1EXIA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exiA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exiA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exiA01
3GPVA 5I44A 1BOWA 2KCUA 1Q0AA 3B49A 3G9RA 1D5YA 1Q05A 3Q1MA 3Q5SA 2HVAA 1DIPA 1Q06A 3D71A 5KAUA 5KATA 5KAXA 4B0YA 1JYHA 1R8DA 2ZHHA 3Q5RA 2OQQA 2GOVA 4WLWA 3E0HA 4R4LA 4WLSA 3GK6A 5GQQA 3HH0A 3LURA 2DG6A 4AYZB 5I41B 1Q09A 1Q07A 1EXIA 5D90A 2ZHGA 1Q08A 4J2NA 3Q5PA 5KCBA 3GP4A 3D70A 5KAVA 4A1MA 3QAOA 3Q2YA 1R8EA 4R4MA 4R24B 3UCSA 3R8KA 2JMLA 3D6YA 2BOWA 5D8CA 3IAOA 3R8JA 5KAWA 1JBGA 4R22B 1EXJA 2VZ4A 3T97B 4R4EA 3D6ZA 5E01A 2J5UA 4AYZA 3Q3DA
chains in the Genus database with same CATH superfamily
4M3LA 1NKZB 1S1CX 3FGAD 1IK7A 1PP9E 1PFIA 1SQPJ 1X0TA 4IL6E 3NTNA 1K73Q 1MFZA 2KUBA 3BRTB 1FZCA 4D6TE 3I5CA 1JOCA 2WVRA 2HYNA 3EQ2A 2JDIH 4J2NA 3V2PA 3EZFA 1U7MA 4I6MC 5E01A 4H0LB 3B49A 3FX0A 1KFMA 3RK3C 4WVZA 2PAJA 1EDJA 1R8DA 3OW2O 4WLSA 1T3JA 4D6TG 2R44A 3M0DC 1R5SA 3H1LG 2IYOA 3H1KE 3L70J 1OVVA 2ZYGA 1KQLA 1SQQD 4W7ZA 2RMZA 1M8OB 1CI6A 3GHGA 3SFDC 1JTHA 3OJAB 3H1JE 2MJZA 2IFMA 4C7RA 1L0LJ 3WU2H 1BSHA 3ZDMA 1GU5A 1GL2C 1M57D 1T8ZA 3KZIH 1LTJC 2KZJA 2M5AA 1IFJA 1Y9BA 3II6A 3VMXA 1PM6A 5E79H 2WSSH 1HGZA 2WPSA 3L72D 3AE4C 5GTHH 2M8RA 2OYIC 1YYCA 5AVXB 4ZKPA 4Y99C 1ZXGA 1NTME 4H44C 3P8MC 2VZ4A 2JWAA 1RHZB 3SFEC 3CI9A 5TISH 1IFMA 3RK2D 3WU2E 2KSEA 5CCGC 5KTBA 1H0TA 4JYCA 4AYCA 3TNUB 3AEGC 5AVZB 2B87A 3L73E 3H1ID 3KZIE 1URQD 1KC8Q 2ZVNB 4WY4C 2FYUE 2FFDA 3QH9A 3BCCE 1SQVE 2RN0A 1NTMG 3EZ2A 1Q81Q 3L36A 1AVOA 5AW3B 4GDOA 3BATA 1A02F 1RE4C 1SQXE 1VQ7P 3L71J 4GKGA 1RQUA 1ZRTE 1YTZT 3RK3E 2H88C 1PGOA 1N73A 2YNYA 1NTKJ 3A0BH 4RO0A 5TISE 1HH0A 1KILD 1WMKA 1IFPA 2A45I 2I1JA 2W90A 4OH8B 3TK1A 3EZ6A 4KJMA 2FYUG 3QAOA 1JO5A 3BCCG 1IZNB 3IN6A 4XA4A 1Q05A 4QMAA 4EOTA 1G2CA 1WRGA 3RK3B 3TGUE 1YITP 1NTMK 1BGYD 2KNCB 1SQPE 2FKWB 2E76C 1LTIC 3AE2C 1JNMA 3A3YB 1K8AQ 3A5TA 3KPEA 2IZ0A 1L4AD 2W83C 3CWBJ 3P32A 3D6YA 4PV1C 4ASVA 2QJYC 4RJTA 2FYUK 5AVQB 3L74J 3CCJP 4C7NB 2L5GB 4PD4H 1NO4A 3RL0C 1FAVA 1SQPG 1HGVA 3PH0A 4JF7A 1YIJP 1SFCA 3L75D 2C9NY 1PPJD 1N7LA 1SQXK 3P8CD 1BDCA 5KCBA 1VF5C 1VQLP 3H1HD 1SQBJ 1KFNA 1BE3J 4R22B 3GHGC 2K3RA 3I56P 2IZ1A 2XV5A 5KAFH 1LTJB 3HTKA 5KKZC 3RK2B 3CXHD 1EXJA 3Q1MA 2Q3EA 4Y99B 3CX5D 3B4SA 2K1AA 4H44B 2KS1B 4IL6X 4JYBA 5AVTB 1L0LE 3V2QA 4PD4E 1NU1D 2HR3A 1LWUA 3FXEA 1SQPK 3L70G 5KAVA 2UWJE 2JP3A 1OW8A 3CPWO 3M9HA 2Y9ZA 4HB1A 2E42A 5BU8B 1W2EA 5B66H 2V7QJ 3MGNA 1QEXA 5KAFE 1MKMA 2A06E 3HUSC 1S3JA 2YIUC 3GP4A 4I1LA 1KILB 2ZT9D 3NFQA 5KJ7A 2BCCD 1L0LG 1VQ9P 3AEEC 2HVAA 1FZGA 4BXLA 3CXHI 2HPCA 1JB0J 1JMBA 2K9JB 2NPSA 2W6AA 2QG4A 2D2CC 1NTZJ 5CCHD 1MFTA 2FFDC 1HUCA 1Q86Q 3SWYA 3CX5I 2W6JH 2WPQA 1EZVD 1CSBA 5KATA 5B66E 1HJBA 2IEFA 1VPCA 4Y28J 5AVVB 3GLMA 3CD6P 1FZCB 4H0LD 3W68A 1PP9D 3G6EP 2Q5UA 1QL1A 3GMAA 5CBOA 3M9BA 3C9IA 1L0LK 1QVGO 1GK4A 4D6TD 2E76B 4R4LA 1NTKE 1LT9C 1YJNP 2ITAA 2POHA 3V4QA 1S5LH 1NGMB 1HF9A 4R4EA 1X9VA 3UIAA 3T97A 5APUA 4PV1B 4KT0J 2ZAEB 3E0HA 1T2KC 1Q09A 3L71G 3VMZA 5D90A 3I55P 2P10A 1IFDA 4BWNA 1VQKP 1U57A 1EZVI 4I7ZB 2BEQD 1BSNA 4DCZA 1DD4A 1KQGB 1NTKG 2N9YB 2OG0A 3CLQA 3H1KD 3U1CA 1VQPP 1CI6B 3GF3A 5L8RJ 1W5CE 3PTZA 3GHGB 2W6BA 1YJWP 2GUSA 2GA1A 4GT1A 1JUNA 2WSCJ 4IL6H 2DW3A 2ZVOB 3RBXA 4U3FE 5AW5B 1EQ7A 5C39A 5KKZB 1SFCC 1GW4A 3B5NC 1S5LE 1OXZA 1GZLA 1JY3P 3H1JD 1Q06A 1ZN5A 2LR2A 5GQQA 4O9BA 2OYOA 2G8YA 4IOIH 3B8EB 2N1TD 5APYA 2KIKA 1AQTA 3GF7A 2M5AB 3UCSA 1WT6A 2O01J 2H43A 1RE3A 4ZMDA 2ZT9B 1BE3E 2HLOA 4AUWA 2WSFH 4U3FG 1OZHA 1NTKK 4DCKA 3LIEA 1HVVA 2KB7P 2QJPB 2KZIA 3L74G 1HJ0A 1LWUC 3F89A 3B71A 3JC22 1NTMD 1IJDB 3H1LE 2E75C 1MZ9A 2FYZA 5DJTB 2J58A 1Q82Q 1P84H 1BE3G 1NKNA 2B87B 3L72J 2KXPB 2LXBA 1S9KE 2ZYAA 3WUVA 1D5YA 3L73D 5KJ7C 2ZHHA 1AFOA 1LTSC 1EDLA 5KLVJ 4C46A 3BCCD 1SQVD 3G3ZA 3Q2YA 1NAFA 2NPSC 1Q90D 4OGQC 2IYPA 4L76A 1SQXD 1N73B 2W8ZA 2WTYA 3Q5SA 2RKLA 1ZRTD 4NPDA 3RK3D 3H1IJ 3CCMP 1ZW0A 1NOHA 4OWFA 3LURA 4BRYA 2PGDA 1P84E 3AE5C 1N7SA 4YXDC 4DT0A 2GM4A 2K37A 1Q0AA 1RF0C 4GOEA 3HD7A 1LX8A 1G2CB 3VP9A 1RF1C 2Y0EA 3HH0A 1DEBA 3IFMA 2Q9IA 1GW3A 4RESB 3HE4A 2SPZA 4RKUJ 5APTA 3TGUD 1J1DB 3N4XA 5EFWB 1M1KQ 2Q3IA 4N78E 4IFFA 1NTZG 2OYHA 3ITKA 2IBZD 2P2UA 1KB9H 1GL2D 2B89A 3Q5PA 1FS0E 1OMIA 4WBAA 2XKMA 1FZEA 2P67A 2N1TB 4AYZA 5GTIE 3HUSA 2E5TA 1SFCB 1RH6A 2KK7A 5H2FH 2FBWC 2P7JA 1OW6A 4GODA 2ZHGA 3MUDA 1S2EA 4H44D 5I44A 4N6JA 5B5EH 3OAKA 1M56D 4IFMA 1NWQA 2QJKC 1PGQA 3RL0g 3R2PA 5CCGD 3GG2A 1KB9E 1FDIA 3KHUA 3RBZA 3L75J 4WWIA 3EFGA 1EC5A 1J2JB 2WSEJ 5CJ0A 4I2LC 4EIJA 1NJIQ 2R5DA 2Q6QA 3M06A 2W27A 4EYYQ 1XTGB 2IBZI 3QWOC 2JKVA 1J1EC 3Q5RA 3F5HA 3WUTA 4WY4D 1LWUB 1RE3C 1IC2A 3ABVC 1HBWA 4K35A 3CC4P 1H88A 1USEA 5H2FE 1VDFA 1L0LD 4PD4D 1Z56A 2KLVA 3Q3DA 2KOGA 1JCCA 2AEMA 3SWFA 2CPSA 1LT9A 3NXSA 1KQSO 1OX3A 5B5EE 1LGHB 1JM0A 2FXMA 3CCLP 3PP5A 4HKZH 3A2AA 2A06D 2Z4EA 1NU1J 3S1KA 3VMAA 3A7OA 2Q1KA 2WQYC 1OIPA 3P7KA 2E5YA 1LTTC 3EZ7A 3L35A 1VQ5P 1KV4A 1KYOH 5AW9B 1YJ9P 2WPVB 3N7NA 3WUUA 1LP1A 2O1KA 2E76D 1DIPA 5KAUA 3VTPC 3JCUH 3TYYA 4PD4I 2BEZF 2QM7A 2HODA 3B5NA 3SWKA 5KLVE 1S5LX 1GMJA 4R4MA 4ZNCA 1GL2B 2JMLA 1KD1Q 5DJUB 3PJSK 1HTLC 3KXDA 4PV1D 4K3AA 3L70E 1RH5B 3MD0A 3MZWB 1N7SC 4W80A 2Y0DA 4N3YB 1BDDA 3RL0D 3AEBC 4TT3H 3L72G 1OVRA 1KYOE 3HD7C 1VF5D 3BVHA 1M1JA 1LJ2A 3T97B 5KLVG 3FWLA 2OYIB 1PP9J 3PRJA 5AVUB 1FZBA 1KQFB 2IDBA 3JCUE 1D7MA 4CPGA 4D6TJ 1TU3F 2O3JA 2FYNC 1GD2E 2GUVA 2OYHC 3PLNA 2O01N 5AW0B 2C9LY 5TJHA 2WITA 3H1IG 1IFIA 4H13C 4DJGA 3D71A 1M7LA 2OQQA 3LW5J 2OARA 1NHLA 2YKOA 2KP8A 3LIDA 2WT7B 2P1JA 4WY4B 2E74C 1K05A 2QJKB 1L0NJ 3CMAP 2WSEH 3GPVA 5AW7B 2KCUA 1BCCJ 4U3FD 2E43A 1IFNA 4DZOA 3MUDC 5KLVK 3H1KJ 1DEEG 1J1EB 1KN7A 2N9BA 2KNCA 1USDA 1CZQA 1QGKB 4YTPC 3G71P 2G3AA 5CHXA 4YPCA 2PRRA 3O6QA 1BE3D 1N2DC 2QVAA 3KYQA 3H1JJ 1RF0A 2D2CD 1OVUA 2JWDA 3HE5A 5KAWA 1XTCC 3D6ZA 1RF1A 1FDOA 5CJ4A 3L71E 3L75E 1E5WA 1NH4A 3IR9A 2M0BA 1PGJA 1GK6A 2RH0A 4B86A 1FBMA 4A7PA 2FY8A 4NPFX 3H1LD 3L37A 1KMIZ 2XNDH 3TSIA 2JJLA 3C8VA 2QM8A 1K9MQ 1S9KD 1X8YA 3BRVB 3W67A 2QJYB 4GOFA 1VQMP 3L75G 4LC1A 2JR8A 3RL0B 2WPRA 2YO2A 4IFDK 2BASA 1VF5B 3VN0A 5AW1B 1VQ4P 4JQ0D 1URQA 4UB6H 3M91A 4BRYB 1FC2C 1Q7YQ 1JTHB 3L73J 1JMMA 2V4HA 1H8AA 2YXQB 3CWBE 1SQVJ 1P84D 2ZXEB 2I8DA 1Y6UA 1ZV8A 1JYHA 5CBNA 2YO3A 5AVSB 1SQXJ 3L74E 2Y9YA 3CC7P 1SQQJ 1NU1G 3HE4B 1OWAA 4LGDE 3AEAC 5APWA 2LKMA 1KILA 1NAYA 2JEEA 3FXDA 1SQBE 4NPEA 1SFCD 3WMM0 2FYNB 4L75A 2OYHB 2V7QH 4HH2A 1HWTC 1VQ6P 3PHLA 1M1JC 1S4XA 1T3UA 3CWBG 4UB6E 1NVOA 3G4SP 5CMZA 2FXOA 1PL5A 3HUSB 1RY3A 5APXA 2E74B 1CW5A 2YIUB 1SP4A 2WZ7A 2ZYDA 1W2BO 3VYIA 3C1LA 2CPBA 3TGUJ 2DG6A 1PIXA 1H0TB 1SQBG 3H32A 2YMYA 3H6PA 1GU4A 3HRNA 4OVNF 2OGUA 1P84I 3R8KA 3R4YA 4XE5B 1NU1K 2M3BA 1L4AA 1N86A 2D2CB 2B9BA 1EZVG 2OTLP 2FFDB 1KZUB 1OW7A 3JSVC 2R32A 2XDJA 5AW2B 1AJYA 3GK6A 2E75D 1ZMEC 3AE7C 2FYUD 5M1BA 2XZRA 1JBGA 1PP9G 2J5UA 1KB9D 3TDKA 1L0NE 3AE9C 5KAXA 2Y0CA 1OFCX 1BCCE 5KJ7D 3TF5A 4LLHA 1YQ3C 4W7YA 2O1JA 1YBKA 4YXWH 3CCSP 3CCVP 4HJGH 1SQBK 3IAOA 1NTZE 2Z5HA 5GTIH 2NPSD 3CMEP 1QL2A 1LT9B 1BOWA 4ASWA 4OGQD 5K5GB 3MTUE 2HFED 2LXCB 2KSJA 1L0NG 3AE3C 4JPZB 1LT1A 3USSA 1BCCG 2H7HA 3V5BA 1FZAA 4AQRD 3G9RA 1SQPD 2KVVA 1G1JA 3H1KG 3CCUP 2KYVA 2H89C 2OTKE 2IFNA 2XU6A 2WSCH 3SSUA 1KB9I 1LP1B 5AVRB 1JCDA 4LHFA 1R5LA 2J59M 3RK2C 1BGYJ 3VP8A 3H1JG 3S4RA 4WLWA 1JY2N 2HODB 3B5NB 2QRXA 1S72P 2AEJA 1URQC 2AEFA 3AECC 5KLVD 1L0NK 5CCHA 2O01H 3MP7B 3M0AA 1ZOYC 3HTKB 1SLQA 4DOJA 1VQOP 5APQA 1Q07A 3L70D 2R3SA 1Q08A 2QSIA 1NTZK 1FOSE 3NMDA 1M1JB 1LNQA 1KYOD 1T6AA 3FWNA 3H1HJ 1KILC 1FJPA 5E79E 3VOPA 3L4FA 5BVZA 2QEXP 2Q7CA 3CCRP 4EI2A 3AEDC 2XNXA 1LTGC 5AW6B 3E7KA 5GTHE 2E75B 1SQQE 4R24B 5APVA 5D8CA 1PV3A 2CK3H 3CCQP 1AV1A 2K9YA 2A45H 2P58A 3L73G 2C0WA 1Y8AA 3KQGA 1SQVG 4JBZA 1DX7A 2IX7C 5BU5A 1NYHA 3MIWA 1KTMA 1SQXG 2M3EA 2HPCB 1DH3A 1YHQP 2NPSB 1FJKA 1SQQG 2MKVA 2QIWA 5APSA 1FZCC 1L4AC 4OGQB 2QA4P 1N8RQ 3A0HH 4TLFA 1KYOI 3AE8C 3GW6A 1QLED 1PZQA 4L73A 3H25A 3L72E 1JY3N 2IBZE 3M9QA 4B0YA 2BCCJ 1QVFO 1DD3A 3O6QB 2PP6A 2ZXXA 3V2RA 3A0BE 3AEFC 4U3FJ 1YI2P 3HE5B 2IPPA 1RF1B 1UIIA 4MN4C 2N1TA 1PGPA 1SQVK 3TGUG 4PJ0H 1FZFA 3E1IA 5KLIC 3MHVA 3BASA 4I7ZC 3L71D 2KLUA 1A02J 2IBZG 1SVFA 3H1IE 2PFXA 1SQQK 2QE7H 2R5BA 1R8EA 3TNUA 3A0HE 1NTKD 2A45G 3K5BA 5AW4B 1QX8A 5AW8B 4KHXA 3EZ9A 1X79B 1N7SD 3V6IA 4XFJA 2FXPA 2ZFCA 3HD7D 4HYTB 4Z1MH 4GIFA 3H1LJ 1KILE 4U7JA 1L2PA 1IK9A 3O8ZA 1URQB 3U59A 2WMMA 4PJ0E 1E79H 4EDFA 3IF4A 3RGUA 2ZT9C 2H8PD 4L74A 1EDKA 2JO1A 2QJPC 2WSFJ 4UB8H 1X22A 4H13D 2K88A 3CWBD 1LTBC 2OTJP 1BGYE 2I1KA 5CCHC 1JY2O 2B88A 1FOSF 4A1MA 1VL2A 1FE6A 3L74D 2E74D 2YKPA 1M90Q 3CXHH 3M0DA 3AE6C 1LTAC 3KDPB 1EDIA 1FDMA 1SQBD 1JY2P 2AXCA 1K04A 5I41B 4WB4A 4H0LC 4ZKUA 3EWKA 3CX5H 3V4WA 2BOWA 2A06G 1BGYG 3AE1C 1YTZI 3CL3D 1PPJE 2YMKA 3P8CE 5KAIH 4C7NA 4UB8E 2GOVA 1IO4A 1YQ4C 3H1HE 3U1AA 3H32B 2HG5D 1N73C 1ZR4A 3D70A 3CC2P 1U7JA 2ZJSE 3S9OA 1L4AB 1VQ8P 3R8JA 1GL2A 2WWWA 1AQ5A 1FU1A 3V2NA 3CXHE 1GTWA 3CCEP 1JEKA 1AA0A 1LTJA 5AVWB 1ZR2A 1Y47A 2VRSA 3E1RA 1ZLLA 1NTMJ 1PPJG 1RQVA 5AVYB 3H1HG 3CX5E 2AXTH 1NU1E 1MUUA 2OYIA 2R3CA 3OA7A 2KS1A 5KAIE 1L0ND 1J1DC 1BCCD 1VQNP 1ZP0C 1T2KD 1AVYA 5KLIB 1N7SB 5CCGA 2FYUJ 1SS1A 1Q2NA 2L91A 2YKQA 3BCCJ 3HD7B 1JY3O 1NTZD 1G1IA 2C0XA 3EFFK 1MV8A 3VMYA 2BCCE 2N1TC 1EXIA 1UIXA 2WT7A 2NZ2A 4WY4A 2KI7B 2Z5IA 2AXTE 3B5ND 1RE4A 1KORA 3LW5H 2K9JA 4H13B 4N78D 1EZVE 1GDTA 2YXRB 2NRGA 4AYZB 1H89A 2BCCG
chains in the Genus database with same CATH topology
3GPVA 5I44A 2KCUA 2E76D 2H88C 1VF5B 3Q5SA 1DIPA 1Q06A 1S1CX 5KAUA 5KATA 1OW7A 2MKVA 2QIWA 4WLWA 2IEFA 2QJKC 1AJYA 1WMKA 4Y28J 3FGAD 3RL0g 3GK6A 1IK7A 4OGQB 2E75D 3LURA 2BEZF 5KKZC 3EZ6A 2G8YA 3AE7C 1ZMEC 2ZT9C 3GLMA 5GQQA 1S5LX 5M1BA 1RQVA 1FDIA 3AE8C 1GMJA 3QAOA 4R4MA 3AE5C 3GF7A 4H0LD 3UCSA 2JMLA 4YXDC 2O01J 1JBGA 1EXJA 2WSEJ 2JO1A 1Y9BA 3AECC 2J5UA 4PV1D 3IN6A 2ZT9B 1PM6A 3H25A 1Q0AA 2QJPC 3GMAA 1Q05A 3Q1MA 2WSFJ 4YTPC 1Y6UA 3AE9C 5KAXA 4B0YA 1LX8A 1JYHA 1ZOYC 4H13D 1DD3A 3Q5RA 2G3AA 4H44B 4IL6X 2E76B 4R4LA 3O6QA 3HH0A 3ABVC 3AEFC 3AEBC 4TT3H 1Q07A 1YQ3C 3AE4C 3AEAC 1Q08A 4J2NA 5KAVA 2D2CD 1ZP0C 4RKUJ 4A1MA 1VL2A 2QSIA 2JP3A 1OW8A 3EZFA 1VF5D 2E74D 4H44C 3IAOA 1HJ0A 1NGMB 5KAWA 1HF9A 2E76C 4R4EA 3D6ZA 2VZ4A 5E01A 3AE2C 3Q3DA 1FDOA 3T97B 4H0LB 1BOWA 3SFEC 3B49A 3AE6C 3B71A 2V7QJ 4OGQD 1R8DA 4PV1B 4KT0J 5KLIC 2E75C 4I7ZC 3E0HA 4WLSA 1MKMA 1KQFB 1K04A 5I41B 1Q09A 2IDBA 3AEDC 1EXIA 1UIXA 5D90A 2P10A 2YIUC 4H0LC 3Q5PA 1TU3F 3GP4A 3AE3C 1OMIA 3EWKA 2ZT9D 2NZ2A 2FYNC 1U57A 1R8EA 1KMIZ 2E75B 4R24B 3AEGC 4I7ZB 2BEQD 4H44D 3D6YA 2BOWA 4PV1C 5D8CA 1PV3A 1PL5A 4DCZA 1DD4A 1KQGB 3AE1C 2QJYC 3AEEC 4AYZA 2WQYC 3C8VA 2E74B 3G9RA 2OG0A 4H13C 1D5YA 2HVAA 3EZ9A 2KVVA 3D71A 2K9YA 3GF3A 2YMKA 5L8RJ 2ZHHA 1JB0J 2OQQA 2GOVA 3LW5J 1YQ4C 1RH6A 1KORA 3EZ7A 3EZ2A 2FBWC 2H89C 2DG6A 1PIXA 2WSCJ 4XFJA 4GDOA 1OW6A 2D2CC 3SFDC 4H13B 2FXPA 5KCBA 1VF5C 3D70A 2E74C 2WPVB 1K05A 3Q2YA 3S9OA 3R8KA 3R4YA 3R8JA 1RQUA 1ZRTE 4Z1MH 1Q90D 4LHFA 1NYHA 4R22B 3RK3E 4AYZB 2ZHGA 4OGQC 2D2CB 1KTMA 1KILE 4U7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPV A;  5I44 A;  1BOW A;  2KCU A;  1Q0A A;  3B49 A;  3G9R A;  1D5Y A;  1Q05 A;  3Q1M A;  3Q5S A;  2HVA A;  1DIP A;  1Q06 A;  3D71 A;  5KAU A;  5KAT A;  5KAX A;  4B0Y A;  1JYH A;  1R8D A;  2ZHH A;  3Q5R A;  2OQQ A;  2GOV A;  4WLW A;  3E0H A;  4R4L A;  4WLS A;  3GK6 A;  5GQQ A;  3HH0 A;  3LUR A;  2DG6 A;  4AYZ B;  5I41 B;  1Q09 A;  1Q07 A;  1EXI A;  5D90 A;  2ZHG A;  1Q08 A;  4J2N A;  3Q5P A;  5KCB A;  3GP4 A;  3D70 A;  5KAV A;  4A1M A;  3QAO A;  3Q2Y A;  1R8E A;  4R4M A;  4R24 B;  3UCS A;  3R8K A;  2JML A;  3D6Y A;  2BOW A;  5D8C A;  3IAO A;  3R8J A;  5KAW A;  1JBG A;  4R22 B;  1EXJ A;  2VZ4 A;  3T97 B;  4R4E A;  3D6Z A;  5E01 A;  2J5U A;  4AYZ A;  3Q3D A; 
#chains in the Genus database with same CATH topology
 4M3L A;  1NKZ B;  1S1C X;  3FGA D;  1IK7 A;  1PP9 E;  1PFI A;  1SQP J;  1X0T A;  4IL6 E;  3NTN A;  1K73 Q;  1MFZ A;  2KUB A;  3BRT B;  1FZC A;  4D6T E;  3I5C A;  1JOC A;  2WVR A;  2HYN A;  3EQ2 A;  2JDI H;  4J2N A;  3V2P A;  3EZF A;  1U7M A;  4I6M C;  5E01 A;  4H0L B;  3B49 A;  3FX0 A;  1KFM A;  3RK3 C;  4WVZ A;  2PAJ A;  1EDJ A;  1R8D A;  3OW2 O;  4WLS A;  1T3J A;  4D6T G;  2R44 A;  3M0D C;  1R5S A;  3H1L G;  2IYO A;  3H1K E;  3L70 J;  1OVV A;  2ZYG A;  1KQL A;  1SQQ D;  4W7Z A;  2RMZ A;  1M8O B;  1CI6 A;  3GHG A;  3SFD C;  1JTH A;  3OJA B;  3H1J E;  2MJZ A;  2IFM A;  4C7R A;  1L0L J;  3WU2 H;  1BSH A;  3ZDM A;  1GU5 A;  1GL2 C;  1M57 D;  1T8Z A;  3KZI H;  1LTJ C;  2KZJ A;  2M5A A;  1IFJ A;  1Y9B A;  3II6 A;  3VMX A;  1PM6 A;  5E79 H;  2WSS H;  1HGZ A;  2WPS A;  3L72 D;  3AE4 C;  5GTH H;  2M8R A;  2OYI C;  1YYC A;  5AVX B;  4ZKP A;  4Y99 C;  1ZXG A;  1NTM E;  4H44 C;  3P8M C;  2VZ4 A;  2JWA A;  1RHZ B;  3SFE C;  3CI9 A;  5TIS H;  1IFM A;  3RK2 D;  3WU2 E;  2KSE A;  5CCG C;  5KTB A;  1H0T A;  4JYC A;  4AYC A;  3TNU B;  3AEG C;  5AVZ B;  2B87 A;  3L73 E;  3H1I D;  3KZI E;  1URQ D;  1KC8 Q;  2ZVN B;  4WY4 C;  2FYU E;  2FFD A;  3QH9 A;  3BCC E;  1SQV E;  2RN0 A;  1NTM G;  3EZ2 A;  1Q81 Q;  3L36 A;  1AVO A;  5AW3 B;  4GDO A;  3BAT A;  1A02 F;  1RE4 C;  1SQX E;  1VQ7 P;  3L71 J;  4GKG A;  1RQU A;  1ZRT E;  1YTZ T;  3RK3 E;  2H88 C;  1PGO A;  1N73 A;  2YNY A;  1NTK J;  3A0B H;  4RO0 A;  5TIS E;  1HH0 A;  1KIL D;  1WMK A;  1IFP A;  2A45 I;  2I1J A;  2W90 A;  4OH8 B;  3TK1 A;  3EZ6 A;  4KJM A;  2FYU G;  3QAO A;  1JO5 A;  3BCC G;  1IZN B;  3IN6 A;  4XA4 A;  1Q05 A;  4QMA A;  4EOT A;  1G2C A;  1WRG A;  3RK3 B;  3TGU E;  1YIT P;  1NTM K;  1BGY D;  2KNC B;  1SQP E;  2FKW B;  2E76 C;  1LTI C;  3AE2 C;  1JNM A;  3A3Y B;  1K8A Q;  3A5T A;  3KPE A;  2IZ0 A;  1L4A D;  2W83 C;  3CWB J;  3P32 A;  3D6Y A;  4PV1 C;  4ASV A;  2QJY C;  4RJT A;  2FYU K;  5AVQ B;  3L74 J;  3CCJ P;  4C7N B;  2L5G B;  4PD4 H;  1NO4 A;  3RL0 C;  1FAV A;  1SQP G;  1HGV A;  3PH0 A;  4JF7 A;  1YIJ P;  1SFC A;  3L75 D;  2C9N Y;  1PPJ D;  1N7L A;  1SQX K;  3P8C D;  1BDC A;  5KCB A;  1VF5 C;  1VQL P;  3H1H D;  1SQB J;  1KFN A;  1BE3 J;  4R22 B;  3GHG C;  2K3R A;  3I56 P;  2IZ1 A;  2XV5 A;  5KAF H;  1LTJ B;  3HTK A;  5KKZ C;  3RK2 B;  3CXH D;  1EXJ A;  3Q1M A;  2Q3E A;  4Y99 B;  3CX5 D;  3B4S A;  2K1A A;  4H44 B;  2KS1 B;  4IL6 X;  4JYB A;  5AVT B;  1L0L E;  3V2Q A;  4PD4 E;  1NU1 D;  2HR3 A;  1LWU A;  3FXE A;  1SQP K;  3L70 G;  5KAV A;  2UWJ E;  2JP3 A;  1OW8 A;  3CPW O;  3M9H A;  2Y9Z A;  4HB1 A;  2E42 A;  5BU8 B;  1W2E A;  5B66 H;  2V7Q J;  3MGN A;  1QEX A;  5KAF E;  1MKM A;  2A06 E;  3HUS C;  1S3J A;  2YIU C;  3GP4 A;  4I1L A;  1KIL B;  2ZT9 D;  3NFQ A;  5KJ7 A;  2BCC D;  1L0L G;  1VQ9 P;  3AEE C;  2HVA A;  1FZG A;  4BXL A;  3CXH I;  2HPC A;  1JB0 J;  1JMB A;  2K9J B;  2NPS A;  2W6A A;  2QG4 A;  2D2C C;  1NTZ J;  5CCH D;  1MFT A;  2FFD C;  1HUC A;  1Q86 Q;  3SWY A;  3CX5 I;  2W6J H;  2WPQ A;  1EZV D;  1CSB A;  5KAT A;  5B66 E;  1HJB A;  2IEF A;  1VPC A;  4Y28 J;  5AVV B;  3GLM A;  3CD6 P;  1FZC B;  4H0L D;  3W68 A;  1PP9 D;  3G6E P;  2Q5U A;  1QL1 A;  3GMA A;  5CBO A;  3M9B A;  3C9I A;  1L0L K;  1QVG O;  1GK4 A;  4D6T D;  2E76 B;  4R4L A;  1NTK E;  1LT9 C;  1YJN P;  2ITA A;  2POH A;  3V4Q A;  1S5L H;  1NGM B;  1HF9 A;  4R4E A;  1X9V A;  3UIA A;  3T97 A;  5APU A;  4PV1 B;  4KT0 J;  2ZAE B;  3E0H A;  1T2K C;  1Q09 A;  3L71 G;  3VMZ A;  5D90 A;  3I55 P;  2P10 A;  1IFD A;  4BWN A;  1VQK P;  1U57 A;  1EZV I;  4I7Z B;  2BEQ D;  1BSN A;  4DCZ A;  1DD4 A;  1KQG B;  1NTK G;  2N9Y B;  2OG0 A;  3CLQ A;  3H1K D;  3U1C A;  1VQP P;  1CI6 B;  3GF3 A;  5L8R J;  1W5C E;  3PTZ A;  3GHG B;  2W6B A;  1YJW P;  2GUS A;  2GA1 A;  4GT1 A;  1JUN A;  2WSC J;  4IL6 H;  2DW3 A;  2ZVO B;  3RBX A;  4U3F E;  5AW5 B;  1EQ7 A;  5C39 A;  5KKZ B;  1SFC C;  1GW4 A;  3B5N C;  1S5L E;  1OXZ A;  1GZL A;  1JY3 P;  3H1J D;  1Q06 A;  1ZN5 A;  2LR2 A;  5GQQ A;  4O9B A;  2OYO A;  2G8Y A;  4IOI H;  3B8E B;  2N1T D;  5APY A;  2KIK A;  1AQT A;  3GF7 A;  2M5A B;  3UCS A;  1WT6 A;  2O01 J;  2H43 A;  1RE3 A;  4ZMD A;  2ZT9 B;  1BE3 E;  2HLO A;  4AUW A;  2WSF H;  4U3F G;  1OZH A;  1NTK K;  4DCK A;  3LIE A;  1HVV A;  2KB7 P;  2QJP B;  2KZI A;  3L74 G;  1HJ0 A;  1LWU C;  3F89 A;  3B71 A;  3JC2 2;  1NTM D;  1IJD B;  3H1L E;  2E75 C;  1MZ9 A;  2FYZ A;  5DJT B;  2J58 A;  1Q82 Q;  1P84 H;  1BE3 G;  1NKN A;  2B87 B;  3L72 J;  2KXP B;  2LXB A;  1S9K E;  2ZYA A;  3WUV A;  1D5Y A;  3L73 D;  5KJ7 C;  2ZHH A;  1AFO A;  1LTS C;  1EDL A;  5KLV J;  4C46 A;  3BCC D;  1SQV D;  3G3Z A;  3Q2Y A;  1NAF A;  2NPS C;  1Q90 D;  4OGQ C;  2IYP A;  4L76 A;  1SQX D;  1N73 B;  2W8Z A;  2WTY A;  3Q5S A;  2RKL A;  1ZRT D;  4NPD A;  3RK3 D;  3H1I J;  3CCM P;  1ZW0 A;  1NOH A;  4OWF A;  3LUR A;  4BRY A;  2PGD A;  1P84 E;  3AE5 C;  1N7S A;  4YXD C;  4DT0 A;  2GM4 A;  2K37 A;  1Q0A A;  1RF0 C;  4GOE A;  3HD7 A;  1LX8 A;  1G2C B;  3VP9 A;  1RF1 C;  2Y0E A;  3HH0 A;  1DEB A;  3IFM A;  2Q9I A;  1GW3 A;  4RES B;  3HE4 A;  2SPZ A;  4RKU J;  5APT A;  3TGU D;  1J1D B;  3N4X A;  5EFW B;  1M1K Q;  2Q3I A;  4N78 E;  4IFF A;  1NTZ G;  2OYH A;  3ITK A;  2IBZ D;  2P2U A;  1KB9 H;  1GL2 D;  2B89 A;  3Q5P A;  1FS0 E;  1OMI A;  4WBA A;  2XKM A;  1FZE A;  2P67 A;  2N1T B;  4AYZ A;  5GTI E;  3HUS A;  2E5T A;  1SFC B;  1RH6 A;  2KK7 A;  5H2F H;  2FBW C;  2P7J A;  1OW6 A;  4GOD A;  2ZHG A;  3MUD A;  1S2E A;  4H44 D;  5I44 A;  4N6J A;  5B5E H;  3OAK A;  1M56 D;  4IFM A;  1NWQ A;  2QJK C;  1PGQ A;  3RL0 g;  3R2P A;  5CCG D;  3GG2 A;  1KB9 E;  1FDI A;  3KHU A;  3RBZ A;  3L75 J;  4WWI A;  3EFG A;  1EC5 A;  1J2J B;  2WSE J;  5CJ0 A;  4I2L C;  4EIJ A;  1NJI Q;  2R5D A;  2Q6Q A;  3M06 A;  2W27 A;  4EYY Q;  1XTG B;  2IBZ I;  3QWO C;  2JKV A;  1J1E C;  3Q5R A;  3F5H A;  3WUT A;  4WY4 D;  1LWU B;  1RE3 C;  1IC2 A;  3ABV C;  1HBW A;  4K35 A;  3CC4 P;  1H88 A;  1USE A;  5H2F E;  1VDF A;  1L0L D;  4PD4 D;  1Z56 A;  2KLV A;  3Q3D A;  2KOG A;  1JCC A;  2AEM A;  3SWF A;  2CPS A;  1LT9 A;  3NXS A;  1KQS O;  1OX3 A;  5B5E E;  1LGH B;  1JM0 A;  2FXM A;  3CCL P;  3PP5 A;  4HKZ H;  3A2A A;  2A06 D;  2Z4E A;  1NU1 J;  3S1K A;  3VMA A;  3A7O A;  2Q1K A;  2WQY C;  1OIP A;  3P7K A;  2E5Y A;  1LTT C;  3EZ7 A;  3L35 A;  1VQ5 P;  1KV4 A;  1KYO H;  5AW9 B;  1YJ9 P;  2WPV B;  3N7N A;  3WUU A;  1LP1 A;  2O1K A;  2E76 D;  1DIP A;  5KAU A;  3VTP C;  3JCU H;  3TYY A;  4PD4 I;  2BEZ F;  2QM7 A;  2HOD A;  3B5N A;  3SWK A;  5KLV E;  1S5L X;  1GMJ A;  4R4M A;  4ZNC A;  1GL2 B;  2JML A;  1KD1 Q;  5DJU B;  3PJS K;  1HTL C;  3KXD A;  4PV1 D;  4K3A A;  3L70 E;  1RH5 B;  3MD0 A;  3MZW B;  1N7S C;  4W80 A;  2Y0D A;  4N3Y B;  1BDD A;  3RL0 D;  3AEB C;  4TT3 H;  3L72 G;  1OVR A;  1KYO E;  3HD7 C;  1VF5 D;  3BVH A;  1M1J A;  1LJ2 A;  3T97 B;  5KLV G;  3FWL A;  2OYI B;  1PP9 J;  3PRJ A;  5AVU B;  1FZB A;  1KQF B;  2IDB A;  3JCU E;  1D7M A;  4CPG A;  4D6T J;  1TU3 F;  2O3J A;  2FYN C;  1GD2 E;  2GUV A;  2OYH C;  3PLN A;  2O01 N;  5AW0 B;  2C9L Y;  5TJH A;  2WIT A;  3H1I G;  1IFI A;  4H13 C;  4DJG A;  3D71 A;  1M7L A;  2OQQ A;  3LW5 J;  2OAR A;  1NHL A;  2YKO A;  2KP8 A;  3LID A;  2WT7 B;  2P1J A;  4WY4 B;  2E74 C;  1K05 A;  2QJK B;  1L0N J;  3CMA P;  2WSE H;  3GPV A;  5AW7 B;  2KCU A;  1BCC J;  4U3F D;  2E43 A;  1IFN A;  4DZO A;  3MUD C;  5KLV K;  3H1K J;  1DEE G;  1J1E B;  1KN7 A;  2N9B A;  2KNC A;  1USD A;  1CZQ A;  1QGK B;  4YTP C;  3G71 P;  2G3A A;  5CHX A;  4YPC A;  2PRR A;  3O6Q A;  1BE3 D;  1N2D C;  2QVA A;  3KYQ A;  3H1J J;  1RF0 A;  2D2C D;  1OVU A;  2JWD A;  3HE5 A;  5KAW A;  1XTC C;  3D6Z A;  1RF1 A;  1FDO A;  5CJ4 A;  3L71 E;  3L75 E;  1E5W A;  1NH4 A;  3IR9 A;  2M0B A;  1PGJ A;  1GK6 A;  2RH0 A;  4B86 A;  1FBM A;  4A7P A;  2FY8 A;  4NPF X;  3H1L D;  3L37 A;  1KMI Z;  2XND H;  3TSI A;  2JJL A;  3C8V A;  2QM8 A;  1K9M Q;  1S9K D;  1X8Y A;  3BRV B;  3W67 A;  2QJY B;  4GOF A;  1VQM P;  3L75 G;  4LC1 A;  2JR8 A;  3RL0 B;  2WPR A;  2YO2 A;  4IFD K;  2BAS A;  1VF5 B;  3VN0 A;  5AW1 B;  1VQ4 P;  4JQ0 D;  1URQ A;  4UB6 H;  3M91 A;  4BRY B;  1FC2 C;  1Q7Y Q;  1JTH B;  3L73 J;  1JMM A;  2V4H A;  1H8A A;  2YXQ B;  3CWB E;  1SQV J;  1P84 D;  2ZXE B;  2I8D A;  1Y6U A;  1ZV8 A;  1JYH A;  5CBN A;  2YO3 A;  5AVS B;  1SQX J;  3L74 E;  2Y9Y A;  3CC7 P;  1SQQ J;  1NU1 G;  3HE4 B;  1OWA A;  4LGD E;  3AEA C;  5APW A;  2LKM A;  1KIL A;  1NAY A;  2JEE A;  3FXD A;  1SQB E;  4NPE A;  1SFC D;  3WMM 0;  2FYN B;  4L75 A;  2OYH B;  2V7Q H;  4HH2 A;  1HWT C;  1VQ6 P;  3PHL A;  1M1J C;  1S4X A;  1T3U A;  3CWB G;  4UB6 E;  1NVO A;  3G4S P;  5CMZ A;  2FXO A;  1PL5 A;  3HUS B;  1RY3 A;  5APX A;  2E74 B;  1CW5 A;  2YIU B;  1SP4 A;  2WZ7 A;  2ZYD A;  1W2B O;  3VYI A;  3C1L A;  2CPB A;  3TGU J;  2DG6 A;  1PIX A;  1H0T B;  1SQB G;  3H32 A;  2YMY A;  3H6P A;  1GU4 A;  3HRN A;  4OVN F;  2OGU A;  1P84 I;  3R8K A;  3R4Y A;  4XE5 B;  1NU1 K;  2M3B A;  1L4A A;  1N86 A;  2D2C B;  2B9B A;  1EZV G;  2OTL P;  2FFD B;  1KZU B;  1OW7 A;  3JSV C;  2R32 A;  2XDJ A;  5AW2 B;  1AJY A;  3GK6 A;  2E75 D;  1ZME C;  3AE7 C;  2FYU D;  5M1B A;  2XZR A;  1JBG A;  1PP9 G;  2J5U A;  1KB9 D;  3TDK A;  1L0N E;  3AE9 C;  5KAX A;  2Y0C A;  1OFC X;  1BCC E;  5KJ7 D;  3TF5 A;  4LLH A;  1YQ3 C;  4W7Y A;  2O1J A;  1YBK A;  4YXW H;  3CCS P;  3CCV P;  4HJG H;  1SQB K;  3IAO A;  1NTZ E;  2Z5H A;  5GTI H;  2NPS D;  3CME P;  1QL2 A;  1LT9 B;  1BOW A;  4ASW A;  4OGQ D;  5K5G B;  3MTU E;  2HFE D;  2LXC B;  2KSJ A;  1L0N G;  3AE3 C;  4JPZ B;  1LT1 A;  3USS A;  1BCC G;  2H7H A;  3V5B A;  1FZA A;  4AQR D;  3G9R A;  1SQP D;  2KVV A;  1G1J A;  3H1K G;  3CCU P;  2KYV A;  2H89 C;  2OTK E;  2IFN A;  2XU6 A;  2WSC H;  3SSU A;  1KB9 I;  1LP1 B;  5AVR B;  1JCD A;  4LHF A;  1R5L A;  2J59 M;  3RK2 C;  1BGY J;  3VP8 A;  3H1J G;  3S4R A;  4WLW A;  1JY2 N;  2HOD B;  3B5N B;  2QRX A;  1S72 P;  2AEJ A;  1URQ C;  2AEF A;  3AEC C;  5KLV D;  1L0N K;  5CCH A;  2O01 H;  3MP7 B;  3M0A A;  1ZOY C;  3HTK B;  1SLQ A;  4DOJ A;  1VQO P;  5APQ A;  1Q07 A;  3L70 D;  2R3S A;  1Q08 A;  2QSI A;  1NTZ K;  1FOS E;  3NMD A;  1M1J B;  1LNQ A;  1KYO D;  1T6A A;  3FWN A;  3H1H J;  1KIL C;  1FJP A;  5E79 E;  3VOP A;  3L4F A;  5BVZ A;  2QEX P;  2Q7C A;  3CCR P;  4EI2 A;  3AED C;  2XNX A;  1LTG C;  5AW6 B;  3E7K A;  5GTH E;  2E75 B;  1SQQ E;  4R24 B;  5APV A;  5D8C A;  1PV3 A;  2CK3 H;  3CCQ P;  1AV1 A;  2K9Y A;  2A45 H;  2P58 A;  3L73 G;  2C0W A;  1Y8A A;  3KQG A;  1SQV G;  4JBZ A;  1DX7 A;  2IX7 C;  5BU5 A;  1NYH A;  3MIW A;  1KTM A;  1SQX G;  2M3E A;  2HPC B;  1DH3 A;  1YHQ P;  2NPS B;  1FJK A;  1SQQ G;  2MKV A;  2QIW A;  5APS A;  1FZC C;  1L4A C;  4OGQ B;  2QA4 P;  1N8R Q;  3A0H H;  4TLF A;  1KYO I;  3AE8 C;  3GW6 A;  1QLE D;  1PZQ A;  4L73 A;  3H25 A;  3L72 E;  1JY3 N;  2IBZ E;  3M9Q A;  4B0Y A;  2BCC J;  1QVF O;  1DD3 A;  3O6Q B;  2PP6 A;  2ZXX A;  3V2R A;  3A0B E;  3AEF C;  4U3F J;  1YI2 P;  3HE5 B;  2IPP A;  1RF1 B;  1UII A;  4MN4 C;  2N1T A;  1PGP A;  1SQV K;  3TGU G;  4PJ0 H;  1FZF A;  3E1I A;  5KLI C;  3MHV A;  3BAS A;  4I7Z C;  3L71 D;  2KLU A;  1A02 J;  2IBZ G;  1SVF A;  3H1I E;  2PFX A;  1SQQ K;  2QE7 H;  2R5B A;  1R8E A;  3TNU A;  3A0H E;  1NTK D;  2A45 G;  3K5B A;  5AW4 B;  1QX8 A;  5AW8 B;  4KHX A;  3EZ9 A;  1X79 B;  1N7S D;  3V6I A;  4XFJ A;  2FXP A;  2ZFC A;  3HD7 D;  4HYT B;  4Z1M H;  4GIF A;  3H1L J;  1KIL E;  4U7J A;  1L2P A;  1IK9 A;  3O8Z A;  1URQ B;  3U59 A;  2WMM A;  4PJ0 E;  1E79 H;  4EDF A;  3IF4 A;  3RGU A;  2ZT9 C;  2H8P D;  4L74 A;  1EDK A;  2JO1 A;  2QJP C;  2WSF J;  4UB8 H;  1X22 A;  4H13 D;  2K88 A;  3CWB D;  1LTB C;  2OTJ P;  1BGY E;  2I1K A;  5CCH C;  1JY2 O;  2B88 A;  1FOS F;  4A1M A;  1VL2 A;  1FE6 A;  3L74 D;  2E74 D;  2YKP A;  1M90 Q;  3CXH H;  3M0D A;  3AE6 C;  1LTA C;  3KDP B;  1EDI A;  1FDM A;  1SQB D;  1JY2 P;  2AXC A;  1K04 A;  5I41 B;  4WB4 A;  4H0L C;  4ZKU A;  3EWK A;  3CX5 H;  3V4W A;  2BOW A;  2A06 G;  1BGY G;  3AE1 C;  1YTZ I;  3CL3 D;  1PPJ E;  2YMK A;  3P8C E;  5KAI H;  4C7N A;  4UB8 E;  2GOV A;  1IO4 A;  1YQ4 C;  3H1H E;  3U1A A;  3H32 B;  2HG5 D;  1N73 C;  1ZR4 A;  3D70 A;  3CC2 P;  1U7J A;  2ZJS E;  3S9O A;  1L4A B;  1VQ8 P;  3R8J A;  1GL2 A;  2WWW A;  1AQ5 A;  1FU1 A;  3V2N A;  3CXH E;  1GTW A;  3CCE P;  1JEK A;  1AA0 A;  1LTJ A;  5AVW B;  1ZR2 A;  1Y47 A;  2VRS A;  3E1R A;  1ZLL A;  1NTM J;  1PPJ G;  1RQV A;  5AVY B;  3H1H G;  3CX5 E;  2AXT H;  1NU1 E;  1MUU A;  2OYI A;  2R3C A;  3OA7 A;  2KS1 A;  5KAI E;  1L0N D;  1J1D C;  1BCC D;  1VQN P;  1ZP0 C;  1T2K D;  1AVY A;  5KLI B;  1N7S B;  5CCG A;  2FYU J;  1SS1 A;  1Q2N A;  2L91 A;  2YKQ A;  3BCC J;  3HD7 B;  1JY3 O;  1NTZ D;  1G1I A;  2C0X A;  3EFF K;  1MV8 A;  3VMY A;  2BCC E;  2N1T C;  1EXI A;  1UIX A;  2WT7 A;  2NZ2 A;  4WY4 A;  2KI7 B;  2Z5I A;  2AXT E;  3B5N D;  1RE4 A;  1KOR A;  3LW5 H;  2K9J A;  4H13 B;  4N78 D;  1EZV E;  1GDT A;  2YXR B;  2NRG A;  4AYZ B;  1H89 A;  2BCC G; 
#chains in the Genus database with same CATH homology
 3GPV A;  5I44 A;  2KCU A;  2E76 D;  2H88 C;  1VF5 B;  3Q5S A;  1DIP A;  1Q06 A;  1S1C X;  5KAU A;  5KAT A;  1OW7 A;  2MKV A;  2QIW A;  4WLW A;  2IEF A;  2QJK C;  1AJY A;  1WMK A;  4Y28 J;  3FGA D;  3RL0 g;  3GK6 A;  1IK7 A;  4OGQ B;  2E75 D;  3LUR A;  2BEZ F;  5KKZ C;  3EZ6 A;  2G8Y A;  3AE7 C;  1ZME C;  2ZT9 C;  3GLM A;  5GQQ A;  1S5L X;  5M1B A;  1RQV A;  1FDI A;  3AE8 C;  1GMJ A;  3QAO A;  4R4M A;  3AE5 C;  3GF7 A;  4H0L D;  3UCS A;  2JML A;  4YXD C;  2O01 J;  1JBG A;  1EXJ A;  2WSE J;  2JO1 A;  1Y9B A;  3AEC C;  2J5U A;  4PV1 D;  3IN6 A;  2ZT9 B;  1PM6 A;  3H25 A;  1Q0A A;  2QJP C;  3GMA A;  1Q05 A;  3Q1M A;  2WSF J;  4YTP C;  1Y6U A;  3AE9 C;  5KAX A;  4B0Y A;  1LX8 A;  1JYH A;  1ZOY C;  4H13 D;  1DD3 A;  3Q5R A;  2G3A A;  4H44 B;  4IL6 X;  2E76 B;  4R4L A;  3O6Q A;  3HH0 A;  3ABV C;  3AEF C;  3AEB C;  4TT3 H;  1Q07 A;  1YQ3 C;  3AE4 C;  3AEA C;  1Q08 A;  4J2N A;  5KAV A;  2D2C D;  1ZP0 C;  4RKU J;  4A1M A;  1VL2 A;  2QSI A;  2JP3 A;  1OW8 A;  3EZF A;  1VF5 D;  2E74 D;  4H44 C;  3IAO A;  1HJ0 A;  1NGM B;  5KAW A;  1HF9 A;  2E76 C;  4R4E A;  3D6Z A;  2VZ4 A;  5E01 A;  3AE2 C;  3Q3D A;  1FDO A;  3T97 B;  4H0L B;  1BOW A;  3SFE C;  3B49 A;  3AE6 C;  3B71 A;  2V7Q J;  4OGQ D;  1R8D A;  4PV1 B;  4KT0 J;  5KLI C;  2E75 C;  4I7Z C;  3E0H A;  4WLS A;  1MKM A;  1KQF B;  1K04 A;  5I41 B;  1Q09 A;  2IDB A;  3AED C;  1EXI A;  1UIX A;  5D90 A;  2P10 A;  2YIU C;  4H0L C;  3Q5P A;  1TU3 F;  3GP4 A;  3AE3 C;  1OMI A;  3EWK A;  2ZT9 D;  2NZ2 A;  2FYN C;  1U57 A;  1R8E A;  1KMI Z;  2E75 B;  4R24 B;  3AEG C;  4I7Z B;  2BEQ D;  4H44 D;  3D6Y A;  2BOW A;  4PV1 C;  5D8C A;  1PV3 A;  1PL5 A;  4DCZ A;  1DD4 A;  1KQG B;  3AE1 C;  2QJY C;  3AEE C;  4AYZ A;  2WQY C;  3C8V A;  2E74 B;  3G9R A;  2OG0 A;  4H13 C;  1D5Y A;  2HVA A;  3EZ9 A;  2KVV A;  3D71 A;  2K9Y A;  3GF3 A;  2YMK A;  5L8R J;  2ZHH A;  1JB0 J;  2OQQ A;  2GOV A;  3LW5 J;  1YQ4 C;  1RH6 A;  1KOR A;  3EZ7 A;  3EZ2 A;  2FBW C;  2H89 C;  2DG6 A;  1PIX A;  2WSC J;  4XFJ A;  4GDO A;  1OW6 A;  2D2C C;  3SFD C;  4H13 B;  2FXP A;  5KCB A;  1VF5 C;  3D70 A;  2E74 C;  2WPV B;  1K05 A;  3Q2Y A;  3S9O A;  3R8K A;  3R4Y A;  3R8J A;  1RQU A;  1ZRT E;  4Z1M H;  1Q90 D;  4LHF A;  1NYH A;  4R22 B;  3RK3 E;  4AYZ B;  2ZHG A;  4OGQ C;  2D2C B;  1KTM A;  1KIL E;  4U7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...