4OGQC 1KB9D 1RY3A 4ZNCA 1LTJA 1KQFB 2O01J 3WUUA 3VN0A 1BGYE 2KZJA 1J1EC 1A02J 1K8AQ 2KUBA 3E1RA 2N9BA 2Y9YA 2ZVNB 1LWUC 1GDTA 3B5NA 3L75G 1JY2N 3ITKA 3BVHA 1M1KQ 1OVRA 2P2UA 5KLVK 1NTKE 2IBZE 5CJ4A 4M3LA 3S1KA 1GW3A 1YJ9P 4UB6E 1BGYJ 4U3FG 5KATA 5D8CA 3FWLA 3CXHE 1NTKD 2K37A 1PL5A 3EZ9A 1QVGO 1L0NG 2D2CD 3RL0D 1SQBE 3AE9C 5APVA 4PD4H 3O6QB 3WUTA 1NOHA 1AJYA 2E75D 3W67A 4LHFA 1U7MA 1SQBD 2HVAA 2QA4P 1S2EA 4K3AA 1K73Q 1GU5A 1NTMJ 3KPEA 1FZGA 5H2FH 1N7SD 5KAFH 3AEGC 3GPVA 2OYHA 2WPQA 3SWKA 5KAIH 4IFDK 3OJAB 1NTZK 1L0LE 3H1KG 2ZT9C 3EQ2A 3TGUE 2OG0A 3MUDA 3GK6A 2E76B 3AEEC 3L73E 1JMBA 3L71E 1LT1A 1L0LJ 2FYUE 1AQTA 3AE5C 3AEFC 1FZCA 3L73D 3L74E 2BOWA 1KILA 1M57D 3TGUJ 2FYUD 2IFMA 3C9IA 1BE3J 4IFMA 3IFMA 2KI7B 1FDOA 3PRJA 3L71J 2QJPB 2KK7A 5TJHA 2FY8A 2JO1A 3L74J 3NFQA 1HGVA 2WSEJ 3OA7A 4DOJA 3RBZA 2WITA 5AVVB 2KNCB 1OXZA 5KLVG 2W6AA 4WY4C 1DEEG 1AV1A 3B4SA 3M0DC 2FFDB 1MKMA 2E43A 3L72J 3P8CD 1NO4A 4XFJA 1NTMK 4JPZB 4YPCA 4W80A 1SQBK 1PP9J 2A06G 5CBOA 2ZT9D 1N2DC 3FXEA 1R5SA 2KSJA 3AE1C 2Q6QA 3W68A 3MUDC 1M8OB 5BU8B 1YIJP 2FKWB 3N4XA 1FOSF 3BATA 3HUSB 2AEFA 1GZLA 3QWOC 2IPPA 3PHLA 4WBAA 1RH5B 2QJKB 2ZYGA 2E42A 3R8KA 2L91A 2D2CB 2XNXA 1RF0C 1KILC 3RL0B 3RK2D 1XTGB 1IK9A 3H25A 4C7NB 3CX5H 3M9HA 4IL6H 1NTZG 2GUSA 5GTHE 3M9BA 1L0LK 1S1CX 2YMKA 3H1HG 2WTYA 3JCUH 2Z4EA 1BDCA 3EFFK 2C0XA 2PFXA 2FXPA 3ABVC 1H0TB 1GL2D 1PPJE 1M56D 2BCCG 1N7SB 2Q7CA 5CCHA 2WVRA 3R2PA 5CCGC 1PPJD 1KB9H 2Q3EA 2B9BA 1S3JA 4WY4D 1KYOH 2E5YA 1H88A 1HGZA 5CBNA 3V2NA 3V2PA 4GIFA 2N1TD 3GHGC 3CCSP 2HPCB 4JBZA 3L70D 2OGUA 3BASA 3II6A 3HTKB 4LGDE 5APXA 1VQ6P 2KS1A 4UB6H 1T3JA 3H1IJ 4PD4E 3M91A 3CC7P 2W6JH 1HWTC 5CMZA 1EQ7A 2KP8A 1IFJA 2IBZG 1ZXGA 2NRGA 1DH3A 1Q7YQ 1OFCX 3NMDA 3D6YA 2WWWA 1BCCJ 1NTMG 4YXDC 5H2FE 1AFOA 5KAFE 3USSA 5AW2B 5AVTB 4D6TE 1LP1B 1SQVG 2KNCA 5KAIE 3CCRP 1PGQA 1VQ8P 5CCHC 1R8EA 1ZLLA 4D6TD 2NPSA 2UWJE 1IFIA 2A45G 3RK3C 1LNQA 1GMJA 1HJBA 2ZAEB 4TT3H 1DD4A 5BVZA 1VQ7P 2KLUA 3CMAP 3R8JA 2QIWA 3V5BA 2Q9IA 4WLSA 3EZ2A 3CCUP 3CCQP 1VQKP 1RF1C 3EFGA 2GA1A 3HUSA 1NJIQ 1HUCA 3TGUG 3GF7A 5L8RJ 3IF4A 3MHVA 1ZR4A 4GKGA 5D90A 1RE4A 2HG5D 1BE3G 1PGPA 1SQPE 1GK6A 2ZHGA 1K05A 2FBWC 2Q1KA 3L71G 1Z56A 4C7NA 1IFPA 4RKUJ 3QH9A 3JC22 1SVFA 3AEDC 2M8RA 4H13B 3Q3DA 1YQ4C 2JWDA 4BWNA 2OYOA 1SQPJ 1KD1Q 4N78E 1GL2B 2HR3A 3MIWA 5B5EE 1DIPA 4HH2A 3VP9A 1H0TA 2WSCH 4O9BA 2JDIH 4N78D 2YKQA 1N7SA 1RHZB 4IFFA 5KKZC 3L72G 1Q07A 3CLQA 2ZXXA 3CC2P 1M1JB 2V4HA 4H44C 1QVFO 1Q06A 1HH0A 3OW2O 2NPSC 2RMZA 3A0HE 2LXBA 1KFMA 1PP9G 3E1IA 2N1TB 5AW8B 1JB0J 5APWA 2HPCA 2HFED 3U59A 3T97B 4H0LC 2E74B 1IK7A 1Q82Q 3PJSK 3H1JJ 2KYVA 3HTKA 4C7RA 1T6AA 4B0YA 1T2KD 3AE4C 2LR2A 2ZYAA 1RE4C 1ZN5A 1S5LX 4L73A 1EXJA 3RBXA 1ZW0A 3JCUE 1H89A 2MKVA 5GTHH 4B86A 1JUNA 3LW5H 2V7QH 1HVVA 5AVUB 2H43A 2HLOA 3TYYA 5KAUA 2QJYC 1VF5D 1VPCA 2PP6A 3BCCE 4EDFA 2P10A 3U1CA 1VQMP 1KYOE 2BCCD 1LP1A 1JM0A 2YIUC 3AEBC 3BCCD 2P1JA 2KLVA 2RH0A 3I5CA 4PV1C 1KYOD 1RE3A 3UCSA 3AE3C 3IN6A 4IOIH 3HRNA 1Q86Q 1SQXD 1X79B 2OYIB 5CHXA 4H44D 1SQPK 2IYPA 4A7PA 1FE6A 4Y99C 3SWYA 3GG2A 2B87A 1URQB 1AVYA 5APYA 5AW1B 1SFCB 2H7HA 3P32A 4KHXA 2JMLA 3C1LA 4BRYB 2J5UA 3PP5A 5AVSB 3C8VA 4ZKUA 3AE7C 2XNDH 3H1IG 4ASWA 4XA4A 2M5AB 1NU1E 1WT6A 1LTAC 4HJGH 2K3RA 2YXRB 2Y9ZA 1NU1D 1NTKJ 3H1LG 2H88C 1BCCG 3CCJP 1KFNA 2DW3A 3E0HA 1IZNB 3CX5I 3M9QA 1SQQE 2I1KA 1YTZT 3KHUA 3JSVC 3HD7D 1J1DB 1Y6UA 1SQBJ 5AW3B 4JYCA 3WU2H 1SQQD 1GL2A 3OAKA 3H32B 5BU5A 3Q5SA 1FDMA 1VQPP 1QLED 1L4AD 1SQVD 1S5LE 3LIDA 1KB9I 4OGQD 1LTJC 1SS1A 3NXSA 2YNYA 2K9JB 2YMYA 1OMIA 5AVQB 3CWBE 3KZIH 2FYNB 2CK3H 1AVOA 1YBKA 3CWBD 1JY2O 1R5LA 3B5NC 1X9VA 1N8RQ 1RQVA 1KMIZ 4YTPC 2R44A 2HODA 2O1JA 4GT1A 2IBZI 2KVVA 3VMAA 1LTSC 1OVUA 3CXHI 1JCDA 3L73J 1EXIA 1EZVE 2MJZA 3F5HA 2FYUJ 4I2LC 3UIAA 3V4QA 3FWNA 1CI6B 1EZVD 4QMAA 1UIIA 1FZAA 2KSEA 3G4SP 1VF5B 5B66E 1LT9B 5KAXA 2BEQD 5B5EH 1NTKK 3P8CE 2A45I 4EYYQ 1KQGB 2M3BA 2OYHC 2O1KA 1ZOYC 2BASA 3R4YA 2WPSA 2IYOA 2WSCJ 3GF3A 3A0HH 3L37A 2E5TA 4I7ZB 2ZHHA 5AW7B 1URQA 3H1JG 1SFCA 3KDPB 4BRYA 4UB8H 1IFDA 4R4MA 2CPSA 2KB7P 1FZCC 2IX7C 1M7LA 3VP8A 2M5AA 1GW4A 1LTIC 2JP3A 5AW4B 1GD2E 4AQRD 2KIKA 2KXPB 1MZ9A 2E75B 3O6QA 5KAWA 2H8PD 1R8DA 3QAOA 2IEFA 2PGDA 3CCMP 2AEJA 1Q90D 3D70A 5DJUB 3HD7B 3EWKA 2DG6A 1LX8A 3Q5RA 1DX7A 3A2AA 5KJ7A 1AA0A 5AVYB 3LW5J 2V7QJ 5KLIC 3TSIA 1L4AB 2FYUK 2O01H 2GUVA 1N73B 4OGQB 4DCKA 4R4EA 3MZWB 3FXDA 3L70E 1CSBA 1T3UA 2W90A 1J1EB 5M1BA 1YITP 3L75E 2K9JA 3HE5B 1SLQA 3P7KA 1T8ZA 1HTLC 1G1JA 1LWUB 3L75D 1BGYG 1NHLA 4U3FE 1K9MQ 3L70J 3V4WA 2YKPA 1FS0E 1BDDA 1L0NE 4U3FD 5AW0B 2GM4A 1FBMA 1KILE 4ZKPA 2O01N 1NTKG 1L0ND 1CZQA 1KQLA 1KILD 2Y0CA 4I1LA 2OTKE 3H1LD 1IO4A 1IJDB 3IAOA 1LTBC 1BCCD 4N3YB 1JY3N 5E79E 1SQBG 3WU2E 4RJTA 1CI6A 2R5BA 1K04A 1Q08A 2HYNA 3MGNA 2XV5A 4L75A 3CPWO 3SWFA 2FFDA 5KJ7C 4K35A 5CCGD 2OQQA 1ZV8A 1S5LH 2JEEA 3KZIE 2R3CA 5AW9B 1QX8A 3M06A 4RESB 3H1KD 3MTUE 4D6TJ 2ZT9B 1KQSO 2C0WA 1VQOP 3WMM0 2FYZA 1L0LG 3SSUA 2E76C 4GODA 1NH4A 1LTGC 1ZR2A 5AW6B 3CMEP 4WB4A 1D5YA 5KCBA 3TK1A 1YQ3C 1RH6A 1KV4A 5DJTB 5GTIH 3RK2B 3L73G 4LC1A 1OW7A 1IFMA 2FYUG 1OX3A 1JMMA 4PD4I 1P84E 3L74G 5TISE 5APTA 1YYCA 1JY2P 1P84D 4N6JA 4OVNF 4MN4C 4R24B 3Q2YA 2QJPC 1PZQA 3HD7A 5KLVE 3VMZA 5B66H 3TF5A 4DT0A 5KLVD 4WY4B 3RK3E 2B88A 5CCHD 1PFIA 2FFDC 1N73A 3HH0A 1PV3A 3RK3D 1PIXA 1YI2P 2A06E 3N7NA 2Z5HA 2ITAA 1VQ4P 2ZYDA 3HE5A 2A06D 4LLHA 1BOWA 3H6PA 5E01A 4UB8E 1OWAA 1EC5A 1GU4A 1NYHA 4GDOA 1MFZA 1N86A 3HUSC 1VL2A 2SPZA 2W6BA 2QJKC 1NTZE 3EZFA 1KILB 1PM6A 3L4FA 3Q1MA 2D2CC 2WMMA 3RL0C 3GW6A 3AECC 4WVZA 3H1HE 1NTZD 3B8EB 1VDFA 3Q5PA 3H1HD 1S72P 2BCCE 2J58A 1JCCA 3EZ7A 4HKZH 1VQ5P 2M0BA 3L36A 1EDLA 3TDKA 1SQXE 2RKLA 1N7SC 3D71A 1PPJG 1Q2NA 3K5BA 1SP4A 2BCCJ 3G3ZA 3MP7B 3BCCJ
chains in the Genus database with same CATH topology
4R4LA 1EXIA 2QIWA 1Q90D 1MKMA 3AEAC 4WLSA 4WLWA 3D70A 2QSIA 2WQYC 3HH0A 3EWKA 2DG6A 4DCZA 1PV3A 2IDBA 1ZMEC 1JYHA 3GMAA 1LX8A 3EZ2A 3Q5RA 1FDIA 1PIXA 2BEZF 3AEGC 1HJ0A 3GPVA 4B0YA 3FGAD 2H88C 5I41B 2OQQA 3AE4C 3SFDC 4XFJA 3LW5J 2V7QJ 3GF7A 4H0LD 5KLIC 1JBGA 5L8RJ 2WSFJ 1S5LX 3E0HA 1VF5B 5D90A 3AE6C 4Z1MH 1KORA 1VF5C 5KAXA 2BEQD 3LURA 1EXJA 1BOWA 2K9YA 2ZT9D 5E01A 2G8YA 3GP4A 2ZT9B 3AE1C 4KT0J 4OGQB 1Q0AA 1OW6A 2ZT9C 1KQGB 2ZHGA 4OGQC 5I44A 1Y9BA 1Y6UA 1K05A 2FBWC 3AE8C 4R4EA 2MKVA 1KQFB 2VZ4A 2OG0A 2O01J 1NYHA 4Y28J 4A1MA 1ZOYC 4GDOA 5M1BA 3GK6A 1Q05A 2E76B 3R4YA 1OW8A 4RKUJ 4J2NA 2E76C 3Q5SA 1VL2A 1DD3A 5KAUA 3AEEC 2QJYC 2WSCJ 1VF5D 3AEDC 3GF3A 2NZ2A 4H13D 4U7JA 3EZ6A 4H13B 3Q3DA 2QJKC 1NGMB 1YQ4C 2P10A 4H13C 3R8KA 3GLMA 3EZFA 2D2CB 1D5YA 5KAVA 5KCBA 1YQ3C 3AE5C 1PM6A 1RH6A 3AEFC 3Q1MA 2D2CC 4OGQD 3SFEC 3D6YA 4I7ZB 3B49A 1U57A 3AECC 2GOVA 4I7ZC 2YIUC 3AEBC 3H25A 1DIPA 2ZHHA 2BOWA 4PV1B 1OMIA 4YXDC 1OW7A 4PV1C 2G3AA 2E76D 3UCSA 1ZP0C 4IL6X 3AE3C 5KATA 2FYNC 1UIXA 5D8CA 1KILE 3IN6A 5KKZC 1TU3F 3Q5PA 1Q07A 2YMKA 1S1CX 3RL0g 3EZ7A 1PL5A 4H44D 1FDOA 4R4MA 3EZ9A 1WMKA 4H44B 2D2CD 3G9RA 4AYZA 4R22B 4H44C 1Q06A 1RQVA 2FXPA 4R24B 3Q2YA 2QJPC 3ABVC 3AE9C 1HF9A 2JO1A 2JP3A 1KMIZ 1AJYA 1R8EA 4YTPC 3B71A 5GQQA 4PV1D 3S9OA 2E75D 1Q09A 3IAOA 2WPVB 2E75B 1KTMA 2JMLA 3AE2C 4LHFA 2WSEJ 2E75C 3O6QA 1GMJA 2KVVA 1ZRTE 3D6ZA 5KAWA 2J5UA 2HVAA 1JB0J 1K04A 4TT3H 3D71A 3C8VA 2KCUA 1RQUA 1DD4A 3AE7C 1Q08A 4H0LB 4AYZB 1R8DA 3T97B 4H0LC 2E74D 3QAOA 2IEFA 3RK3E 2E74B 2H89C 1IK7A 3R8JA 2E74C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4L A;  1EXI A;  3GP4 A;  5KAV A;  1Q06 A;  5KCB A;  3Q1M A;  4WLS A;  4WLW A;  3D70 A;  1Q0A A;  4R24 B;  3Q2Y A;  3D6Y A;  2ZHG A;  3B49 A;  5I44 A;  3HH0 A;  1R8E A;  2GOV A;  4R4E A;  2DG6 A;  1DIP A;  5GQQ A;  2ZHH A;  2BOW A;  1Q09 A;  1JYH A;  2VZ4 A;  3Q5R A;  3IAO A;  2JML A;  4B0Y A;  3GPV A;  4A1M A;  5I41 B;  2OQQ A;  3UCS A;  1Q05 A;  3GK6 A;  4J2N A;  3D6Z A;  2J5U A;  5KAT A;  3Q5S A;  5KAW A;  5D8C A;  2HVA A;  3D71 A;  3Q5P A;  2KCU A;  1Q07 A;  3E0H A;  5KAU A;  1JBG A;  1Q08 A;  4AYZ B;  1R8D A;  3R8J A;  1D5Y A;  5D90 A;  3T97 B;  3QAO A;  4R4M A;  5KAX A;  3LUR A;  3Q3D A;  1EXJ A;  1BOW A;  3R8K A;  4AYZ A;  3G9R A;  5E01 A;  4R22 B; 
#chains in the Genus database with same CATH topology
 2NPS D;  2ZXE B;  1WRG A;  4JQ0 D;  2P7J A;  2ZJS E;  1YJW P;  4BXL A;  1OVV A;  1ZME C;  3CD6 P;  1IC2 A;  3GHG B;  1FDI A;  3CI9 A;  4RO0 A;  1SQX J;  2PAJ A;  4L74 A;  2QM8 A;  3SFD C;  4H0L D;  2AEM A;  3L70 G;  2QM7 A;  2JKV A;  1BGY D;  3AE6 C;  1Q81 Q;  3GP4 A;  1XTC C;  2YXQ B;  3AE8 C;  1USD A;  1DEB A;  4GOF A;  1KC8 Q;  2IBZ D;  2JWA A;  3EZ6 A;  1NTM E;  5AVR B;  3CXH D;  5KAV A;  1NU1 J;  2C9L Y;  1G2C B;  4PJ0 H;  3B49 A;  1MUU A;  1NTM D;  5E79 H;  4GOE A;  1SQV E;  2QG4 A;  1FJP A;  2QRX A;  2J59 M;  3CCE P;  4JYB A;  4CPG A;  1SQQ J;  4WY4 A;  3CCL P;  3M0D A;  1M1J A;  3PLN A;  1KYO I;  3B71 A;  4PV1 D;  3S9O A;  1RE3 C;  3RK3 B;  2WT7 B;  4D6T G;  3HE4 B;  3VMY A;  1SQV J;  2N1T A;  1FC2 C;  2P58 A;  4NPE A;  3PTZ A;  1S4X A;  2KZI A;  2YO3 A;  3T97 A;  1NKN A;  1VQN P;  2IDB A;  1L0L D;  1JYH A;  3GMA A;  1HJ0 A;  1BE3 E;  3CWB J;  5GTI E;  1RF1 B;  3TGU D;  3FX0 A;  1BE3 D;  1X22 A;  1YHQ P;  2KS1 B;  2K9Y A;  4L76 A;  4EI2 A;  4KT0 J;  2XZR A;  1SQX K;  5I44 A;  1RF0 A;  3RK2 C;  3L71 D;  2VZ4 A;  3L35 A;  2WSF H;  1P84 H;  4ASV A;  3A0B E;  5TIS H;  1SQP G;  3L74 D;  2AXC A;  1CW5 A;  1LTT C;  5APS A;  3NTN A;  4H13 C;  4EOT A;  1YTZ I;  3L72 E;  1U57 A;  1Y8A A;  1FZE A;  1GL2 C;  1QEX A;  4WWI A;  3V2R A;  4JF7 A;  5KKZ B;  3L72 D;  5CCG A;  1QGK B;  1EDI A;  1NU1 K;  1PP9 E;  4DZO A;  2LXC B;  4H44 B;  3G9R A;  1M1J C;  2NPS B;  2OYI A;  2FXM A;  1PP9 D;  4DJG A;  1Q09 A;  3IR9 A;  2N1T C;  2P67 A;  5KTB A;  1JY3 P;  3GHG A;  3B5N D;  1G1I A;  4H0L B;  4AYZ B;  1SQQ K;  1EDJ A;  4NPD A;  2AXT E;  2H89 C;  5EFW B;  3V6I A;  2E74 C;  2JJL A;  1L2P A;  2R32 A;  4OWF A;  2OTJ P;  1SQV K;  2Q5U A;  2XKM A;  3A3Y B;  1FU1 A;  3LUR A;  2IZ0 A;  1BSN A;  3KXD A;  1Y9B A;  1EZV I;  1G2C A;  1OIP A;  1Q05 A;  1NVO A;  2Y0D A;  1OW8 A;  3WUV A;  2LKM A;  2QJY B;  1QL1 A;  3H32 A;  3CL3 D;  1YJN P;  2NZ2 A;  4H13 D;  1HBW A;  1W5C E;  4ZMD A;  1X8Y A;  2VRS A;  3TNU B;  2YIU B;  1FOS E;  1JTH B;  4PV1 B;  2Z5I A;  1NAY A;  2WPR A;  3BCC G;  5AVX B;  2B89 A;  1KZU B;  2G3A A;  1ZP0 C;  2WT7 A;  1H8A A;  3HE4 A;  4W7Z A;  1KN7 A;  3U1A A;  1SQX G;  2OYI C;  1JEK A;  3KYQ A;  4Y99 B;  3VYI A;  1URQ C;  3H1I E;  2W8Z A;  1X0T A;  1SFC C;  2N9Y B;  2OAR A;  2WPV B;  1KTM A;  2K1A A;  3L75 J;  3H1I D;  2KCU A;  1PGO A;  1RQU A;  1RF1 A;  3LIE A;  2E74 D;  3BRT B;  3H1L E;  5AW5 B;  2KOG A;  1U7J A;  4WLW A;  2QSI A;  1BCC E;  2WQY C;  4U3F J;  1FJK A;  4HYT B;  2ZFC A;  3CXH H;  1NU1 G;  4PJ0 E;  1VQL P;  1FZF A;  1L0N J;  1J2J B;  1E5W A;  2I1J A;  2YO2 A;  4PD4 D;  5AVZ B;  5K5G B;  3H1L J;  2XU6 A;  1D7M A;  2G8Y A;  1LT9 A;  1NKZ B;  1OZH A;  1Q0A A;  3MD0 A;  1J1D C;  3V2Q A;  4Y28 J;  3M0A A;  1SQQ G;  2POH A;  3H1K E;  1DD3 A;  4KJM A;  2A45 H;  3A7O A;  4OH8 B;  1FZB A;  1PGJ A;  2QEX P;  1FAV A;  1LTJ B;  3SFE C;  1EDK A;  5CJ0 A;  3RGU A;  3G6E P;  4NPF X;  4IL6 X;  2FYN C;  1UIX A;  3H1K J;  1MFT A;  4W7Y A;  1S9K E;  3B5N B;  3RL0 g;  3CWB G;  2B87 B;  1NWQ A;  1WMK A;  4AYZ A;  2ZVO B;  1URQ D;  2JR8 A;  1S9K D;  1SFC D;  2OTL P;  1JOC A;  3CC4 P;  5GQQ A;  2K88 A;  1W2B O;  2I8D A;  1T2K C;  2IFN A;  5AVW B;  3CCV P;  3A5T A;  3VOP A;  2QE7 H;  3P8M C;  3S4R A;  2R5D A;  4R4L A;  2WSE H;  4XE5 B;  4DCZ A;  3A0B H;  1JY3 O;  1E79 H;  1VQ9 P;  4AUW A;  1SQP D;  5I41 B;  1EZV G;  3E7K A;  2W27 A;  1Y47 A;  1JNM A;  2WSF J;  3KQG A;  1NAF A;  4Z1M H;  1KOR A;  1VF5 C;  4I6M C;  1LT9 C;  2Q3I A;  1L4A A;  1N7L A;  3G71 P;  2XDJ A;  5KJ7 D;  1L0N K;  5APU A;  3TNU A;  2OYH B;  4A1M A;  1JTH A;  4TLF A;  5KLV J;  4J2N A;  3F89 A;  4HB1 A;  1USE A;  4U7J A;  1NGM B;  3H1J E;  3GLM A;  2W83 C;  3VMX A;  5APQ A;  1LWU A;  2GOV A;  4I7Z C;  2CPB A;  3H1J D;  2FXO A;  4AYC A;  2E76 D;  2O3J A;  1TU3 F;  1A02 F;  2AXT H;  1AQ5 A;  1FZC B;  4R22 B;  3I56 P;  1JO5 A;  1IFN A;  2HOD B;  3BRV B;  2RN0 A;  3VTP C;  1MV8 A;  2WZ7 A;  1HF9 A;  3PH0 A;  3AE2 C;  2E75 C;  5C39 A;  2L5G B;  1ZRT E;  3D6Z A;  3CX5 E;  2R3S A;  4IL6 E;  2C9N Y;  1LJ2 A;  2IZ1 A;  2QVA A;  2Y0E A;  2PRR A;  3ZDM A;  1P84 I;  1ZRT D;  3I55 P;  1W2E A;  3CX5 D;  3AEA C;  1NTZ J;  3O8Z A;  4YXW H;  1GTW A;  1QL2 A;  3HD7 C;  1LGH B;  1BSH A;  2BEZ F;  3FGA D;  3H1H J;  1M90 Q;  2YKO A;  5KLI B;  2M3E A;  1JBG A;  1GK4 A;  4EIJ A;  1KB9 E;  1L4A C;  2WSS H;  1N73 C;  4C46 A;  1OW6 A;  4OGQ C;  1KB9 D;  1RY3 A;  4ZNC A;  1LTJ A;  1KQF B;  2O01 J;  3WUU A;  3VN0 A;  1BGY E;  2KZJ A;  1J1E C;  1A02 J;  1K8A Q;  2KUB A;  3E1R A;  2N9B A;  2Y9Y A;  2ZVN B;  1LWU C;  1GDT A;  3B5N A;  3L75 G;  1JY2 N;  3ITK A;  3BVH A;  1M1K Q;  1OVR A;  2P2U A;  5KLV K;  1NTK E;  2IBZ E;  5CJ4 A;  4M3L A;  3S1K A;  1GW3 A;  1YJ9 P;  4UB6 E;  1BGY J;  4U3F G;  5KAT A;  5D8C A;  3FWL A;  3CXH E;  1NTK D;  2K37 A;  1PL5 A;  3EZ9 A;  1QVG O;  1L0N G;  2D2C D;  3RL0 D;  1SQB E;  3AE9 C;  5APV A;  4PD4 H;  3O6Q B;  3WUT A;  1NOH A;  1AJY A;  2E75 D;  3W67 A;  4LHF A;  1U7M A;  1SQB D;  2HVA A;  2QA4 P;  1S2E A;  4K3A A;  1K73 Q;  1GU5 A;  1NTM J;  3KPE A;  1FZG A;  5H2F H;  1N7S D;  5KAF H;  3AEG C;  3GPV A;  2OYH A;  2WPQ A;  3SWK A;  5KAI H;  4IFD K;  3OJA B;  1NTZ K;  1L0L E;  3H1K G;  2ZT9 C;  3EQ2 A;  3TGU E;  2OG0 A;  3MUD A;  3GK6 A;  2E76 B;  3AEE C;  3L73 E;  1JMB A;  3L71 E;  1LT1 A;  1L0L J;  2FYU E;  1AQT A;  3AE5 C;  3AEF C;  1FZC A;  3L73 D;  3L74 E;  2BOW A;  1KIL A;  1M57 D;  3TGU J;  2FYU D;  2IFM A;  3C9I A;  1BE3 J;  4IFM A;  3IFM A;  2KI7 B;  1FDO A;  3PRJ A;  3L71 J;  2QJP B;  2KK7 A;  5TJH A;  2FY8 A;  2JO1 A;  3L74 J;  3NFQ A;  1HGV A;  2WSE J;  3OA7 A;  4DOJ A;  3RBZ A;  2WIT A;  5AVV B;  2KNC B;  1OXZ A;  5KLV G;  2W6A A;  4WY4 C;  1DEE G;  1AV1 A;  3B4S A;  3M0D C;  2FFD B;  1MKM A;  2E43 A;  3L72 J;  3P8C D;  1NO4 A;  4XFJ A;  1NTM K;  4JPZ B;  4YPC A;  4W80 A;  1SQB K;  1PP9 J;  2A06 G;  5CBO A;  2ZT9 D;  1N2D C;  3FXE A;  1R5S A;  2KSJ A;  3AE1 C;  2Q6Q A;  3W68 A;  3MUD C;  1M8O B;  5BU8 B;  1YIJ P;  2FKW B;  3N4X A;  1FOS F;  3BAT A;  3HUS B;  2AEF A;  1GZL A;  3QWO C;  2IPP A;  3PHL A;  4WBA A;  1RH5 B;  2QJK B;  2ZYG A;  2E42 A;  3R8K A;  2L91 A;  2D2C B;  2XNX A;  1RF0 C;  1KIL C;  3RL0 B;  3RK2 D;  1XTG B;  1IK9 A;  3H25 A;  4C7N B;  3CX5 H;  3M9H A;  4IL6 H;  1NTZ G;  2GUS A;  5GTH E;  3M9B A;  1L0L K;  1S1C X;  2YMK A;  3H1H G;  2WTY A;  3JCU H;  2Z4E A;  1BDC A;  3EFF K;  2C0X A;  2PFX A;  2FXP A;  3ABV C;  1H0T B;  1GL2 D;  1PPJ E;  1M56 D;  2BCC G;  1N7S B;  2Q7C A;  5CCH A;  2WVR A;  3R2P A;  5CCG C;  1PPJ D;  1KB9 H;  2Q3E A;  2B9B A;  1S3J A;  4WY4 D;  1KYO H;  2E5Y A;  1H88 A;  1HGZ A;  5CBN A;  3V2N A;  3V2P A;  4GIF A;  2N1T D;  3GHG C;  3CCS P;  2HPC B;  4JBZ A;  3L70 D;  2OGU A;  3BAS A;  3II6 A;  3HTK B;  4LGD E;  5APX A;  1VQ6 P;  2KS1 A;  4UB6 H;  1T3J A;  3H1I J;  4PD4 E;  3M91 A;  3CC7 P;  2W6J H;  1HWT C;  5CMZ A;  1EQ7 A;  2KP8 A;  1IFJ A;  2IBZ G;  1ZXG A;  2NRG A;  1DH3 A;  1Q7Y Q;  1OFC X;  3NMD A;  3D6Y A;  2WWW A;  1BCC J;  1NTM G;  4YXD C;  5H2F E;  1AFO A;  5KAF E;  3USS A;  5AW2 B;  5AVT B;  4D6T E;  1LP1 B;  1SQV G;  2KNC A;  5KAI E;  3CCR P;  1PGQ A;  1VQ8 P;  5CCH C;  1R8E A;  1ZLL A;  4D6T D;  2NPS A;  2UWJ E;  1IFI A;  2A45 G;  3RK3 C;  1LNQ A;  1GMJ A;  1HJB A;  2ZAE B;  4TT3 H;  1DD4 A;  5BVZ A;  1VQ7 P;  2KLU A;  3CMA P;  3R8J A;  2QIW A;  3V5B A;  2Q9I A;  4WLS A;  3EZ2 A;  3CCU P;  3CCQ P;  1VQK P;  1RF1 C;  3EFG A;  2GA1 A;  3HUS A;  1NJI Q;  1HUC A;  3TGU G;  3GF7 A;  5L8R J;  3IF4 A;  3MHV A;  1ZR4 A;  4GKG A;  5D90 A;  1RE4 A;  2HG5 D;  1BE3 G;  1PGP A;  1SQP E;  1GK6 A;  2ZHG A;  1K05 A;  2FBW C;  2Q1K A;  3L71 G;  1Z56 A;  4C7N A;  1IFP A;  4RKU J;  3QH9 A;  3JC2 2;  1SVF A;  3AED C;  2M8R A;  4H13 B;  3Q3D A;  1YQ4 C;  2JWD A;  4BWN A;  2OYO A;  1SQP J;  1KD1 Q;  4N78 E;  1GL2 B;  2HR3 A;  3MIW A;  5B5E E;  1DIP A;  4HH2 A;  3VP9 A;  1H0T A;  2WSC H;  4O9B A;  2JDI H;  4N78 D;  2YKQ A;  1N7S A;  1RHZ B;  4IFF A;  5KKZ C;  3L72 G;  1Q07 A;  3CLQ A;  2ZXX A;  3CC2 P;  1M1J B;  2V4H A;  4H44 C;  1QVF O;  1Q06 A;  1HH0 A;  3OW2 O;  2NPS C;  2RMZ A;  3A0H E;  2LXB A;  1KFM A;  1PP9 G;  3E1I A;  2N1T B;  5AW8 B;  1JB0 J;  5APW A;  2HPC A;  2HFE D;  3U59 A;  3T97 B;  4H0L C;  2E74 B;  1IK7 A;  1Q82 Q;  3PJS K;  3H1J J;  2KYV A;  3HTK A;  4C7R A;  1T6A A;  4B0Y A;  1T2K D;  3AE4 C;  2LR2 A;  2ZYA A;  1RE4 C;  1ZN5 A;  1S5L X;  4L73 A;  1EXJ A;  3RBX A;  1ZW0 A;  3JCU E;  1H89 A;  2MKV A;  5GTH H;  4B86 A;  1JUN A;  3LW5 H;  2V7Q H;  1HVV A;  5AVU B;  2H43 A;  2HLO A;  3TYY A;  5KAU A;  2QJY C;  1VF5 D;  1VPC A;  2PP6 A;  3BCC E;  4EDF A;  2P10 A;  3U1C A;  1VQM P;  1KYO E;  2BCC D;  1LP1 A;  1JM0 A;  2YIU C;  3AEB C;  3BCC D;  2P1J A;  2KLV A;  2RH0 A;  3I5C A;  4PV1 C;  1KYO D;  1RE3 A;  3UCS A;  3AE3 C;  3IN6 A;  4IOI H;  3HRN A;  1Q86 Q;  1SQX D;  1X79 B;  2OYI B;  5CHX A;  4H44 D;  1SQP K;  2IYP A;  4A7P A;  1FE6 A;  4Y99 C;  3SWY A;  3GG2 A;  2B87 A;  1URQ B;  1AVY A;  5APY A;  5AW1 B;  1SFC B;  2H7H A;  3P32 A;  4KHX A;  2JML A;  3C1L A;  4BRY B;  2J5U A;  3PP5 A;  5AVS B;  3C8V A;  4ZKU A;  3AE7 C;  2XND H;  3H1I G;  4ASW A;  4XA4 A;  2M5A B;  1NU1 E;  1WT6 A;  1LTA C;  4HJG H;  2K3R A;  2YXR B;  2Y9Z A;  1NU1 D;  1NTK J;  3H1L G;  2H88 C;  1BCC G;  3CCJ P;  1KFN A;  2DW3 A;  3E0H A;  1IZN B;  3CX5 I;  3M9Q A;  1SQQ E;  2I1K A;  1YTZ T;  3KHU A;  3JSV C;  3HD7 D;  1J1D B;  1Y6U A;  1SQB J;  5AW3 B;  4JYC A;  3WU2 H;  1SQQ D;  1GL2 A;  3OAK A;  3H32 B;  5BU5 A;  3Q5S A;  1FDM A;  1VQP P;  1QLE D;  1L4A D;  1SQV D;  1S5L E;  3LID A;  1KB9 I;  4OGQ D;  1LTJ C;  1SS1 A;  3NXS A;  2YNY A;  2K9J B;  2YMY A;  1OMI A;  5AVQ B;  3CWB E;  3KZI H;  2FYN B;  2CK3 H;  1AVO A;  1YBK A;  3CWB D;  1JY2 O;  1R5L A;  3B5N C;  1X9V A;  1N8R Q;  1RQV A;  1KMI Z;  4YTP C;  2R44 A;  2HOD A;  2O1J A;  4GT1 A;  2IBZ I;  2KVV A;  3VMA A;  1LTS C;  1OVU A;  3CXH I;  1JCD A;  3L73 J;  1EXI A;  1EZV E;  2MJZ A;  3F5H A;  2FYU J;  4I2L C;  3UIA A;  3V4Q A;  3FWN A;  1CI6 B;  1EZV D;  4QMA A;  1UII A;  1FZA A;  2KSE A;  3G4S P;  1VF5 B;  5B66 E;  1LT9 B;  5KAX A;  2BEQ D;  5B5E H;  1NTK K;  3P8C E;  2A45 I;  4EYY Q;  1KQG B;  2M3B A;  2OYH C;  2O1K A;  1ZOY C;  2BAS A;  3R4Y A;  2WPS A;  2IYO A;  2WSC J;  3GF3 A;  3A0H H;  3L37 A;  2E5T A;  4I7Z B;  2ZHH A;  5AW7 B;  1URQ A;  3H1J G;  1SFC A;  3KDP B;  4BRY A;  4UB8 H;  1IFD A;  4R4M A;  2CPS A;  2KB7 P;  1FZC C;  2IX7 C;  1M7L A;  3VP8 A;  2M5A A;  1GW4 A;  1LTI C;  2JP3 A;  5AW4 B;  1GD2 E;  4AQR D;  2KIK A;  2KXP B;  1MZ9 A;  2E75 B;  3O6Q A;  5KAW A;  2H8P D;  1R8D A;  3QAO A;  2IEF A;  2PGD A;  3CCM P;  2AEJ A;  1Q90 D;  3D70 A;  5DJU B;  3HD7 B;  3EWK A;  2DG6 A;  1LX8 A;  3Q5R A;  1DX7 A;  3A2A A;  5KJ7 A;  1AA0 A;  5AVY B;  3LW5 J;  2V7Q J;  5KLI C;  3TSI A;  1L4A B;  2FYU K;  2O01 H;  2GUV A;  1N73 B;  4OGQ B;  4DCK A;  4R4E A;  3MZW B;  3FXD A;  3L70 E;  1CSB A;  1T3U A;  2W90 A;  1J1E B;  5M1B A;  1YIT P;  3L75 E;  2K9J A;  3HE5 B;  1SLQ A;  3P7K A;  1T8Z A;  1HTL C;  1G1J A;  1LWU B;  3L75 D;  1BGY G;  1NHL A;  4U3F E;  1K9M Q;  3L70 J;  3V4W A;  2YKP A;  1FS0 E;  1BDD A;  1L0N E;  4U3F D;  5AW0 B;  2GM4 A;  1FBM A;  1KIL E;  4ZKP A;  2O01 N;  1NTK G;  1L0N D;  1CZQ A;  1KQL A;  1KIL D;  2Y0C A;  4I1L A;  2OTK E;  3H1L D;  1IO4 A;  1IJD B;  3IAO A;  1LTB C;  1BCC D;  4N3Y B;  1JY3 N;  5E79 E;  1SQB G;  3WU2 E;  4RJT A;  1CI6 A;  2R5B A;  1K04 A;  1Q08 A;  2HYN A;  3MGN A;  2XV5 A;  4L75 A;  3CPW O;  3SWF A;  2FFD A;  5KJ7 C;  4K35 A;  5CCG D;  2OQQ A;  1ZV8 A;  1S5L H;  2JEE A;  3KZI E;  2R3C A;  5AW9 B;  1QX8 A;  3M06 A;  4RES B;  3H1K D;  3MTU E;  4D6T J;  2ZT9 B;  1KQS O;  2C0W A;  1VQO P;  3WMM 0;  2FYZ A;  1L0L G;  3SSU A;  2E76 C;  4GOD A;  1NH4 A;  1LTG C;  1ZR2 A;  5AW6 B;  3CME P;  4WB4 A;  1D5Y A;  5KCB A;  3TK1 A;  1YQ3 C;  1RH6 A;  1KV4 A;  5DJT B;  5GTI H;  3RK2 B;  3L73 G;  4LC1 A;  1OW7 A;  1IFM A;  2FYU G;  1OX3 A;  1JMM A;  4PD4 I;  1P84 E;  3L74 G;  5TIS E;  5APT A;  1YYC A;  1JY2 P;  1P84 D;  4N6J A;  4OVN F;  4MN4 C;  4R24 B;  3Q2Y A;  2QJP C;  1PZQ A;  3HD7 A;  5KLV E;  3VMZ A;  5B66 H;  3TF5 A;  4DT0 A;  5KLV D;  4WY4 B;  3RK3 E;  2B88 A;  5CCH D;  1PFI A;  2FFD C;  1N73 A;  3HH0 A;  1PV3 A;  3RK3 D;  1PIX A;  1YI2 P;  2A06 E;  3N7N A;  2Z5H A;  2ITA A;  1VQ4 P;  2ZYD A;  3HE5 A;  2A06 D;  4LLH A;  1BOW A;  3H6P A;  5E01 A;  4UB8 E;  1OWA A;  1EC5 A;  1GU4 A;  1NYH A;  4GDO A;  1MFZ A;  1N86 A;  3HUS C;  1VL2 A;  2SPZ A;  2W6B A;  2QJK C;  1NTZ E;  3EZF A;  1KIL B;  1PM6 A;  3L4F A;  3Q1M A;  2D2C C;  2WMM A;  3RL0 C;  3GW6 A;  3AEC C;  4WVZ A;  3H1H E;  1NTZ D;  3B8E B;  1VDF A;  3Q5P A;  3H1H D;  1S72 P;  2BCC E;  2J58 A;  1JCC A;  3EZ7 A;  4HKZ H;  1VQ5 P;  2M0B A;  3L36 A;  1EDL A;  3TDK A;  1SQX E;  2RKL A;  1N7S C;  3D71 A;  1PPJ G;  1Q2N A;  3K5B A;  1SP4 A;  2BCC J;  3G3Z A;  3MP7 B;  3BCC J; 
#chains in the Genus database with same CATH homology
 4R4L A;  1EXI A;  2QIW A;  1Q90 D;  1MKM A;  3AEA C;  4WLS A;  4WLW A;  3D70 A;  2QSI A;  2WQY C;  3HH0 A;  3EWK A;  2DG6 A;  4DCZ A;  1PV3 A;  2IDB A;  1ZME C;  1JYH A;  3GMA A;  1LX8 A;  3EZ2 A;  3Q5R A;  1FDI A;  1PIX A;  2BEZ F;  3AEG C;  1HJ0 A;  3GPV A;  4B0Y A;  3FGA D;  2H88 C;  5I41 B;  2OQQ A;  3AE4 C;  3SFD C;  4XFJ A;  3LW5 J;  2V7Q J;  3GF7 A;  4H0L D;  5KLI C;  1JBG A;  5L8R J;  2WSF J;  1S5L X;  3E0H A;  1VF5 B;  5D90 A;  3AE6 C;  4Z1M H;  1KOR A;  1VF5 C;  5KAX A;  2BEQ D;  3LUR A;  1EXJ A;  1BOW A;  2K9Y A;  2ZT9 D;  5E01 A;  2G8Y A;  3GP4 A;  2ZT9 B;  3AE1 C;  4KT0 J;  4OGQ B;  1Q0A A;  1OW6 A;  2ZT9 C;  1KQG B;  2ZHG A;  4OGQ C;  5I44 A;  1Y9B A;  1Y6U A;  1K05 A;  2FBW C;  3AE8 C;  4R4E A;  2MKV A;  1KQF B;  2VZ4 A;  2OG0 A;  2O01 J;  1NYH A;  4Y28 J;  4A1M A;  1ZOY C;  4GDO A;  5M1B A;  3GK6 A;  1Q05 A;  2E76 B;  3R4Y A;  1OW8 A;  4RKU J;  4J2N A;  2E76 C;  3Q5S A;  1VL2 A;  1DD3 A;  5KAU A;  3AEE C;  2QJY C;  2WSC J;  1VF5 D;  3AED C;  3GF3 A;  2NZ2 A;  4H13 D;  4U7J A;  3EZ6 A;  4H13 B;  3Q3D A;  2QJK C;  1NGM B;  1YQ4 C;  2P10 A;  4H13 C;  3R8K A;  3GLM A;  3EZF A;  2D2C B;  1D5Y A;  5KAV A;  5KCB A;  1YQ3 C;  3AE5 C;  1PM6 A;  1RH6 A;  3AEF C;  3Q1M A;  2D2C C;  4OGQ D;  3SFE C;  3D6Y A;  4I7Z B;  3B49 A;  1U57 A;  3AEC C;  2GOV A;  4I7Z C;  2YIU C;  3AEB C;  3H25 A;  1DIP A;  2ZHH A;  2BOW A;  4PV1 B;  1OMI A;  4YXD C;  1OW7 A;  4PV1 C;  2G3A A;  2E76 D;  3UCS A;  1ZP0 C;  4IL6 X;  3AE3 C;  5KAT A;  2FYN C;  1UIX A;  5D8C A;  1KIL E;  3IN6 A;  5KKZ C;  1TU3 F;  3Q5P A;  1Q07 A;  2YMK A;  1S1C X;  3RL0 g;  3EZ7 A;  1PL5 A;  4H44 D;  1FDO A;  4R4M A;  3EZ9 A;  1WMK A;  4H44 B;  2D2C D;  3G9R A;  4AYZ A;  4R22 B;  4H44 C;  1Q06 A;  1RQV A;  2FXP A;  4R24 B;  3Q2Y A;  2QJP C;  3ABV C;  3AE9 C;  1HF9 A;  2JO1 A;  2JP3 A;  1KMI Z;  1AJY A;  1R8E A;  4YTP C;  3B71 A;  5GQQ A;  4PV1 D;  3S9O A;  2E75 D;  1Q09 A;  3IAO A;  2WPV B;  2E75 B;  1KTM A;  2JML A;  3AE2 C;  4LHF A;  2WSE J;  2E75 C;  3O6Q A;  1GMJ A;  2KVV A;  1ZRT E;  3D6Z A;  5KAW A;  2J5U A;  2HVA A;  1JB0 J;  1K04 A;  4TT3 H;  3D71 A;  3C8V A;  2KCU A;  1RQU A;  1DD4 A;  3AE7 C;  1Q08 A;  4H0L B;  4AYZ B;  1R8D A;  3T97 B;  4H0L C;  2E74 D;  3QAO A;  2IEF A;  3RK3 E;  2E74 B;  2H89 C;  1IK7 A;  3R8J A;  2E74 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...