1EXIA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exiA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exiA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exiA01
2J5UA 3LURA 3R8KA 3GP4A 1JBGA 2JMLA 3GPVA 4J2NA 1Q08A 4R4MA 1Q09A 3Q3DA 1R8DA 2OQQA 2HVAA 5KAUA 3Q1MA 3B49A 3D6YA 1D5YA 1EXJA 1DIPA 3Q5RA 3E0HA 5E01A 3HH0A 1BOWA 2KCUA 2ZHHA 3G9RA 1Q0AA 4R4LA 3D71A 2VZ4A 4WLSA 2ZHGA 5D90A 5D8CA 2DG6A 3Q5SA 4AYZA 5KAWA 5KATA 3Q5PA 4A1MA 3D6ZA 3QAOA 1EXIA 5GQQA 4R24B 2BOWA 5KCBA 3R8JA 4AYZB 3UCSA 5KAVA 3GK6A 1Q05A 4WLWA 3D70A 1Q07A 5I44A 1Q06A 3Q2YA 3IAOA 1R8EA 4R22B 4R4EA 2GOVA 4B0YA 5I41B 1JYHA 5KAXA 3T97B
chains in the Genus database with same CATH superfamily
2H88C 4GT1A 3FXEA 1CI6A 5KLVJ 5K5GB 1Z56A 3TNUA 4WWIA 3BATA 1PPJE 3CCEP 1S2EA 4I1LA 2XDJA 1NYHA 2E75D 1VQ7P 2O01J 1RHZB 4IFFA 1SQBK 1GK4A 1HWTC 1NTZJ 2N9YB 3V4WA 5CCGA 3V2PA 1BE3G 3H1LG 3L70G 1R5LA 1LP1A 2IBZG 1VQMP 3CI9A 1VQ5P 1S3JA 5KAWA 1N2DC 2KB7P 3H1JD 2E75C 3H1JG 5KCBA 2JDIH 3WUTA 1Q7YQ 4OVNF 3CCLP 1P84E 1J2JB 3M0DC 1OWAA 1VPCA 1LTTC 2AEMA 5KAFE 1FDOA 1BCCD 4N6JA 2A06D 3LW5J 1RE3C 5CHXA 1NTKJ 1H88A 4W7ZA 1FBMA 4AYZA 2GM4A 1L4AB 2E5TA 1SFCA 1VQOP 3A3YB 3H32A 3RBZA 1JMMA 1JEKA 3R8KA 1KQLA 1DD3A 3GP4A 1SQQG 5AW2B 5AW6B 4PD4I 5GTIE 1J1DC 1BSHA 1PP9D 3AECC 5AVSB 2C0WA 3L74G 3V2RA 1SQVD 3L70J 3KPEA 2VRSA 1SQPJ 1KQSO 2Y0EA 1SQQD 2IBZI 1RF1A 1GL2B 1JOCA 1NAFA 1HUCA 3USSA 5H2FE 1UIXA 3AE3C 2UWJE 4WLWA 2OYOA 3H1JE 3B5NC 2Y9YA 1YJWP 3CX5H 1PGJA 3AE8C 1EXJA 2W6AA 3QH9A 4L73A 1LTBC 2IYPA 1NTZK 1E79H 3TNUB 2FXOA 4N3YB 1QL1A 2WPRA 5M1BA 1KILB 4R4EA 2ZJSE 1VL2A 4CPGA 1BDCA 5CJ4A 3GF3A 1W5CE 1KC8Q 1N7SA 4BRYA 4NPFX 4AQRD 2P7JA 3PH0A 4XE5B 2JP3A 2P1JA 3TGUJ 1KB9H 3CD6P 4H44C 3D70A 4WVZA 2E74C 1IK9A 2QJKC 3F89A 3CX5I 4UB8E 1A02J 2B87A 3EQ2A 1E5WA 5KAIH 3CMEP 2QM8A 5KATA 3HD7B 3TSIA 5KKZC 3A7OA 1NH4A 1VDFA 2YXRB 5I41B 1K9MQ 3CCVP 1NU1K 3A5TA 1IFIA 3E7KA 1S5LE 4HYTB 2KNCA 2W6JH 4I7ZB 2E76B 5D8CA 2KLUA 5APTA 4R24B 2CPBA 3VOPA 1VQNP 5AVWB 4OGQC 1LTSC 3BRTB 3NTNA 3BRVB 4OGQD 1LX8A 2W6BA 1QVFO 3HH0A 3HTKA 4H44B 2KS1B 2Y0DA 5E79E 3GF7A 1SQBD 4EOTA 3GG2A 5H2FH 1L0ND 1A02F 2WPSA 2I1JA 1X0TA 2J59M 5AW0B 3M9BA 1AQTA 2BEQD 1KB9D 2VZ4A 3HUSC 2E42A 1FZCA 2XV5A 1KV4A 2FYUJ 3MUDC 1QGKB 2K37A 3HUSA 1W2EA 4C7NB 1S9KD 1PP9G 4C7NA 3CWBG 2B89A 3EFGA 1BCCG 3RL0B 3AE7C 3NMDA 2AXTH 2HR3A 4GOEA 1YBKA 1LTJB 4HKZH 1S9KE 1VQLP 1R8EA 3L70E 3EZ7A 4GDOA 2JMLA 1BE3D 1QL2A 2M3BA 1Y9BA 3VMAA 2D2CB 1KN7A 3GHGC 1SQPG 3EWKA 5APSA 3V2NA 3MGNA 4U3FJ 4K3AA 1HF9A 1NKNA 2O01N 3L74J 1Q05A 2WT7B 1ZMEC 2WITA 2WT7A 1HJ0A 4ZKUA 1L0NG 1EZVG 2YMYA 5APQA 3RK3E 1SQVG 5AVTB 1SQXG 2FFDA 1KFMA 4ZMDA 4A7PA 5AW8B 1T2KC 2AXTE 2AEJA 2WVRA 1T3JA 2FYNC 2HODA 3SWYA 3CX5D 1JY2N 3SWFA 1KQFB 3RK3C 3AEDC 2OQQA 4DCKA 4K35A 1OVUA 1OIPA 3T97A 2DG6A 1JTHA 4GOFA 1NU1D 4XA4A 1S4XA 1URQB 1Q09A 4L76A 1DD4A 4H13C 2GA1A 3L75G 3U59A 1X9VA 3CLQA 3JC22 1YIJP 4DCZA 3W68A 4AUWA 2V7QH 3BASA 2FKWB 3L75J 3VMYA 4PD4D 4ZNCA 3WU2H 1BGYJ 1VQ9P 2OYIC 3L75E 1RQVA 2N1TA 4DT0A 3B5NB 1MFZA 4DZOA 3G6EP 3G9RA 3GW6A 1QX8A 3D71A 1GU4A 3BVHA 1P84I 1T3UA 4IFMA 1YJNP 3HTKB 3L4FA 5AW7B 1G1IA 4JYBA 1SS1A 1K04A 2Q5UA 1KYOH 4ASVA 3MZWB 3EZFA 3ITKA 3C9IA 3PJSK 2YIUC 2NPSD 1WRGA 3II6A 1LGHB 1CI6B 1N8RQ 4LHFA 2QJPB 2B87B 2KOGA 4RKUJ 5CBOA 3L72E 2OARA 3H1IJ 2MKVA 5CBNA 3L71J 2E74B 2QJPC 1FDIA 1ZOYC 3SFDC 2ZYGA 4H0LD 1LTIC 4ZKPA 1ZR2A 1L4AC 1EDKA 1NTMJ 2BOWA 5CCGC 2V4HA 3CX5E 2QVAA 1URQC 1H89A 1N73A 1M7LA 1EZVE 1IFNA 3LW5H 3OAKA 4YPCA 3Q5RA 2A45I 1BOWA 4IL6H 1NTKD 3KZIH 3G4SP 2ZT9D 1BSNA 2FYUG 4WY4C 2PFXA 4PV1C 2ZT9B 3HD7D 4Y28J 5KTBA 5B66E 3CXHI 1MZ9A 2WPVB 2KZIA 1PP9J 2FY8A 1JUNA 2O01H 1RH6A 1BE3E 2O1KA 1LP1B 1L2PA 4R22B 5BVZA 2P10A 3CWBD 3AEBC 1VQ6P 2IX7C 4EYYQ 2QG4A 5KLVG 2IZ0A 1NO4A 3WMM0 3OJAB 1PGPA 1KFNA 1MV8A 1OW7A 2I8DA 1CZQA 2KZJA 1BDDA 2ZXEB 3O6QA 1M90Q 3T97B 1JTHB 3AEGC 3BCCJ 1L0NK 4WBAA 3HRNA 1FU1A 4AYCA 2AXCA 1Y47A 2Y9ZA 1YYCA 3B8EB 3RL0C 1OW8A 3KXDA 3L72G 3B5ND 1FZFA 3L36A 2LXCB 4UB8H 3GHGA 4W80A 4Y99B 1L0LK 1LWUC 2Q3IA 3P32A 3VN0A 3VMXA 1K8AQ 1IFMA 2RMZA 1L0LG 3M9QA 4R4LA 2QA4P 3KYQA 3NXSA 1X79B 2R3SA 1KB9I 1TU3F 2YNYA 3M0AA 1PGQA 2ZYAA 5GQQA 1N7LA 2H7HA 3JCUE 3FWLA 5CCGD 2NPSB 1ZW0A 2ZFCA 3AE1C 2IBZE 4JBZA 2WPQA 1JCDA 1HTLC 3L72J 1VQKP 1NTMK 1SQBE 1S5LX 1NOHA 3H1HJ 3MHVA 1YI2P 2YXQB 2YMKA 3L37A 1R5SA 3M9HA 2ZVOB 2OYIA 2HYNA 2LKMA 1GDTA 2IPPA 3Q5PA 1LWUB 3UCSA 3MIWA 3S1KA 2G3AA 4DJGA 3SSUA 3GLMA 1AVYA 2RN0A 2YO2A 1IFPA 1D5YA 2KLVA 1N86A 1AV1A 3CCSP 1WT6A 3CWBE 5B66H 4ASWA 2CK3H 4D6TG 3CXHH 3N4XA 1SQPK 1JBGA 1JMBA 1NU1G 3L73J 1FOSE 2QSIA 2KK7A 1ZLLA 3LIEA 3VYIA 4W7YA 1LTJA 4U7JA 2HVAA 4NPEA 2KSJA 1RF1B 3AE5C 2ZHHA 2WSFH 3BCCE 1EZVD 1NTMG 3AEEC 2N1TD 2N9BA 4B0YA 2KS1A 2FYUE 5KAXA 3VMZA 1AVOA 1SFCC 5KLVD 1KILC 3S9OA 1OMIA 3JSVC 1LJ2A 2R5DA 4GKGA 4AYZB 4DOJA 3CCJP 2Q7CA 5DJTB 3I5CA 4GODA 2OYHC 1LT1A 1QVGO 3VTPC 1KILD 1ZV8A 1N7SB 1FOSF 2V7QJ 5TISH 1OFCX 2Z5IA 1SQQE 1SQVK 1P84D 1KYOD 3W67A 2Q9IA 2W90A 1BCCJ 4I6MC 1T2KD 3GHGB 1EDJA 2D2CC 2YKPA 1NHLA 2GUSA 1NU1J 3HD7A 2BCCJ 3L73G 1YITP 2JWAA 1PPJG 2CPSA 2KP8A 2FFDB 1IFDA 3ABVC 4D6TJ 1NTME 1GL2D 3A0BE 1XTGB 1SQQK 4QMAA 3E0HA 2WQYC 1VF5D 2R44A 3TF5A 2QJYB 1KORA 2KNCB 1SVFA 3L71E 3I56P 1PL5A 2R3CA 2OGUA 2E5YA 2L5GB 4IFDK 1VQ4P 1OX3A 1LT9C 1HGZA 2E76D 5L8RJ 3EZ2A 1Y6UA 1SQPD 1GL2C 1XTCC 3UIAA 2FXMA 1N7SC 1URQA 3B71A 1EQ7A 1BGYD 1AA0A 2P58A 1FDMA 4YXWH 1YTZT 1SQXJ 2FYUK 3L71G 3B4SA 4D6TE 3IAOA 1NWQA 1EDIA 2OTLP 1UIIA 1NTZG 2BCCE 4R4MA 1M1JB 1N73C 1SFCB 4LGDE 3V4QA 4L74A 2OTKE 1LTJC 1FZCB 3H25A 2W83C 3H6PA 5KAVA 2WSEH 4WY4A 4C46A 1BGYE 1YTZI 1FZCC 1KQGB 1LNQA 3IFMA 1H0TB 2H89C 2WSCH 1NAYA 1RF1C 2N1TB 1P84H 1JY3P 4IL6E 1SQPE 1EZVI 3TGUD 5I44A 4N78E 1HBWA 1J1EB 3H1HG 1NU1E 5KKZB 3RK2C 3H1ID 5BU8B 3R8JA 1NGMB 4BXLA 2M5AB 1PFIA 1Q90D 2IZ1A 3H1LE 1SQVJ 3L70D 4EI2A 2RKLA 1H8AA 3PP5A 1L0LD 2NPSC 5CMZA 1JO5A 1SQQJ 2XZRA 2L91A 3ZDMA 2KVVA 1SLQA 3F5HA 2NPSA 1RE4A 4WLSA 1LT9A 3H1KD 1RE4C 1KYOE 3R4YA 5AVUB 2SPZA 2GOVA 4H0LC 1RF0A 2WWWA 3B49A 5APWA 1RF0C 5E01A 3E1RA 1HGVA 1MFTA 3MTUE 1GW3A 3L73E 4XFJA 3HD7C 5TJHA 1NTZE 1Y8AA 1S1CX 3GMAA 5B5EE 1ZP0C 3CWBJ 1PM6A 3AE4C 4U3FE 1L0NJ 1VQPP 1OVVA 2KCUA 4RJTA 1KZUB 2Z4EA 1GK6A 5KLVE 2YIUB 1NVOA 1L0LE 1GU5A 2QRXA 3PTZA 1IO4A 1JYHA 3OA7A 5APYA 3CPWO 2IFNA 3BCCD 3R2PA 4PJ0H 1KB9E 1OZHA 1Q81Q 4YTPC 3NFQA 5D90A 1L0NE 1K73Q 1U7JA 2FXPA 4TLFA 3FGAD 1H0TA 1NTKG 5EFWB 3LURA 2Q1KA 5AVRB 1Q08A 4KJMA 3H1LJ 1NTKK 3P7KA 1NTKE 3CC4P 2LR2A 1LTAC 2M8RA 1DX7A 4WY4B 2HFED 2K9JA 2ZYDA 2C9LY 2Y0CA 3L74D 2HPCB 1OW6A 2JR8A 4M3LA 3RL0D 3FX0A 2ZVNB 1Q82Q 2E75B 5KJ7D 1AQ5A 1RH5B 5KJ7C 1M8OB 1L4AD 3D6ZA 1QLED 1GW4A 1URQD 3L72D 3A2AA 1SQXK 1SQBJ 3IN6A 3B5NA 3V2QA 3A0HE 2H8PD 1W2BO 3KZIE 1DEBA 1U57A 3N7NA 5GTIH 5KJ7A 5APUA 1N73B 1KMIZ 5E79H 3K5BA 1S72P 2XNXA 2FYNB 4KT0J 1JM0A 3CCMP 4WY4D 5GTHH 1M56D 2W8ZA 1YHQP 1IJDB 4PD4H 3WU2E 1BE3J 1FE6A 1ZN5A 2FBWC 1MKMA 1KD1Q 1PP9E 5CCHA 1SQBG 3AEAC 4H13B 3PHLA 3EFFK 4IOIH 3CXHE 4A1MA 4U3FD 3O6QB 2P2UA 3CCUP 2YKOA 3P8CE 1SQXE 1D7MA 1NTZD 3L35A 1LWUA 1J1EC 4JQ0D 1HH0A 1JY2O 1IFJA 1LTGC 1BCCE 3H1JJ 4OGQB 5AVZB 2G8YA 2M3EA 3SWKA 3LIDA 3H1KE 3QWOC 1IZNB 2JJLA 1FZGA 1IK7A 1PIXA 4GIFA 5AVQB 3V6IA 2QJYC 2QIWA 1X22A 1FS0E 1FZEA 3PRJA 1FAVA 2AEFA 2H43A 2C0XA 3RK2B 2PGDA 2K9JB 1FZBA 5APVA 2IYOA 2IDBA 1PPJD 3H32B 1FC2C 3M91A 1FJKA 1JY2P 3U1CA 5DJUB 4JYCA 4HJGH 1NKZB 2JO1A 1ZRTD 4H44D 5AVYB 3U1AA 3MP7B 1KILA 5CCHC 5AW9B 1USEA 2NZ2A 5AW5B 1PGOA 1VQ8P 2OTJP 2B9BA 1NJIQ 1GL2A 5AW1B 3AE2C 2O3JA 1HJBA 4PV1B 3P8CD 4NPDA 2HG5D 3V5BA 4IL6X 1JNMA 5GTHE 3KDPB 2E74D 2M0BA 2IFMA 3Q5SA 3OW2O 2Q3EA 1AFOA 3TK1A 2KIKA 1VF5B 3AEFC 3FWNA 1GMJA 2HLOA 2A45G 2YKQA 1U7MA 3CCQP 2XKMA 4UB6H 1M1JC 5B5EH 1RQUA 3P8MC 1AJYA 1VF5C 3VP9A 1SQXD 3CCRP 5BU5A 4BRYB 4JPZB 1N7SD 2OYHB 4JF7A 3EZ6A 2K88A 3CXHD 3G71P 3RGUA 3Q3DA 2WSSH 2KI7B 3L71D 2E76C 4TT3H 3TDKA 5AW3B 5KLIB 1OVRA 3JCUH 1M57D 1WMKA 1OXZA 3G3ZA 2WTYA 2N1TC 1NTMD 3H1IG 3H1HE 4EIJA 3GK6A 3O8ZA 1SFCD 5C39A 3AE6C 5KAFH 5TISE 2J5UA 2E43A 3HE4B 4PD4E 1RE3A 4HB1A 1GTWA 3HE4A 4I2LC 3C1LA 1FJPA 3H1KG 2ITAA 3AE9C 3CC2P 2K1AA 2BEZF 4EDFA 2B88A 1KTMA 1YJ9P 3L74E 3CC7P 1PV3A 1JY3N 1EC5A 2QE7H 1DIPA 2IEFA 5KLIC 2MJZA 2JEEA 2JKVA 1Q0AA 2WMMA 1KILE 4YXDC 1SP4A 3BCCG 2ZAEB 2R5BA 3WUUA 5CCHD 2OG0A 4RESB 3MD0A 4LC1A 2NRGA 3EZ9A 2A45H 1L0LJ 2WSCJ 3RL0g 1BGYG 2D2CD 4MN4C 1DEEG 2QJKB 2O1JA 2GUVA 3SFEC 3MUDA 3H1KJ 3CMAP 4WB4A 2WSEJ 1EXIA 2FYUD 4KHXA 2XNDH 1Q07A 2K9YA 2M5AA 3RBXA 3D6YA 2FFDC 3HUSB 2I1KA 3RK3D 1FZAA 5AW4B 4C7RA 3RK3B 3QAOA 4OWFA 4Y99C 2BASA 2KYVA 3TYYA 3KQGA 1Q2NA 2POHA 4UB6E 1EDLA 3L73D 4B86A 3WUVA 3C8VA 2HODB 3IR9A 3A0HH 2KXPB 2Z5HA 3E1IA 4HH2A 3IF4A 3FXDA 2J58A 2QM7A 1LT9B 1SQVE 3S4RA 1JCCA 3M0DA 1YQ3C 2ZXXA 2PP6A 1PZQA 2R32A 2PAJA 3HE5B 5AVXB 1CSBA 4PV1D 3HE5A 3CL3D 4H13D 2FYZA 1Q86Q 1J1DB 3H1HD 1M1KQ 1S5LH 2QEXP 1R8DA 1IC2A 3Q1MA 4U3FG 1ZR4A 3H1LD 1GZLA 1JY3O 3VP8A 1YQ4C 4LLHA 2A06E 2DW3A 5APXA 4O9BA 2RH0A 3I55P 1G2CA 4I7ZC 3Q2YA 2ZT9C 3RK2D 1G2CB 4N78D 5KAIE 4OH8B 3KHUA 1JB0J 1L4AA 2P67A 2IBZD 4H0LB 1X8YA 4L75A 1G1JA 3PLNA 2OYHA 3A0BH 2WZ7A 4Z1MH 2Q6QA 3L75D 1USDA 1RY3A 1M1JA 5KAUA 2W27A 2PRRA 2KSEA 3H1IE 4BWNA 1QEXA 2BCCD 1ZXGA 1Q06A 1KYOI 3TGUE 4D6TD 2LXBA 2WSFJ 3M06A 3GPVA 1K05A 1T6AA 2YO3A 4J2NA 2JWDA 1MUUA 4RO0A 2K3RA 2KUBA 2HPCA 1GD2E 2OYIB 1T8ZA 2ZHGA 5AVVB 1CW5A 1ZRTE 2BCCG 2C9NY 5CJ0A 1DH3A 2XU6A 1HVVA 4PJ0E 2A06G 5KLVK 3TGUG
chains in the Genus database with same CATH topology
2H88C 1PM6A 3EZ7A 3AE4C 1JBGA 3AEFC 2JMLA 4GDOA 1KQGB 2WSCJ 1GMJA 1R8DA 3Q1MA 3RL0g 2D2CD 1IK7A 1PIXA 1Y9BA 3Q5RA 2H89C 1BOWA 2KCUA 2QJYC 2D2CB 2D2CC 1YQ4C 4I7ZB 4R4LA 3SFEC 2E76B 3EWKA 2QIWA 5D8CA 1NYHA 1UIXA 2QSIA 1RQUA 1AJYA 3AE3C 1TU3F 2WSEJ 1HF9A 1U57A 1EXIA 2ZT9D 4R24B 1VF5C 2E75D 4PV1C 1Q05A 4WLWA 2O01J 1Q07A 5I44A 2ZT9B 3Q2YA 2K9YA 4I7ZC 2ZT9C 1ZMEC 3ABVC 4OGQC 1RQVA 1JYHA 5GQQA 4Y28J 3EZ6A 1KMIZ 1HJ0A 4U7JA 4OGQD 2HVAA 3R8JA 3Q3DA 1JB0J 4H0LB 1NGMB 1LX8A 3RK3E 3D6YA 2IDBA 3AE8C 2E76C 1EXJA 3AE5C 2WQYC 1VF5D 3AE1C 3HH0A 4TT3H 3E0HA 2WPVB 2ZHHA 1KORA 3G9RA 4H44B 4YTPC 3D71A 1Q90D 4KT0J 1PL5A 5D90A 1WMKA 5KAWA 1RH6A 2FXPA 3QAOA 3FGAD 2E75C 5KCBA 4Z1MH 3GK6A 3GF7A 3AEEC 2E76D 2FYNC 5L8RJ 1S5LX 5M1BA 3EZ2A 3AE6C 4R22B 4R4EA 1Y6UA 1VL2A 4B0YA 2P10A 5KAXA 2J5UA 3LURA 3AEBC 1KQFB 3GF3A 1Q08A 1K04A 2YMKA 3AEDC 1FDOA 2OQQA 5KAUA 2JO1A 2FBWC 1MKMA 4H44D 2KVVA 3LW5J 3EZFA 3C8VA 2BEQD 3B71A 3S9OA 2VZ4A 1OMIA 4WLSA 3AEAC 4H13B 2DG6A 2YIUC 4AYZA 2NZ2A 3Q5PA 4A1MA 2JP3A 4AYZB 1OW7A 3UCSA 4LHFA 3AE9C 4H44C 3D70A 3O6QA 3R4YA 1Q06A 3AE2C 1OW6A 3IAOA 2E74C 2BEZF 2QJKC 2GOVA 1KTMA 4PV1B 4H0LC 2G3AA 3R8KA 3T97B 1DD3A 2WSFJ 4RKUJ 3GP4A 3GPVA 1K05A 3GLMA 2E75B 1PV3A 4J2NA 3AEGC 4IL6X 1Q09A 4R4MA 2MKVA 3B49A 1DD4A 3AE7C 1D5YA 4H13C 2E74B 2IEFA 5KLIC 2QJPC 5E01A 1YQ3C 1DIPA 1FDIA 1ZOYC 3SFDC 1Q0AA 2V7QJ 1KILE 3AECC 2E74D 2ZHGA 4YXDC 4H0LD 3Q5SA 1ZRTE 5KATA 1OW8A 4DCZA 3D6ZA 4XFJA 3H25A 5KKZC 2BOWA 1S1CX 2OG0A 4OGQB 5KAVA 4PV1D 3GMAA 3IN6A 4H13D 1R8EA 2G8YA 3EZ9A 1VF5B 5I41B 1ZP0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5U A;  3LUR A;  3R8K A;  3GP4 A;  1JBG A;  2JML A;  3GPV A;  4J2N A;  1Q08 A;  4R4M A;  1Q09 A;  3Q3D A;  1R8D A;  2OQQ A;  2HVA A;  5KAU A;  3Q1M A;  3B49 A;  3D6Y A;  1D5Y A;  1EXJ A;  1DIP A;  3Q5R A;  3E0H A;  5E01 A;  3HH0 A;  1BOW A;  2KCU A;  2ZHH A;  3G9R A;  1Q0A A;  4R4L A;  3D71 A;  2VZ4 A;  4WLS A;  2ZHG A;  5D90 A;  5D8C A;  2DG6 A;  3Q5S A;  4AYZ A;  5KAW A;  5KAT A;  3Q5P A;  4A1M A;  3D6Z A;  3QAO A;  1EXI A;  5GQQ A;  4R24 B;  2BOW A;  5KCB A;  3R8J A;  4AYZ B;  3UCS A;  5KAV A;  3GK6 A;  1Q05 A;  4WLW A;  3D70 A;  1Q07 A;  5I44 A;  1Q06 A;  3Q2Y A;  3IAO A;  1R8E A;  4R22 B;  4R4E A;  2GOV A;  4B0Y A;  5I41 B;  1JYH A;  5KAX A;  3T97 B; 
#chains in the Genus database with same CATH topology
 2H88 C;  4GT1 A;  3FXE A;  1CI6 A;  5KLV J;  5K5G B;  1Z56 A;  3TNU A;  4WWI A;  3BAT A;  1PPJ E;  3CCE P;  1S2E A;  4I1L A;  2XDJ A;  1NYH A;  2E75 D;  1VQ7 P;  2O01 J;  1RHZ B;  4IFF A;  1SQB K;  1GK4 A;  1HWT C;  1NTZ J;  2N9Y B;  3V4W A;  5CCG A;  3V2P A;  1BE3 G;  3H1L G;  3L70 G;  1R5L A;  1LP1 A;  2IBZ G;  1VQM P;  3CI9 A;  1VQ5 P;  1S3J A;  5KAW A;  1N2D C;  2KB7 P;  3H1J D;  2E75 C;  3H1J G;  5KCB A;  2JDI H;  3WUT A;  1Q7Y Q;  4OVN F;  3CCL P;  1P84 E;  1J2J B;  3M0D C;  1OWA A;  1VPC A;  1LTT C;  2AEM A;  5KAF E;  1FDO A;  1BCC D;  4N6J A;  2A06 D;  3LW5 J;  1RE3 C;  5CHX A;  1NTK J;  1H88 A;  4W7Z A;  1FBM A;  4AYZ A;  2GM4 A;  1L4A B;  2E5T A;  1SFC A;  1VQO P;  3A3Y B;  3H32 A;  3RBZ A;  1JMM A;  1JEK A;  3R8K A;  1KQL A;  1DD3 A;  3GP4 A;  1SQQ G;  5AW2 B;  5AW6 B;  4PD4 I;  5GTI E;  1J1D C;  1BSH A;  1PP9 D;  3AEC C;  5AVS B;  2C0W A;  3L74 G;  3V2R A;  1SQV D;  3L70 J;  3KPE A;  2VRS A;  1SQP J;  1KQS O;  2Y0E A;  1SQQ D;  2IBZ I;  1RF1 A;  1GL2 B;  1JOC A;  1NAF A;  1HUC A;  3USS A;  5H2F E;  1UIX A;  3AE3 C;  2UWJ E;  4WLW A;  2OYO A;  3H1J E;  3B5N C;  2Y9Y A;  1YJW P;  3CX5 H;  1PGJ A;  3AE8 C;  1EXJ A;  2W6A A;  3QH9 A;  4L73 A;  1LTB C;  2IYP A;  1NTZ K;  1E79 H;  3TNU B;  2FXO A;  4N3Y B;  1QL1 A;  2WPR A;  5M1B A;  1KIL B;  4R4E A;  2ZJS E;  1VL2 A;  4CPG A;  1BDC A;  5CJ4 A;  3GF3 A;  1W5C E;  1KC8 Q;  1N7S A;  4BRY A;  4NPF X;  4AQR D;  2P7J A;  3PH0 A;  4XE5 B;  2JP3 A;  2P1J A;  3TGU J;  1KB9 H;  3CD6 P;  4H44 C;  3D70 A;  4WVZ A;  2E74 C;  1IK9 A;  2QJK C;  3F89 A;  3CX5 I;  4UB8 E;  1A02 J;  2B87 A;  3EQ2 A;  1E5W A;  5KAI H;  3CME P;  2QM8 A;  5KAT A;  3HD7 B;  3TSI A;  5KKZ C;  3A7O A;  1NH4 A;  1VDF A;  2YXR B;  5I41 B;  1K9M Q;  3CCV P;  1NU1 K;  3A5T A;  1IFI A;  3E7K A;  1S5L E;  4HYT B;  2KNC A;  2W6J H;  4I7Z B;  2E76 B;  5D8C A;  2KLU A;  5APT A;  4R24 B;  2CPB A;  3VOP A;  1VQN P;  5AVW B;  4OGQ C;  1LTS C;  3BRT B;  3NTN A;  3BRV B;  4OGQ D;  1LX8 A;  2W6B A;  1QVF O;  3HH0 A;  3HTK A;  4H44 B;  2KS1 B;  2Y0D A;  5E79 E;  3GF7 A;  1SQB D;  4EOT A;  3GG2 A;  5H2F H;  1L0N D;  1A02 F;  2WPS A;  2I1J A;  1X0T A;  2J59 M;  5AW0 B;  3M9B A;  1AQT A;  2BEQ D;  1KB9 D;  2VZ4 A;  3HUS C;  2E42 A;  1FZC A;  2XV5 A;  1KV4 A;  2FYU J;  3MUD C;  1QGK B;  2K37 A;  3HUS A;  1W2E A;  4C7N B;  1S9K D;  1PP9 G;  4C7N A;  3CWB G;  2B89 A;  3EFG A;  1BCC G;  3RL0 B;  3AE7 C;  3NMD A;  2AXT H;  2HR3 A;  4GOE A;  1YBK A;  1LTJ B;  4HKZ H;  1S9K E;  1VQL P;  1R8E A;  3L70 E;  3EZ7 A;  4GDO A;  2JML A;  1BE3 D;  1QL2 A;  2M3B A;  1Y9B A;  3VMA A;  2D2C B;  1KN7 A;  3GHG C;  1SQP G;  3EWK A;  5APS A;  3V2N A;  3MGN A;  4U3F J;  4K3A A;  1HF9 A;  1NKN A;  2O01 N;  3L74 J;  1Q05 A;  2WT7 B;  1ZME C;  2WIT A;  2WT7 A;  1HJ0 A;  4ZKU A;  1L0N G;  1EZV G;  2YMY A;  5APQ A;  3RK3 E;  1SQV G;  5AVT B;  1SQX G;  2FFD A;  1KFM A;  4ZMD A;  4A7P A;  5AW8 B;  1T2K C;  2AXT E;  2AEJ A;  2WVR A;  1T3J A;  2FYN C;  2HOD A;  3SWY A;  3CX5 D;  1JY2 N;  3SWF A;  1KQF B;  3RK3 C;  3AED C;  2OQQ A;  4DCK A;  4K35 A;  1OVU A;  1OIP A;  3T97 A;  2DG6 A;  1JTH A;  4GOF A;  1NU1 D;  4XA4 A;  1S4X A;  1URQ B;  1Q09 A;  4L76 A;  1DD4 A;  4H13 C;  2GA1 A;  3L75 G;  3U59 A;  1X9V A;  3CLQ A;  3JC2 2;  1YIJ P;  4DCZ A;  3W68 A;  4AUW A;  2V7Q H;  3BAS A;  2FKW B;  3L75 J;  3VMY A;  4PD4 D;  4ZNC A;  3WU2 H;  1BGY J;  1VQ9 P;  2OYI C;  3L75 E;  1RQV A;  2N1T A;  4DT0 A;  3B5N B;  1MFZ A;  4DZO A;  3G6E P;  3G9R A;  3GW6 A;  1QX8 A;  3D71 A;  1GU4 A;  3BVH A;  1P84 I;  1T3U A;  4IFM A;  1YJN P;  3HTK B;  3L4F A;  5AW7 B;  1G1I A;  4JYB A;  1SS1 A;  1K04 A;  2Q5U A;  1KYO H;  4ASV A;  3MZW B;  3EZF A;  3ITK A;  3C9I A;  3PJS K;  2YIU C;  2NPS D;  1WRG A;  3II6 A;  1LGH B;  1CI6 B;  1N8R Q;  4LHF A;  2QJP B;  2B87 B;  2KOG A;  4RKU J;  5CBO A;  3L72 E;  2OAR A;  3H1I J;  2MKV A;  5CBN A;  3L71 J;  2E74 B;  2QJP C;  1FDI A;  1ZOY C;  3SFD C;  2ZYG A;  4H0L D;  1LTI C;  4ZKP A;  1ZR2 A;  1L4A C;  1EDK A;  1NTM J;  2BOW A;  5CCG C;  2V4H A;  3CX5 E;  2QVA A;  1URQ C;  1H89 A;  1N73 A;  1M7L A;  1EZV E;  1IFN A;  3LW5 H;  3OAK A;  4YPC A;  3Q5R A;  2A45 I;  1BOW A;  4IL6 H;  1NTK D;  3KZI H;  3G4S P;  2ZT9 D;  1BSN A;  2FYU G;  4WY4 C;  2PFX A;  4PV1 C;  2ZT9 B;  3HD7 D;  4Y28 J;  5KTB A;  5B66 E;  3CXH I;  1MZ9 A;  2WPV B;  2KZI A;  1PP9 J;  2FY8 A;  1JUN A;  2O01 H;  1RH6 A;  1BE3 E;  2O1K A;  1LP1 B;  1L2P A;  4R22 B;  5BVZ A;  2P10 A;  3CWB D;  3AEB C;  1VQ6 P;  2IX7 C;  4EYY Q;  2QG4 A;  5KLV G;  2IZ0 A;  1NO4 A;  3WMM 0;  3OJA B;  1PGP A;  1KFN A;  1MV8 A;  1OW7 A;  2I8D A;  1CZQ A;  2KZJ A;  1BDD A;  2ZXE B;  3O6Q A;  1M90 Q;  3T97 B;  1JTH B;  3AEG C;  3BCC J;  1L0N K;  4WBA A;  3HRN A;  1FU1 A;  4AYC A;  2AXC A;  1Y47 A;  2Y9Z A;  1YYC A;  3B8E B;  3RL0 C;  1OW8 A;  3KXD A;  3L72 G;  3B5N D;  1FZF A;  3L36 A;  2LXC B;  4UB8 H;  3GHG A;  4W80 A;  4Y99 B;  1L0L K;  1LWU C;  2Q3I A;  3P32 A;  3VN0 A;  3VMX A;  1K8A Q;  1IFM A;  2RMZ A;  1L0L G;  3M9Q A;  4R4L A;  2QA4 P;  3KYQ A;  3NXS A;  1X79 B;  2R3S A;  1KB9 I;  1TU3 F;  2YNY A;  3M0A A;  1PGQ A;  2ZYA A;  5GQQ A;  1N7L A;  2H7H A;  3JCU E;  3FWL A;  5CCG D;  2NPS B;  1ZW0 A;  2ZFC A;  3AE1 C;  2IBZ E;  4JBZ A;  2WPQ A;  1JCD A;  1HTL C;  3L72 J;  1VQK P;  1NTM K;  1SQB E;  1S5L X;  1NOH A;  3H1H J;  3MHV A;  1YI2 P;  2YXQ B;  2YMK A;  3L37 A;  1R5S A;  3M9H A;  2ZVO B;  2OYI A;  2HYN A;  2LKM A;  1GDT A;  2IPP A;  3Q5P A;  1LWU B;  3UCS A;  3MIW A;  3S1K A;  2G3A A;  4DJG A;  3SSU A;  3GLM A;  1AVY A;  2RN0 A;  2YO2 A;  1IFP A;  1D5Y A;  2KLV A;  1N86 A;  1AV1 A;  3CCS P;  1WT6 A;  3CWB E;  5B66 H;  4ASW A;  2CK3 H;  4D6T G;  3CXH H;  3N4X A;  1SQP K;  1JBG A;  1JMB A;  1NU1 G;  3L73 J;  1FOS E;  2QSI A;  2KK7 A;  1ZLL A;  3LIE A;  3VYI A;  4W7Y A;  1LTJ A;  4U7J A;  2HVA A;  4NPE A;  2KSJ A;  1RF1 B;  3AE5 C;  2ZHH A;  2WSF H;  3BCC E;  1EZV D;  1NTM G;  3AEE C;  2N1T D;  2N9B A;  4B0Y A;  2KS1 A;  2FYU E;  5KAX A;  3VMZ A;  1AVO A;  1SFC C;  5KLV D;  1KIL C;  3S9O A;  1OMI A;  3JSV C;  1LJ2 A;  2R5D A;  4GKG A;  4AYZ B;  4DOJ A;  3CCJ P;  2Q7C A;  5DJT B;  3I5C A;  4GOD A;  2OYH C;  1LT1 A;  1QVG O;  3VTP C;  1KIL D;  1ZV8 A;  1N7S B;  1FOS F;  2V7Q J;  5TIS H;  1OFC X;  2Z5I A;  1SQQ E;  1SQV K;  1P84 D;  1KYO D;  3W67 A;  2Q9I A;  2W90 A;  1BCC J;  4I6M C;  1T2K D;  3GHG B;  1EDJ A;  2D2C C;  2YKP A;  1NHL A;  2GUS A;  1NU1 J;  3HD7 A;  2BCC J;  3L73 G;  1YIT P;  2JWA A;  1PPJ G;  2CPS A;  2KP8 A;  2FFD B;  1IFD A;  3ABV C;  4D6T J;  1NTM E;  1GL2 D;  3A0B E;  1XTG B;  1SQQ K;  4QMA A;  3E0H A;  2WQY C;  1VF5 D;  2R44 A;  3TF5 A;  2QJY B;  1KOR A;  2KNC B;  1SVF A;  3L71 E;  3I56 P;  1PL5 A;  2R3C A;  2OGU A;  2E5Y A;  2L5G B;  4IFD K;  1VQ4 P;  1OX3 A;  1LT9 C;  1HGZ A;  2E76 D;  5L8R J;  3EZ2 A;  1Y6U A;  1SQP D;  1GL2 C;  1XTC C;  3UIA A;  2FXM A;  1N7S C;  1URQ A;  3B71 A;  1EQ7 A;  1BGY D;  1AA0 A;  2P58 A;  1FDM A;  4YXW H;  1YTZ T;  1SQX J;  2FYU K;  3L71 G;  3B4S A;  4D6T E;  3IAO A;  1NWQ A;  1EDI A;  2OTL P;  1UII A;  1NTZ G;  2BCC E;  4R4M A;  1M1J B;  1N73 C;  1SFC B;  4LGD E;  3V4Q A;  4L74 A;  2OTK E;  1LTJ C;  1FZC B;  3H25 A;  2W83 C;  3H6P A;  5KAV A;  2WSE H;  4WY4 A;  4C46 A;  1BGY E;  1YTZ I;  1FZC C;  1KQG B;  1LNQ A;  3IFM A;  1H0T B;  2H89 C;  2WSC H;  1NAY A;  1RF1 C;  2N1T B;  1P84 H;  1JY3 P;  4IL6 E;  1SQP E;  1EZV I;  3TGU D;  5I44 A;  4N78 E;  1HBW A;  1J1E B;  3H1H G;  1NU1 E;  5KKZ B;  3RK2 C;  3H1I D;  5BU8 B;  3R8J A;  1NGM B;  4BXL A;  2M5A B;  1PFI A;  1Q90 D;  2IZ1 A;  3H1L E;  1SQV J;  3L70 D;  4EI2 A;  2RKL A;  1H8A A;  3PP5 A;  1L0L D;  2NPS C;  5CMZ A;  1JO5 A;  1SQQ J;  2XZR A;  2L91 A;  3ZDM A;  2KVV A;  1SLQ A;  3F5H A;  2NPS A;  1RE4 A;  4WLS A;  1LT9 A;  3H1K D;  1RE4 C;  1KYO E;  3R4Y A;  5AVU B;  2SPZ A;  2GOV A;  4H0L C;  1RF0 A;  2WWW A;  3B49 A;  5APW A;  1RF0 C;  5E01 A;  3E1R A;  1HGV A;  1MFT A;  3MTU E;  1GW3 A;  3L73 E;  4XFJ A;  3HD7 C;  5TJH A;  1NTZ E;  1Y8A A;  1S1C X;  3GMA A;  5B5E E;  1ZP0 C;  3CWB J;  1PM6 A;  3AE4 C;  4U3F E;  1L0N J;  1VQP P;  1OVV A;  2KCU A;  4RJT A;  1KZU B;  2Z4E A;  1GK6 A;  5KLV E;  2YIU B;  1NVO A;  1L0L E;  1GU5 A;  2QRX A;  3PTZ A;  1IO4 A;  1JYH A;  3OA7 A;  5APY A;  3CPW O;  2IFN A;  3BCC D;  3R2P A;  4PJ0 H;  1KB9 E;  1OZH A;  1Q81 Q;  4YTP C;  3NFQ A;  5D90 A;  1L0N E;  1K73 Q;  1U7J A;  2FXP A;  4TLF A;  3FGA D;  1H0T A;  1NTK G;  5EFW B;  3LUR A;  2Q1K A;  5AVR B;  1Q08 A;  4KJM A;  3H1L J;  1NTK K;  3P7K A;  1NTK E;  3CC4 P;  2LR2 A;  1LTA C;  2M8R A;  1DX7 A;  4WY4 B;  2HFE D;  2K9J A;  2ZYD A;  2C9L Y;  2Y0C A;  3L74 D;  2HPC B;  1OW6 A;  2JR8 A;  4M3L A;  3RL0 D;  3FX0 A;  2ZVN B;  1Q82 Q;  2E75 B;  5KJ7 D;  1AQ5 A;  1RH5 B;  5KJ7 C;  1M8O B;  1L4A D;  3D6Z A;  1QLE D;  1GW4 A;  1URQ D;  3L72 D;  3A2A A;  1SQX K;  1SQB J;  3IN6 A;  3B5N A;  3V2Q A;  3A0H E;  2H8P D;  1W2B O;  3KZI E;  1DEB A;  1U57 A;  3N7N A;  5GTI H;  5KJ7 A;  5APU A;  1N73 B;  1KMI Z;  5E79 H;  3K5B A;  1S72 P;  2XNX A;  2FYN B;  4KT0 J;  1JM0 A;  3CCM P;  4WY4 D;  5GTH H;  1M56 D;  2W8Z A;  1YHQ P;  1IJD B;  4PD4 H;  3WU2 E;  1BE3 J;  1FE6 A;  1ZN5 A;  2FBW C;  1MKM A;  1KD1 Q;  1PP9 E;  5CCH A;  1SQB G;  3AEA C;  4H13 B;  3PHL A;  3EFF K;  4IOI H;  3CXH E;  4A1M A;  4U3F D;  3O6Q B;  2P2U A;  3CCU P;  2YKO A;  3P8C E;  1SQX E;  1D7M A;  1NTZ D;  3L35 A;  1LWU A;  1J1E C;  4JQ0 D;  1HH0 A;  1JY2 O;  1IFJ A;  1LTG C;  1BCC E;  3H1J J;  4OGQ B;  5AVZ B;  2G8Y A;  2M3E A;  3SWK A;  3LID A;  3H1K E;  3QWO C;  1IZN B;  2JJL A;  1FZG A;  1IK7 A;  1PIX A;  4GIF A;  5AVQ B;  3V6I A;  2QJY C;  2QIW A;  1X22 A;  1FS0 E;  1FZE A;  3PRJ A;  1FAV A;  2AEF A;  2H43 A;  2C0X A;  3RK2 B;  2PGD A;  2K9J B;  1FZB A;  5APV A;  2IYO A;  2IDB A;  1PPJ D;  3H32 B;  1FC2 C;  3M91 A;  1FJK A;  1JY2 P;  3U1C A;  5DJU B;  4JYC A;  4HJG H;  1NKZ B;  2JO1 A;  1ZRT D;  4H44 D;  5AVY B;  3U1A A;  3MP7 B;  1KIL A;  5CCH C;  5AW9 B;  1USE A;  2NZ2 A;  5AW5 B;  1PGO A;  1VQ8 P;  2OTJ P;  2B9B A;  1NJI Q;  1GL2 A;  5AW1 B;  3AE2 C;  2O3J A;  1HJB A;  4PV1 B;  3P8C D;  4NPD A;  2HG5 D;  3V5B A;  4IL6 X;  1JNM A;  5GTH E;  3KDP B;  2E74 D;  2M0B A;  2IFM A;  3Q5S A;  3OW2 O;  2Q3E A;  1AFO A;  3TK1 A;  2KIK A;  1VF5 B;  3AEF C;  3FWN A;  1GMJ A;  2HLO A;  2A45 G;  2YKQ A;  1U7M A;  3CCQ P;  2XKM A;  4UB6 H;  1M1J C;  5B5E H;  1RQU A;  3P8M C;  1AJY A;  1VF5 C;  3VP9 A;  1SQX D;  3CCR P;  5BU5 A;  4BRY B;  4JPZ B;  1N7S D;  2OYH B;  4JF7 A;  3EZ6 A;  2K88 A;  3CXH D;  3G71 P;  3RGU A;  3Q3D A;  2WSS H;  2KI7 B;  3L71 D;  2E76 C;  4TT3 H;  3TDK A;  5AW3 B;  5KLI B;  1OVR A;  3JCU H;  1M57 D;  1WMK A;  1OXZ A;  3G3Z A;  2WTY A;  2N1T C;  1NTM D;  3H1I G;  3H1H E;  4EIJ A;  3GK6 A;  3O8Z A;  1SFC D;  5C39 A;  3AE6 C;  5KAF H;  5TIS E;  2J5U A;  2E43 A;  3HE4 B;  4PD4 E;  1RE3 A;  4HB1 A;  1GTW A;  3HE4 A;  4I2L C;  3C1L A;  1FJP A;  3H1K G;  2ITA A;  3AE9 C;  3CC2 P;  2K1A A;  2BEZ F;  4EDF A;  2B88 A;  1KTM A;  1YJ9 P;  3L74 E;  3CC7 P;  1PV3 A;  1JY3 N;  1EC5 A;  2QE7 H;  1DIP A;  2IEF A;  5KLI C;  2MJZ A;  2JEE A;  2JKV A;  1Q0A A;  2WMM A;  1KIL E;  4YXD C;  1SP4 A;  3BCC G;  2ZAE B;  2R5B A;  3WUU A;  5CCH D;  2OG0 A;  4RES B;  3MD0 A;  4LC1 A;  2NRG A;  3EZ9 A;  2A45 H;  1L0L J;  2WSC J;  3RL0 g;  1BGY G;  2D2C D;  4MN4 C;  1DEE G;  2QJK B;  2O1J A;  2GUV A;  3SFE C;  3MUD A;  3H1K J;  3CMA P;  4WB4 A;  2WSE J;  1EXI A;  2FYU D;  4KHX A;  2XND H;  1Q07 A;  2K9Y A;  2M5A A;  3RBX A;  3D6Y A;  2FFD C;  3HUS B;  2I1K A;  3RK3 D;  1FZA A;  5AW4 B;  4C7R A;  3RK3 B;  3QAO A;  4OWF A;  4Y99 C;  2BAS A;  2KYV A;  3TYY A;  3KQG A;  1Q2N A;  2POH A;  4UB6 E;  1EDL A;  3L73 D;  4B86 A;  3WUV A;  3C8V A;  2HOD B;  3IR9 A;  3A0H H;  2KXP B;  2Z5H A;  3E1I A;  4HH2 A;  3IF4 A;  3FXD A;  2J58 A;  2QM7 A;  1LT9 B;  1SQV E;  3S4R A;  1JCC A;  3M0D A;  1YQ3 C;  2ZXX A;  2PP6 A;  1PZQ A;  2R32 A;  2PAJ A;  3HE5 B;  5AVX B;  1CSB A;  4PV1 D;  3HE5 A;  3CL3 D;  4H13 D;  2FYZ A;  1Q86 Q;  1J1D B;  3H1H D;  1M1K Q;  1S5L H;  2QEX P;  1R8D A;  1IC2 A;  3Q1M A;  4U3F G;  1ZR4 A;  3H1L D;  1GZL A;  1JY3 O;  3VP8 A;  1YQ4 C;  4LLH A;  2A06 E;  2DW3 A;  5APX A;  4O9B A;  2RH0 A;  3I55 P;  1G2C A;  4I7Z C;  3Q2Y A;  2ZT9 C;  3RK2 D;  1G2C B;  4N78 D;  5KAI E;  4OH8 B;  3KHU A;  1JB0 J;  1L4A A;  2P67 A;  2IBZ D;  4H0L B;  1X8Y A;  4L75 A;  1G1J A;  3PLN A;  2OYH A;  3A0B H;  2WZ7 A;  4Z1M H;  2Q6Q A;  3L75 D;  1USD A;  1RY3 A;  1M1J A;  5KAU A;  2W27 A;  2PRR A;  2KSE A;  3H1I E;  4BWN A;  1QEX A;  2BCC D;  1ZXG A;  1Q06 A;  1KYO I;  3TGU E;  4D6T D;  2LXB A;  2WSF J;  3M06 A;  3GPV A;  1K05 A;  1T6A A;  2YO3 A;  4J2N A;  2JWD A;  1MUU A;  4RO0 A;  2K3R A;  2KUB A;  2HPC A;  1GD2 E;  2OYI B;  1T8Z A;  2ZHG A;  5AVV B;  1CW5 A;  1ZRT E;  2BCC G;  2C9N Y;  5CJ0 A;  1DH3 A;  2XU6 A;  1HVV A;  4PJ0 E;  2A06 G;  5KLV K;  3TGU G; 
#chains in the Genus database with same CATH homology
 2H88 C;  1PM6 A;  3EZ7 A;  3AE4 C;  1JBG A;  3AEF C;  2JML A;  4GDO A;  1KQG B;  2WSC J;  1GMJ A;  1R8D A;  3Q1M A;  3RL0 g;  2D2C D;  1IK7 A;  1PIX A;  1Y9B A;  3Q5R A;  2H89 C;  1BOW A;  2KCU A;  2QJY C;  2D2C B;  2D2C C;  1YQ4 C;  4I7Z B;  4R4L A;  3SFE C;  2E76 B;  3EWK A;  2QIW A;  5D8C A;  1NYH A;  1UIX A;  2QSI A;  1RQU A;  1AJY A;  3AE3 C;  1TU3 F;  2WSE J;  1HF9 A;  1U57 A;  1EXI A;  2ZT9 D;  4R24 B;  1VF5 C;  2E75 D;  4PV1 C;  1Q05 A;  4WLW A;  2O01 J;  1Q07 A;  5I44 A;  2ZT9 B;  3Q2Y A;  2K9Y A;  4I7Z C;  2ZT9 C;  1ZME C;  3ABV C;  4OGQ C;  1RQV A;  1JYH A;  5GQQ A;  4Y28 J;  3EZ6 A;  1KMI Z;  1HJ0 A;  4U7J A;  4OGQ D;  2HVA A;  3R8J A;  3Q3D A;  1JB0 J;  4H0L B;  1NGM B;  1LX8 A;  3RK3 E;  3D6Y A;  2IDB A;  3AE8 C;  2E76 C;  1EXJ A;  3AE5 C;  2WQY C;  1VF5 D;  3AE1 C;  3HH0 A;  4TT3 H;  3E0H A;  2WPV B;  2ZHH A;  1KOR A;  3G9R A;  4H44 B;  4YTP C;  3D71 A;  1Q90 D;  4KT0 J;  1PL5 A;  5D90 A;  1WMK A;  5KAW A;  1RH6 A;  2FXP A;  3QAO A;  3FGA D;  2E75 C;  5KCB A;  4Z1M H;  3GK6 A;  3GF7 A;  3AEE C;  2E76 D;  2FYN C;  5L8R J;  1S5L X;  5M1B A;  3EZ2 A;  3AE6 C;  4R22 B;  4R4E A;  1Y6U A;  1VL2 A;  4B0Y A;  2P10 A;  5KAX A;  2J5U A;  3LUR A;  3AEB C;  1KQF B;  3GF3 A;  1Q08 A;  1K04 A;  2YMK A;  3AED C;  1FDO A;  2OQQ A;  5KAU A;  2JO1 A;  2FBW C;  1MKM A;  4H44 D;  2KVV A;  3LW5 J;  3EZF A;  3C8V A;  2BEQ D;  3B71 A;  3S9O A;  2VZ4 A;  1OMI A;  4WLS A;  3AEA C;  4H13 B;  2DG6 A;  2YIU C;  4AYZ A;  2NZ2 A;  3Q5P A;  4A1M A;  2JP3 A;  4AYZ B;  1OW7 A;  3UCS A;  4LHF A;  3AE9 C;  4H44 C;  3D70 A;  3O6Q A;  3R4Y A;  1Q06 A;  3AE2 C;  1OW6 A;  3IAO A;  2E74 C;  2BEZ F;  2QJK C;  2GOV A;  1KTM A;  4PV1 B;  4H0L C;  2G3A A;  3R8K A;  3T97 B;  1DD3 A;  2WSF J;  4RKU J;  3GP4 A;  3GPV A;  1K05 A;  3GLM A;  2E75 B;  1PV3 A;  4J2N A;  3AEG C;  4IL6 X;  1Q09 A;  4R4M A;  2MKV A;  3B49 A;  1DD4 A;  3AE7 C;  1D5Y A;  4H13 C;  2E74 B;  2IEF A;  5KLI C;  2QJP C;  5E01 A;  1YQ3 C;  1DIP A;  1FDI A;  1ZOY C;  3SFD C;  1Q0A A;  2V7Q J;  1KIL E;  3AEC C;  2E74 D;  2ZHG A;  4YXD C;  4H0L D;  3Q5S A;  1ZRT E;  5KAT A;  1OW8 A;  4DCZ A;  3D6Z A;  4XFJ A;  3H25 A;  5KKZ C;  2BOW A;  1S1C X;  2OG0 A;  4OGQ B;  5KAV A;  4PV1 D;  3GMA A;  3IN6 A;  4H13 D;  1R8E A;  2G8Y A;  3EZ9 A;  1VF5 B;  5I41 B;  1ZP0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...