3D6ZA

Crystal structure of r275e mutant of bmrr bound to dna and rhodamine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
total genus 76
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d6zA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d6zA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d6zA03
2J5UA 5GQQA 2OQQA 1Q08A 1JBGA 2DG6A 3HH0A 3Q5RA 2BOWA 2GOVA 2HVAA 2ZHGA 1JYHA 4R24B 3Q3DA 2VZ4A 3D6YA 3GK6A 3B49A 4R4EA 3Q1MA 5KAUA 1D5YA 1Q09A 4WLSA 3Q2YA 1R8EA 4R22B 4B0YA 3R8JA 1EXIA 3G9RA 5KAXA 5I44A 5KAWA 5D90A 5KAVA 2JMLA 5D8CA 3D6ZA 3IAOA 3LURA 3GP4A 3D70A 3E0HA 1R8DA 1Q07A 3UCSA 5E01A 1Q06A 4R4MA 4WLWA 4A1MA 4AYZA 5KCBA 1BOWA 3Q5PA 3QAOA 4AYZB 3D71A 3T97B 2KCUA 5KATA 2ZHHA 1EXJA 3Q5SA 5I41B 4J2NA 3R8KA 1Q0AA 3GPVA 1Q05A 4R4LA 1DIPA
chains in the Genus database with same CATH superfamily
2E75D 3CX5H 5H2FE 3H1KG 3AE4C 4AQRD 2IFNA 2N9YB 4BXLA 2YKPA 3RK2D 2RKLA 2Q3IA 2GM4A 1NTZK 2WPRA 2N1TA 4TT3H 4OWFA 1FS0E 1FZEA 3P32A 4PV1B 3V5BA 2VZ4A 3CCLP 2XV5A 1UIIA 5EFWB 1YJ9P 1IFDA 1GK4A 1EC5A 3HUSB 3TK1A 5E79H 1QX8A 5CCHD 4H13B 3RK3D 4CPGA 1KB9H 3HE5B 3M0AA 1NAYA 3CCRP 5KLVK 1BSHA 2QJPB 2OYHB 1URQD 2YIUB 1KORA 4O9BA 3R4YA 3RBXA 2JR8A 2KLUA 1USDA 2J59M 3II6A 3H1HD 3CWBG 1FZGA 3GF7A 1BE3D 1SVFA 3AEGC 2I1JA 4D6TD 2FXOA 3Q2YA 4EIJA 2GUSA 4JBZA 3I56P 1SFCD 3CCMP 3LURA 1GW3A 3H1IJ 1P84I 4OGQC 3H1JD 4ZKUA 1HGZA 3CCQP 1EDKA 1JY3P 1G1JA 1DEEG 3EFFK 1N8RQ 3C9IA 1M1JB 4PD4E 3D6ZA 3CCVP 1N7SB 3E0HA 5E01A 4D6TJ 4PV1D 5BVZA 4C7NB 3P8CD 3AE2C 1NTMK 1L0LK 2E5YA 1LTSC 1VDFA 3TNUB 4A7PA 1NAFA 3FWNA 4H13D 5AVTB 2FBWC 3H1KD 3CL3D 5CBOA 3EZFA 2N1TD 1S72P 4BWNA 1Q86Q 3D71A 1H0TB 4TLFA 1PV3A 1PP9E 1JY2P 1AQ5A 1YBKA 2K9YA 1OVRA 4B86A 2WPVB 3S1KA 2AXTH 2ZYDA 2OYIA 4EOTA 2YKQA 4UB6H 2AEFA 1LTJC 2JO1A 1GTWA 3M0DC 4GOEA 1UIXA 3VN0A 3H32A 5AW5B 2M8RA 3NXSA 5CBNA 2BCCG 5CCGA 3CPWO 3GHGA 2YO3A 1L4AB 3N4XA 4WY4A 1GDTA 1MV8A 1JM0A 3L75G 3KPEA 1QEXA 1KQFB 3EZ6A 1KV4A 1BGYE 1EZVI 1JTHA 2JJLA 1VQ7P 1Y47A 3CWBD 1N7SD 1RE4C 1SQQK 3WUUA 3P8MC 2POHA 2W27A 5M1BA 2Z5IA 2WTYA 2R5DA 1SQXK 2Q9IA 1NU1E 2C0WA 2VRSA 1R5SA 1KYOD 2N9BA 2KUBA 3MP7B 5KAFE 1KTMA 3D6YA 3LW5J 1U7MA 1EDIA 2WMMA 2KZJA 2E42A 3R2PA 2QSIA 4Y28J 4JQ0D 1Q81Q 1NTZG 3B4SA 1L0NE 1NKNA 2QE7H 4L73A 2R44A 3L71G 1RE3C 3GG2A 3TGUG 2WWWA 2K1AA 5APVA 3BASA 4C7RA 1PGPA 3BCCE 2WPQA 5KTBA 5D90A 1LWUA 5KAVA 1S2EA 1LX8A 2P10A 2K9JB 1KQLA 5KATA 4ASWA 1VQ5P 1L4AD 3L70E 3PHLA 3VP9A 4XE5B 3G3ZA 4N3YB 2NPSA 2FFDC 1VQLP 3CCJP 2FYNB 4PJ0E 2WSCH 3F5HA 1T2KC 3KYQA 3V2QA 1FZBA 5CCGD 2Y9ZA 3BATA 4WY4D 4HB1A 4GOFA 2HPCB 4M3LA 2BCCD 3PRJA 3BRTB 1NU1J 1S5LH 4U3FG 4UB8H 3L75D 3CXHE 5KKZC 1NTKD 1S3JA 4J2NA 3M9HA 1QVFO 2H8PD 3B5NC 4AUWA 1HJ0A 1D5YA 3ITKA 1R8EA 2WSFH 1RQUA 1KILA 4NPFX 3CD6P 1L0NJ 1M57D 3HD7A 1VQ4P 5AW0B 4AYZA 1Q2NA 5B5EH 3TSIA 1RF1C 3A0BE 1L0LG 4OGQB 1W2BO 1GZLA 3L75J 3O6QA 1NTKJ 3GW6A 5B66E 5GTIH 3BCCJ 3WU2H 1IFMA 2K3RA 1N73A 3G9RA 3USSA 2XU6A 3MD0A 1FU1A 1GL2A 3JC22 3HE4A 1FDOA 3L70J 1DD4A 1LT1A 3H1LG 5AW6B 5TJHA 3L71D 2HODA 5DJTB 3E1RA 1P84E 2PP6A 1OXZA 2XKMA 1KB9I 1SQBE 1KC8Q 3MHVA 1T3UA 1KILE 2W8ZA 1J1DC 2XNXA 5APWA 4N78E 1YQ4C 1HJBA 1SQVD 3AE9C 1YHQP 1EZVG 4I2LC 1CI6A 1RY3A 3QAOA 3T97A 3CC2P 1HUCA 2LXBA 5GQQA 1SQQG 1H89A 5CMZA 1VQ8P 5K5GB 2IZ1A 1SQXG 2QJYC 2H43A 1SQVJ 2YMYA 1EXJA 3SWKA 3OA7A 3IR9A 2P58A 3GPVA 1Q05A 1SS1A 2I1KA 2H89C 5CCHA 1AA0A 2KS1A 1BDCA 4YXWH 1BCCE 2FKWB 5KAIE 2KI7B 5H2FH 5AVVB 1AVYA 3H25A 1N86A 2M5AA 1EDJA 1HBWA 3HTKA 1FC2C 2D2CB 1PPJG 2ZAEB 1URQA 2LKMA 3N7NA 1NU1K 3BRVB 5CJ4A 2OQQA 2BOWA 1KFNA 3GK6A 1GL2D 1SQBJ 3EZ7A 4DCZA 4MN4C 1Q07A 1GW4A 4WLWA 1BOWA 1SP4A 1T3JA 3U59A 1LT9C 1L0NK 2RH0A 1YITP 2LR2A 3H1LD 3SWYA 3RK3E 3TF5A 1AFOA 4LC1A 2E5TA 3PJSK 1VF5C 3VYIA 2ZT9C 3CLQA 2FFDB 3M91A 3HUSA 3H1HE 2BASA 2YKOA 1BE3E 1AJYA 1OFCX 1EZVD 4D6TE 1U7JA 3R8KA 1JY3O 1AV1A 1WRGA 2K37A 1FOSF 3HH0A 4H0LC 1WT6A 1BCCJ 3L73G 1JYHA 1JUNA 2ZVNB 4DZOA 2JWDA 2I8DA 3H1JE 2D2CD 2OYHA 2OYOA 2HYNA 2YMKA 4PD4H 4IL6E 3W68A 3L74G 1QVGO 1J1EC 1Y6UA 2JWAA 2OTLP 4LLHA 3AE3C 1JB0J 3B5NB 3NTNA 1BSNA 2OTJP 5I44A 3P8CE 2JMLA 1IFJA 3LW5H 2KK7A 4XFJA 3UCSA 1JY2O 2NPSC 3VMXA 3G4SP 5AVYB 1PPJD 3LIEA 1RF1B 2CPSA 3H1KE 4DJGA 4WBAA 2JKVA 1Q09A 1LGHB 3IFMA 1ZRTD 1TU3F 4YPCA 1VPCA 1FZFA 3CMEP 4L75A 1Z56A 1N7SA 1W2EA 2KOGA 1JOCA 3AEFC 4C7NA 1HTLC 2FYUG 2IDBA 1SQPG 2AXCA 3H1HJ 3TNUA 3G6EP 1MFZA 1BE3J 1KFMA 1OVVA 1X9VA 1XTCC 2IBZG 1H0TA 2CK3H 1SQBK 4QMAA 2BEZF 3AECC 2GUVA 1GMJA 2G8YA 1J1DB 2A45H 1KILC 3H1JJ 4H44C 2P2UA 2O01J 3HD7C 1NO4A 1FZAA 2ITAA 2E76C 5KJ7A 5APYA 3CWBE 3M06A 5KAFH 1RF0A 5BU8B 3EZ9A 2KB7P 1L4AA 1YYCA 3L73D 1KYOE 2O01N 4IOIH 1D7MA 5TISE 3S9OA 2QJYB 2R3CA 2RN0A 2E43A 3L74D 1R8DA 3H1KJ 1ZR2A 1QL2A 3G71P 2WT7B 3L73J 5KLIC 1AQTA 1VL2A 1PGJA 3L72G 2E75C 4GODA 3Q1MA 1DH3A 1JY3N 4JPZB 5CJ0A 1KB9D 1YQ3C 1L2PA 2OARA 3A3YB 2KP8A 4PJ0H 1K73Q 1EDLA 2QIWA 1ZMEC 2CPBA 1LTBC 2FYUD 2IPPA 1S1CX 1LT9B 2Y0DA 2UWJE 1OW7A 1SQPD 5APTA 4I7ZB 2R3SA 2OG0A 1G2CB 1K05A 2K9JA 3CWBJ 1FZCB 3CXHH 5CCHC 2IBZD 2BCCE 2J58A 2V7QH 3RK3C 1VF5B 3NFQA 1PL5A 1H8AA 1A02J 2NRGA 1JY2N 4WLSA 3L75E 2ZT9B 1NTKE 3L35A 5KJ7D 1ZV8A 2KZIA 2FYUJ 1ZOYC 1URQC 2Q3EA 1LTGC 3CI9A 3KQGA 3A0BH 1X79B 2HPCA 2DW3A 5KLVG 2KNCB 3IN6A 1QLED 2C9LY 5B66H 4H0LB 4Y99C 1QL1A 1PZQA 2ZJSE 1Q90D 1SFCC 2PGDA 4RJTA 2HR3A 2RMZA 3KZIE 1HH0A 1P84H 3L71E 2R32A 1MFTA 1FJKA 2A06G 3PTZA 1LNQA 3CMAP 3L72D 4IL6X 3I5CA 1OW6A 5KAXA 3CX5I 4H13C 3WMM0 2G3AA 1VF5D 4ZMDA 2BCCJ 1LTAC 2N1TC 1GD2E 1NTMG 1NJIQ 1SQVE 1LP1B 1W5CE 4GIFA 4R4LA 3V6IA 2B87B 4EYYQ 3V2NA 3L37A 2YIUC 2PAJA 3TDKA 3I55P 3L72J 2W6AA 2W90A 1NTZD 4PD4I 4HH2A 2R5BA 3TGUD 4AYCA 3IF4A 1FDMA 1EXIA 5KAIH 2KXPB 4H44B 3CCSP 1Y9BA 4NPEA 4NPDA 3MIWA 1PFIA 3MGNA 1KZUB 1N2DC 2E76B 3CC7P 5APSA 1PGQA 3RGUA 3Q5RA 5AW9B 3M9BA 1NH4A 1NTZJ 5KLVD 1N7SC 4KHXA 3L71J 3TGUJ 2W6JH 4GDOA 3C1LA 2IYPA 3SSUA 1LTJB 3MZWB 2IBZI 2ZXEB 2B88A 2Y0CA 1KMIZ 4BRYB 5KAUA 2O1KA 5GTHE 1RE4A 1ZR4A 4HYTB 5APQA 2L91A 2WSEJ 4K35A 3JCUE 4OGQD 4U3FD 3H1LE 2KCUA 2ZHHA 4ZKPA 4W80A 4W7ZA 5KLIB 1Q08A 1FDIA 2Q6QA 2M0BA 2WQYC 2A06D 1IJDB 4JYBA 2A45I 3U1AA 3PLNA 2GA1A 1EQ7A 2MJZA 2Q7CA 1M56D 1RF0C 2YXQB 3FX0A 1L4AC 1NTMD 3H1IG 1RE3A 2OYIC 1L0LD 1MUUA 4U3FJ 1EZVE 2WSCJ 1KQGB 3A5TA 1OWAA 2O01H 5KCBA 3FXDA 1NHLA 2IFMA 4IL6H 1SQQE 5I41B 3OAKA 1J2JB 5CCGC 3VOPA 1SLQA 1S9KD 3GHGC 4WY4C 3SWFA 2FFDA 3VMYA 1KN7A 2HG5D 2B89A 1L0LJ 2FXMA 1ZN5A 4Z1MH 3MUDA 2JDIH 4IFFA 1NTKK 1OW8A 1JO5A 1JNMA 1JBGA 1T8ZA 3AE1C 1USEA 3L36A 2FYZA 2XZRA 3UIAA 1PPJE 1MKMA 3A0HE 3H1LJ 1NVOA 1SFCB 2ZXXA 3OW2O 2E74C 1ZRTE 4R24B 3HE5A 3EZ2A 4U7JA 2QM8A 3B5NA 1SQQD 5APUA 2IYOA 1SQXD 3RBZA 4C46A 1Q0AA 1IFNA 5KKZB 1RF1A 2C9NY 3CXHI 3H6PA 1KD1Q 2QG4A 1LWUC 2FYNC 4DOJA 2YNYA 3K5BA 1SQQJ 1NOHA 2AEMA 2JP3A 2N1TB 1SQXJ 3FXEA 5AW2B 2DG6A 3EWKA 2O1JA 3Q3DA 1H88A 1CW5A 3H1ID 1SQVK 4JYCA 1KYOH 1M1JA 4GT1A 3GMAA 2AEJA 3B71A 5TISH 3NMDA 2P67A 3Q5SA 1VQ9P 3L73E 1U57A 4ASVA 3AE8C 3CX5E 1DIPA 2M3EA 2HVAA 1PP9G 4WVZA 5APXA 1VQMP 2WZ7A 3L4FA 3L74E 1FBMA 1T2KD 3AEDC 1JMMA 3RL0g 3RL0C 3EFGA 4XA4A 1MZ9A 3PH0A 4N6JA 4L74A 1HF9A 4IFMA 1K04A 3SFEC 1AVOA 5E79E 5AVSB 1Q06A 2W6BA 1KB9E 3B5ND 3KXDA 1BGYG 1KQSO 1FJPA 1N73C 2A45G 5AW7B 1GL2C 3MTUE 2H7HA 5KAWA 3CX5D 4KT0J 1LTIC 2WT7A 2Q1KA 2BEQD 5DJUB 2HFED 3M9QA 2FYUE 3Q5PA 2KIKA 2IX7C 3V4QA 1NU1G 5AVWB 1M8OB 2KSJA 1SQPE 1S5LX 5AVXB 2ZHGA 1OIPA 2C0XA 2HLOA 2IBZE 1XTGB 3IAOA 2WPSA 1RH6A 4YTPC 2QRXA 3PP5A 4PD4D 1L0NG 1N7LA 4GKGA 1GU4A 1R5LA 2JEEA 1LT9A 1RHZB 3VTPC 2OYIB 3L74J 3CCUP 1G1IA 2QJKC 5AW8B 1G2CA 1VQNP 5AW4B 1NTKG 3BCCG 2ZYAA 4HKZH 1S4XA 1FZCA 1YTZT 1X8YA 1IO4A 3RK2C 3O8ZA 3H32B 1A02F 2GOVA 1GU5A 3L70G 3GHGB 1PP9D 4WY4B 3KZIH 3VMAA 1FE6A 3P7KA 1VQPP 2D2CC 3AE7C 4RKUJ 1HWTC 3D70A 4EDFA 4A1MA 4HJGH 1JTHB 3AE6C 2AXTE 2KNCA 2KSEA 2H88C 3VMZA 1JCDA 4UB6E 1PGOA 5D8CA 2WSSH 2XDJA 3FGAD 1PP9J 1SQPJ 2WSEH 4IFDK 3L72E 3WUVA 5CHXA 3KHUA 3WUTA 1QGKB 2V4HA 1OMIA 1BGYD 2E74B 1X0TA 3OJAB 1Q82Q 5BU5A 3E1IA 2Y9YA 4W7YA 2L5GB 1RQVA 3E7KA 2B9BA 2K88A 4OVNF 2KYVA 1NU1D 3S4RA 1J1EB 1SQVG 3B49A 1IK7A 2ZFCA 2KVVA 2Z5HA 1NGMB 3MUDC 1NTZE 2QVAA 1LWUB 3B8EB 1BGYJ 5AVRB 4R4MA 4DCKA 3ABVC 3TGUE 3C8VA 4PV1C 1LP1A 1WMKA 2B87A 2J5UA 3W67A 2FY8A 1L0ND 2NPSB 2KLVA 3HUSC 1IZNB 2M3BA 4YXDC 1LTTC 1HGVA 5AVQB 4L76A 1K8AQ 4I6MC 1NWQA 1SQBG 3BCCD 3BVHA 5KLVE 3AE5C 2ZT9D 2IEFA 1PIXA 2ZVOB 1NYHA 2QJPC 4R4EA 2OYHC 1VQKP 3L70D 4I1LA 1YTZI 1OX3A 4DT0A 4LGDE 5GTHH 1BDDA 4RO0A 3JCUH 2IZ0A 1Q7YQ 2E74D 2PFXA 2YO2A 4H0LD 3TYYA 1RH5B 3SFDC 3RL0B 3LIDA 4U3FE 3A7OA 1KILB 5AVUB 2W83C 3HD7B 4AYZB 2NZ2A 3A2AA 3V2PA 1GK6A 1LTJA 2A06E 3M0DA 4BRYA 1Y8AA 3CXHD 3O6QB 1PM6A 2QA4P 1DEBA 1M1JC 1M1KQ 4RESB 3GLMA 4B0YA 3U1CA 5AW1B 1N73B 1S5LE 1HVVA 3KDPB 1BCCG 4UB8E 1K9MQ 1GL2B 5AW3B 1OZHA 3HE4B 1NTME 3AEEC 1E5WA 1ZP0C 2QM7A 1L0LE 3CC4P 5AVZB 4EI2A 1KYOI 2NPSD 4WB4A 1IK9A 3HRNA 3JSVC 2FYUK 2HODB 2Y0EA 1VQ6P 1SQPK 1DD3A 5C39A 2O3JA 2WVRA 4KJMA 1JCCA 3CCEP 4WWIA 1JMBA 2V7QJ 1S9KE 5B5EE 3GF3A 5KLVJ 3ZDMA 2OTKE 3V4WA 1ZXGA 5GTIE 3WU2E 3AEBC 2E75B 4K3AA 2Z4EA 5KJ7C 2LXCB 2QJKB 1P84D 1DX7A 1CI6B 3A0HH 3EQ2A 1JEKA 3T97B 1SQBD 2Q5UA 2FXPA 5L8RJ 3RL0D 3RK2B 2SPZA 1KILD 4OH8B 4H44D 3HD7D 1IC2A 2P7JA 1CSBA 4N78D 2E76D 1OVUA 2WITA 1IFIA 3H1HG 1LJ2A 2MKVA 1BE3G 1M7LA 1YIJP 1YJNP 3VP8A 4D6TG 2KS1B 1FOSE 1SQXE 4LHFA 3RK3B 1ZLLA 4R22B 3R8JA 2OGUA 1E79H 1ZW0A 1NKZB 1NTMJ 2M5AB 1M90Q 1X22A 2P1JA 2PRRA 3HTKB 3H1JG 2ZYGA 3F89A 1CZQA 4JF7A 1SFCA 1URQB 1T6AA 3FWLA 2WSFJ 2QEXP 4I7ZC 1YJWP 1FAVA 3V2RA 1IFPA 4ZNCA 1FZCC 4Y99B 3GP4A 2XNDH 1YI2P 1BCCD 3AEAC 1VQOP 3QWOC 3H1IE 3QH9A 2YXRB
chains in the Genus database with same CATH topology
2E75D 2IEFA 1PIXA 3AE6C 1NYHA 2QJPC 3IN6A 4R4EA 1YQ4C 2H88C 3AEBC 1Q09A 4H0LB 2FYNC 2WSCJ 1KQGB 2E75B 1TU3F 3AE4C 1EXIA 3AE9C 5KAWA 4KT0J 1Q90D 5M1BA 5D8CA 3D6ZA 4H44B 3RK3E 2BEQD 1Y9BA 3E0HA 5E01A 3FGAD 4PV1D 5KLIC 5KCBA 3Q5PA 3QAOA 5KKZC 3AEFC 3T97B 2E74D 1VF5C 2E76B 5I41B 4J2NA 2FXPA 2JP3A 1S5LX 4TT3H 1VL2A 3AE2C 4H0LD 5L8RJ 5GQQA 2DG6A 4PV1B 3EWKA 1KTMA 3Q5RA 1HJ0A 1OMIA 2ZT9C 2ZHGA 2E75C 2IDBA 3Q3DA 2VZ4A 3D6YA 2E74B 3SFDC 3Q1MA 4H44D 3LW5J 1D5YA 1R8EA 1RQUA 2QSIA 1YQ3C 4H13D 3IAOA 2E76D 2QJYC 2FBWC 4Y28J 1RH6A 4YTPC 4Z1MH 3GMAA 3EZFA 4GDOA 1RQVA 1AJYA 4AYZA 4AYZB 2NZ2A 3D71A 3B71A 1OW8A 1EXJA 3Q5SA 1PV3A 2QIWA 4H13B 2MKVA 3R8KA 2BEZF 3GPVA 1U57A 3AE8C 1Q05A 3AECC 4OGQB 1ZMEC 1DIPA 1KMIZ 3HH0A 1JBGA 1GMJA 2G8YA 2H89C 4H0LC 2HVAA 2K9YA 1JYHA 3AE1C 3O6QA 1PM6A 3B49A 1IK7A 2WPVB 1S1CX 5KAUA 4LHFA 4IL6X 1OW7A 4H44C 4R22B 1OW6A 2KVVA 3GLMA 3R8JA 4B0YA 2O01J 4I7ZB 3H25A 3G9RA 2QJKC 1NGMB 5KAXA 2D2CD 5D90A 5KAVA 2OG0A 1KORA 2YMKA 2WSEJ 1LX8A 1K05A 4H13C 1MKMA 2P10A 2E76C 2G3AA 4OGQD 2JO1A 3AEEC 1VF5D 4R4MA 1FDOA 1ZP0C 3AEDC 3ABVC 3R4YA 5KATA 2KCUA 3C8VA 1UIXA 2D2CB 2ZHHA 1DD4A 4PV1C 3RL0g 1Y6UA 2E74C 1ZRTE 4R4LA 1WMKA 2J5UA 1VF5B 2OQQA 1Q08A 2GOVA 1FDIA 1PL5A 2WSFJ 3GF7A 2BOWA 4R24B 4I7ZC 3EZ2A 4U7JA 3EZ9A 2WQYC 1JB0J 3AE3C 3AEGC 3GK6A 4WLSA 2YIUC 2ZT9B 3Q2YA 3EZ7A 1DD3A 4YXDC 4DCZA 1HF9A 5I44A 2JMLA 1K04A 3SFEC 4XFJA 2D2CC 3AE7C 3LURA 3GP4A 1ZOYC 4RKUJ 3D70A 2V7QJ 1KQFB 3EZ6A 1Q07A 3UCSA 4A1MA 1Q06A 4WLWA 3GF3A 3S9OA 1BOWA 4OGQC 1KILE 3AEAC 1Q0AA 3AE5C 1R8DA 2ZT9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5U A;  5GQQ A;  2OQQ A;  1Q08 A;  1JBG A;  2DG6 A;  3HH0 A;  3Q5R A;  2BOW A;  2GOV A;  2HVA A;  2ZHG A;  1JYH A;  4R24 B;  3Q3D A;  2VZ4 A;  3D6Y A;  3GK6 A;  3B49 A;  4R4E A;  3Q1M A;  5KAU A;  1D5Y A;  1Q09 A;  4WLS A;  3Q2Y A;  1R8E A;  4R22 B;  4B0Y A;  3R8J A;  1EXI A;  3G9R A;  5KAX A;  5I44 A;  5KAW A;  5D90 A;  5KAV A;  2JML A;  5D8C A;  3D6Z A;  3IAO A;  3LUR A;  3GP4 A;  3D70 A;  3E0H A;  1R8D A;  1Q07 A;  3UCS A;  5E01 A;  1Q06 A;  4R4M A;  4WLW A;  4A1M A;  4AYZ A;  5KCB A;  1BOW A;  3Q5P A;  3QAO A;  4AYZ B;  3D71 A;  3T97 B;  2KCU A;  5KAT A;  2ZHH A;  1EXJ A;  3Q5S A;  5I41 B;  4J2N A;  3R8K A;  1Q0A A;  3GPV A;  1Q05 A;  4R4L A;  1DIP A; 
#chains in the Genus database with same CATH topology
 2E75 D;  3CX5 H;  5H2F E;  3H1K G;  3AE4 C;  4AQR D;  2IFN A;  2N9Y B;  4BXL A;  2YKP A;  3RK2 D;  2RKL A;  2Q3I A;  2GM4 A;  1NTZ K;  2WPR A;  2N1T A;  4TT3 H;  4OWF A;  1FS0 E;  1FZE A;  3P32 A;  4PV1 B;  3V5B A;  2VZ4 A;  3CCL P;  2XV5 A;  1UII A;  5EFW B;  1YJ9 P;  1IFD A;  1GK4 A;  1EC5 A;  3HUS B;  3TK1 A;  5E79 H;  1QX8 A;  5CCH D;  4H13 B;  3RK3 D;  4CPG A;  1KB9 H;  3HE5 B;  3M0A A;  1NAY A;  3CCR P;  5KLV K;  1BSH A;  2QJP B;  2OYH B;  1URQ D;  2YIU B;  1KOR A;  4O9B A;  3R4Y A;  3RBX A;  2JR8 A;  2KLU A;  1USD A;  2J59 M;  3II6 A;  3H1H D;  3CWB G;  1FZG A;  3GF7 A;  1BE3 D;  1SVF A;  3AEG C;  2I1J A;  4D6T D;  2FXO A;  3Q2Y A;  4EIJ A;  2GUS A;  4JBZ A;  3I56 P;  1SFC D;  3CCM P;  3LUR A;  1GW3 A;  3H1I J;  1P84 I;  4OGQ C;  3H1J D;  4ZKU A;  1HGZ A;  3CCQ P;  1EDK A;  1JY3 P;  1G1J A;  1DEE G;  3EFF K;  1N8R Q;  3C9I A;  1M1J B;  4PD4 E;  3D6Z A;  3CCV P;  1N7S B;  3E0H A;  5E01 A;  4D6T J;  4PV1 D;  5BVZ A;  4C7N B;  3P8C D;  3AE2 C;  1NTM K;  1L0L K;  2E5Y A;  1LTS C;  1VDF A;  3TNU B;  4A7P A;  1NAF A;  3FWN A;  4H13 D;  5AVT B;  2FBW C;  3H1K D;  3CL3 D;  5CBO A;  3EZF A;  2N1T D;  1S72 P;  4BWN A;  1Q86 Q;  3D71 A;  1H0T B;  4TLF A;  1PV3 A;  1PP9 E;  1JY2 P;  1AQ5 A;  1YBK A;  2K9Y A;  1OVR A;  4B86 A;  2WPV B;  3S1K A;  2AXT H;  2ZYD A;  2OYI A;  4EOT A;  2YKQ A;  4UB6 H;  2AEF A;  1LTJ C;  2JO1 A;  1GTW A;  3M0D C;  4GOE A;  1UIX A;  3VN0 A;  3H32 A;  5AW5 B;  2M8R A;  3NXS A;  5CBN A;  2BCC G;  5CCG A;  3CPW O;  3GHG A;  2YO3 A;  1L4A B;  3N4X A;  4WY4 A;  1GDT A;  1MV8 A;  1JM0 A;  3L75 G;  3KPE A;  1QEX A;  1KQF B;  3EZ6 A;  1KV4 A;  1BGY E;  1EZV I;  1JTH A;  2JJL A;  1VQ7 P;  1Y47 A;  3CWB D;  1N7S D;  1RE4 C;  1SQQ K;  3WUU A;  3P8M C;  2POH A;  2W27 A;  5M1B A;  2Z5I A;  2WTY A;  2R5D A;  1SQX K;  2Q9I A;  1NU1 E;  2C0W A;  2VRS A;  1R5S A;  1KYO D;  2N9B A;  2KUB A;  3MP7 B;  5KAF E;  1KTM A;  3D6Y A;  3LW5 J;  1U7M A;  1EDI A;  2WMM A;  2KZJ A;  2E42 A;  3R2P A;  2QSI A;  4Y28 J;  4JQ0 D;  1Q81 Q;  1NTZ G;  3B4S A;  1L0N E;  1NKN A;  2QE7 H;  4L73 A;  2R44 A;  3L71 G;  1RE3 C;  3GG2 A;  3TGU G;  2WWW A;  2K1A A;  5APV A;  3BAS A;  4C7R A;  1PGP A;  3BCC E;  2WPQ A;  5KTB A;  5D90 A;  1LWU A;  5KAV A;  1S2E A;  1LX8 A;  2P10 A;  2K9J B;  1KQL A;  5KAT A;  4ASW A;  1VQ5 P;  1L4A D;  3L70 E;  3PHL A;  3VP9 A;  4XE5 B;  3G3Z A;  4N3Y B;  2NPS A;  2FFD C;  1VQL P;  3CCJ P;  2FYN B;  4PJ0 E;  2WSC H;  3F5H A;  1T2K C;  3KYQ A;  3V2Q A;  1FZB A;  5CCG D;  2Y9Z A;  3BAT A;  4WY4 D;  4HB1 A;  4GOF A;  2HPC B;  4M3L A;  2BCC D;  3PRJ A;  3BRT B;  1NU1 J;  1S5L H;  4U3F G;  4UB8 H;  3L75 D;  3CXH E;  5KKZ C;  1NTK D;  1S3J A;  4J2N A;  3M9H A;  1QVF O;  2H8P D;  3B5N C;  4AUW A;  1HJ0 A;  1D5Y A;  3ITK A;  1R8E A;  2WSF H;  1RQU A;  1KIL A;  4NPF X;  3CD6 P;  1L0N J;  1M57 D;  3HD7 A;  1VQ4 P;  5AW0 B;  4AYZ A;  1Q2N A;  5B5E H;  3TSI A;  1RF1 C;  3A0B E;  1L0L G;  4OGQ B;  1W2B O;  1GZL A;  3L75 J;  3O6Q A;  1NTK J;  3GW6 A;  5B66 E;  5GTI H;  3BCC J;  3WU2 H;  1IFM A;  2K3R A;  1N73 A;  3G9R A;  3USS A;  2XU6 A;  3MD0 A;  1FU1 A;  1GL2 A;  3JC2 2;  3HE4 A;  1FDO A;  3L70 J;  1DD4 A;  1LT1 A;  3H1L G;  5AW6 B;  5TJH A;  3L71 D;  2HOD A;  5DJT B;  3E1R A;  1P84 E;  2PP6 A;  1OXZ A;  2XKM A;  1KB9 I;  1SQB E;  1KC8 Q;  3MHV A;  1T3U A;  1KIL E;  2W8Z A;  1J1D C;  2XNX A;  5APW A;  4N78 E;  1YQ4 C;  1HJB A;  1SQV D;  3AE9 C;  1YHQ P;  1EZV G;  4I2L C;  1CI6 A;  1RY3 A;  3QAO A;  3T97 A;  3CC2 P;  1HUC A;  2LXB A;  5GQQ A;  1SQQ G;  1H89 A;  5CMZ A;  1VQ8 P;  5K5G B;  2IZ1 A;  1SQX G;  2QJY C;  2H43 A;  1SQV J;  2YMY A;  1EXJ A;  3SWK A;  3OA7 A;  3IR9 A;  2P58 A;  3GPV A;  1Q05 A;  1SS1 A;  2I1K A;  2H89 C;  5CCH A;  1AA0 A;  2KS1 A;  1BDC A;  4YXW H;  1BCC E;  2FKW B;  5KAI E;  2KI7 B;  5H2F H;  5AVV B;  1AVY A;  3H25 A;  1N86 A;  2M5A A;  1EDJ A;  1HBW A;  3HTK A;  1FC2 C;  2D2C B;  1PPJ G;  2ZAE B;  1URQ A;  2LKM A;  3N7N A;  1NU1 K;  3BRV B;  5CJ4 A;  2OQQ A;  2BOW A;  1KFN A;  3GK6 A;  1GL2 D;  1SQB J;  3EZ7 A;  4DCZ A;  4MN4 C;  1Q07 A;  1GW4 A;  4WLW A;  1BOW A;  1SP4 A;  1T3J A;  3U59 A;  1LT9 C;  1L0N K;  2RH0 A;  1YIT P;  2LR2 A;  3H1L D;  3SWY A;  3RK3 E;  3TF5 A;  1AFO A;  4LC1 A;  2E5T A;  3PJS K;  1VF5 C;  3VYI A;  2ZT9 C;  3CLQ A;  2FFD B;  3M91 A;  3HUS A;  3H1H E;  2BAS A;  2YKO A;  1BE3 E;  1AJY A;  1OFC X;  1EZV D;  4D6T E;  1U7J A;  3R8K A;  1JY3 O;  1AV1 A;  1WRG A;  2K37 A;  1FOS F;  3HH0 A;  4H0L C;  1WT6 A;  1BCC J;  3L73 G;  1JYH A;  1JUN A;  2ZVN B;  4DZO A;  2JWD A;  2I8D A;  3H1J E;  2D2C D;  2OYH A;  2OYO A;  2HYN A;  2YMK A;  4PD4 H;  4IL6 E;  3W68 A;  3L74 G;  1QVG O;  1J1E C;  1Y6U A;  2JWA A;  2OTL P;  4LLH A;  3AE3 C;  1JB0 J;  3B5N B;  3NTN A;  1BSN A;  2OTJ P;  5I44 A;  3P8C E;  2JML A;  1IFJ A;  3LW5 H;  2KK7 A;  4XFJ A;  3UCS A;  1JY2 O;  2NPS C;  3VMX A;  3G4S P;  5AVY B;  1PPJ D;  3LIE A;  1RF1 B;  2CPS A;  3H1K E;  4DJG A;  4WBA A;  2JKV A;  1Q09 A;  1LGH B;  3IFM A;  1ZRT D;  1TU3 F;  4YPC A;  1VPC A;  1FZF A;  3CME P;  4L75 A;  1Z56 A;  1N7S A;  1W2E A;  2KOG A;  1JOC A;  3AEF C;  4C7N A;  1HTL C;  2FYU G;  2IDB A;  1SQP G;  2AXC A;  3H1H J;  3TNU A;  3G6E P;  1MFZ A;  1BE3 J;  1KFM A;  1OVV A;  1X9V A;  1XTC C;  2IBZ G;  1H0T A;  2CK3 H;  1SQB K;  4QMA A;  2BEZ F;  3AEC C;  2GUV A;  1GMJ A;  2G8Y A;  1J1D B;  2A45 H;  1KIL C;  3H1J J;  4H44 C;  2P2U A;  2O01 J;  3HD7 C;  1NO4 A;  1FZA A;  2ITA A;  2E76 C;  5KJ7 A;  5APY A;  3CWB E;  3M06 A;  5KAF H;  1RF0 A;  5BU8 B;  3EZ9 A;  2KB7 P;  1L4A A;  1YYC A;  3L73 D;  1KYO E;  2O01 N;  4IOI H;  1D7M A;  5TIS E;  3S9O A;  2QJY B;  2R3C A;  2RN0 A;  2E43 A;  3L74 D;  1R8D A;  3H1K J;  1ZR2 A;  1QL2 A;  3G71 P;  2WT7 B;  3L73 J;  5KLI C;  1AQT A;  1VL2 A;  1PGJ A;  3L72 G;  2E75 C;  4GOD A;  3Q1M A;  1DH3 A;  1JY3 N;  4JPZ B;  5CJ0 A;  1KB9 D;  1YQ3 C;  1L2P A;  2OAR A;  3A3Y B;  2KP8 A;  4PJ0 H;  1K73 Q;  1EDL A;  2QIW A;  1ZME C;  2CPB A;  1LTB C;  2FYU D;  2IPP A;  1S1C X;  1LT9 B;  2Y0D A;  2UWJ E;  1OW7 A;  1SQP D;  5APT A;  4I7Z B;  2R3S A;  2OG0 A;  1G2C B;  1K05 A;  2K9J A;  3CWB J;  1FZC B;  3CXH H;  5CCH C;  2IBZ D;  2BCC E;  2J58 A;  2V7Q H;  3RK3 C;  1VF5 B;  3NFQ A;  1PL5 A;  1H8A A;  1A02 J;  2NRG A;  1JY2 N;  4WLS A;  3L75 E;  2ZT9 B;  1NTK E;  3L35 A;  5KJ7 D;  1ZV8 A;  2KZI A;  2FYU J;  1ZOY C;  1URQ C;  2Q3E A;  1LTG C;  3CI9 A;  3KQG A;  3A0B H;  1X79 B;  2HPC A;  2DW3 A;  5KLV G;  2KNC B;  3IN6 A;  1QLE D;  2C9L Y;  5B66 H;  4H0L B;  4Y99 C;  1QL1 A;  1PZQ A;  2ZJS E;  1Q90 D;  1SFC C;  2PGD A;  4RJT A;  2HR3 A;  2RMZ A;  3KZI E;  1HH0 A;  1P84 H;  3L71 E;  2R32 A;  1MFT A;  1FJK A;  2A06 G;  3PTZ A;  1LNQ A;  3CMA P;  3L72 D;  4IL6 X;  3I5C A;  1OW6 A;  5KAX A;  3CX5 I;  4H13 C;  3WMM 0;  2G3A A;  1VF5 D;  4ZMD A;  2BCC J;  1LTA C;  2N1T C;  1GD2 E;  1NTM G;  1NJI Q;  1SQV E;  1LP1 B;  1W5C E;  4GIF A;  4R4L A;  3V6I A;  2B87 B;  4EYY Q;  3V2N A;  3L37 A;  2YIU C;  2PAJ A;  3TDK A;  3I55 P;  3L72 J;  2W6A A;  2W90 A;  1NTZ D;  4PD4 I;  4HH2 A;  2R5B A;  3TGU D;  4AYC A;  3IF4 A;  1FDM A;  1EXI A;  5KAI H;  2KXP B;  4H44 B;  3CCS P;  1Y9B A;  4NPE A;  4NPD A;  3MIW A;  1PFI A;  3MGN A;  1KZU B;  1N2D C;  2E76 B;  3CC7 P;  5APS A;  1PGQ A;  3RGU A;  3Q5R A;  5AW9 B;  3M9B A;  1NH4 A;  1NTZ J;  5KLV D;  1N7S C;  4KHX A;  3L71 J;  3TGU J;  2W6J H;  4GDO A;  3C1L A;  2IYP A;  3SSU A;  1LTJ B;  3MZW B;  2IBZ I;  2ZXE B;  2B88 A;  2Y0C A;  1KMI Z;  4BRY B;  5KAU A;  2O1K A;  5GTH E;  1RE4 A;  1ZR4 A;  4HYT B;  5APQ A;  2L91 A;  2WSE J;  4K35 A;  3JCU E;  4OGQ D;  4U3F D;  3H1L E;  2KCU A;  2ZHH A;  4ZKP A;  4W80 A;  4W7Z A;  5KLI B;  1Q08 A;  1FDI A;  2Q6Q A;  2M0B A;  2WQY C;  2A06 D;  1IJD B;  4JYB A;  2A45 I;  3U1A A;  3PLN A;  2GA1 A;  1EQ7 A;  2MJZ A;  2Q7C A;  1M56 D;  1RF0 C;  2YXQ B;  3FX0 A;  1L4A C;  1NTM D;  3H1I G;  1RE3 A;  2OYI C;  1L0L D;  1MUU A;  4U3F J;  1EZV E;  2WSC J;  1KQG B;  3A5T A;  1OWA A;  2O01 H;  5KCB A;  3FXD A;  1NHL A;  2IFM A;  4IL6 H;  1SQQ E;  5I41 B;  3OAK A;  1J2J B;  5CCG C;  3VOP A;  1SLQ A;  1S9K D;  3GHG C;  4WY4 C;  3SWF A;  2FFD A;  3VMY A;  1KN7 A;  2HG5 D;  2B89 A;  1L0L J;  2FXM A;  1ZN5 A;  4Z1M H;  3MUD A;  2JDI H;  4IFF A;  1NTK K;  1OW8 A;  1JO5 A;  1JNM A;  1JBG A;  1T8Z A;  3AE1 C;  1USE A;  3L36 A;  2FYZ A;  2XZR A;  3UIA A;  1PPJ E;  1MKM A;  3A0H E;  3H1L J;  1NVO A;  1SFC B;  2ZXX A;  3OW2 O;  2E74 C;  1ZRT E;  4R24 B;  3HE5 A;  3EZ2 A;  4U7J A;  2QM8 A;  3B5N A;  1SQQ D;  5APU A;  2IYO A;  1SQX D;  3RBZ A;  4C46 A;  1Q0A A;  1IFN A;  5KKZ B;  1RF1 A;  2C9N Y;  3CXH I;  3H6P A;  1KD1 Q;  2QG4 A;  1LWU C;  2FYN C;  4DOJ A;  2YNY A;  3K5B A;  1SQQ J;  1NOH A;  2AEM A;  2JP3 A;  2N1T B;  1SQX J;  3FXE A;  5AW2 B;  2DG6 A;  3EWK A;  2O1J A;  3Q3D A;  1H88 A;  1CW5 A;  3H1I D;  1SQV K;  4JYC A;  1KYO H;  1M1J A;  4GT1 A;  3GMA A;  2AEJ A;  3B71 A;  5TIS H;  3NMD A;  2P67 A;  3Q5S A;  1VQ9 P;  3L73 E;  1U57 A;  4ASV A;  3AE8 C;  3CX5 E;  1DIP A;  2M3E A;  2HVA A;  1PP9 G;  4WVZ A;  5APX A;  1VQM P;  2WZ7 A;  3L4F A;  3L74 E;  1FBM A;  1T2K D;  3AED C;  1JMM A;  3RL0 g;  3RL0 C;  3EFG A;  4XA4 A;  1MZ9 A;  3PH0 A;  4N6J A;  4L74 A;  1HF9 A;  4IFM A;  1K04 A;  3SFE C;  1AVO A;  5E79 E;  5AVS B;  1Q06 A;  2W6B A;  1KB9 E;  3B5N D;  3KXD A;  1BGY G;  1KQS O;  1FJP A;  1N73 C;  2A45 G;  5AW7 B;  1GL2 C;  3MTU E;  2H7H A;  5KAW A;  3CX5 D;  4KT0 J;  1LTI C;  2WT7 A;  2Q1K A;  2BEQ D;  5DJU B;  2HFE D;  3M9Q A;  2FYU E;  3Q5P A;  2KIK A;  2IX7 C;  3V4Q A;  1NU1 G;  5AVW B;  1M8O B;  2KSJ A;  1SQP E;  1S5L X;  5AVX B;  2ZHG A;  1OIP A;  2C0X A;  2HLO A;  2IBZ E;  1XTG B;  3IAO A;  2WPS A;  1RH6 A;  4YTP C;  2QRX A;  3PP5 A;  4PD4 D;  1L0N G;  1N7L A;  4GKG A;  1GU4 A;  1R5L A;  2JEE A;  1LT9 A;  1RHZ B;  3VTP C;  2OYI B;  3L74 J;  3CCU P;  1G1I A;  2QJK C;  5AW8 B;  1G2C A;  1VQN P;  5AW4 B;  1NTK G;  3BCC G;  2ZYA A;  4HKZ H;  1S4X A;  1FZC A;  1YTZ T;  1X8Y A;  1IO4 A;  3RK2 C;  3O8Z A;  3H32 B;  1A02 F;  2GOV A;  1GU5 A;  3L70 G;  3GHG B;  1PP9 D;  4WY4 B;  3KZI H;  3VMA A;  1FE6 A;  3P7K A;  1VQP P;  2D2C C;  3AE7 C;  4RKU J;  1HWT C;  3D70 A;  4EDF A;  4A1M A;  4HJG H;  1JTH B;  3AE6 C;  2AXT E;  2KNC A;  2KSE A;  2H88 C;  3VMZ A;  1JCD A;  4UB6 E;  1PGO A;  5D8C A;  2WSS H;  2XDJ A;  3FGA D;  1PP9 J;  1SQP J;  2WSE H;  4IFD K;  3L72 E;  3WUV A;  5CHX A;  3KHU A;  3WUT A;  1QGK B;  2V4H A;  1OMI A;  1BGY D;  2E74 B;  1X0T A;  3OJA B;  1Q82 Q;  5BU5 A;  3E1I A;  2Y9Y A;  4W7Y A;  2L5G B;  1RQV A;  3E7K A;  2B9B A;  2K88 A;  4OVN F;  2KYV A;  1NU1 D;  3S4R A;  1J1E B;  1SQV G;  3B49 A;  1IK7 A;  2ZFC A;  2KVV A;  2Z5H A;  1NGM B;  3MUD C;  1NTZ E;  2QVA A;  1LWU B;  3B8E B;  1BGY J;  5AVR B;  4R4M A;  4DCK A;  3ABV C;  3TGU E;  3C8V A;  4PV1 C;  1LP1 A;  1WMK A;  2B87 A;  2J5U A;  3W67 A;  2FY8 A;  1L0N D;  2NPS B;  2KLV A;  3HUS C;  1IZN B;  2M3B A;  4YXD C;  1LTT C;  1HGV A;  5AVQ B;  4L76 A;  1K8A Q;  4I6M C;  1NWQ A;  1SQB G;  3BCC D;  3BVH A;  5KLV E;  3AE5 C;  2ZT9 D;  2IEF A;  1PIX A;  2ZVO B;  1NYH A;  2QJP C;  4R4E A;  2OYH C;  1VQK P;  3L70 D;  4I1L A;  1YTZ I;  1OX3 A;  4DT0 A;  4LGD E;  5GTH H;  1BDD A;  4RO0 A;  3JCU H;  2IZ0 A;  1Q7Y Q;  2E74 D;  2PFX A;  2YO2 A;  4H0L D;  3TYY A;  1RH5 B;  3SFD C;  3RL0 B;  3LID A;  4U3F E;  3A7O A;  1KIL B;  5AVU B;  2W83 C;  3HD7 B;  4AYZ B;  2NZ2 A;  3A2A A;  3V2P A;  1GK6 A;  1LTJ A;  2A06 E;  3M0D A;  4BRY A;  1Y8A A;  3CXH D;  3O6Q B;  1PM6 A;  2QA4 P;  1DEB A;  1M1J C;  1M1K Q;  4RES B;  3GLM A;  4B0Y A;  3U1C A;  5AW1 B;  1N73 B;  1S5L E;  1HVV A;  3KDP B;  1BCC G;  4UB8 E;  1K9M Q;  1GL2 B;  5AW3 B;  1OZH A;  3HE4 B;  1NTM E;  3AEE C;  1E5W A;  1ZP0 C;  2QM7 A;  1L0L E;  3CC4 P;  5AVZ B;  4EI2 A;  1KYO I;  2NPS D;  4WB4 A;  1IK9 A;  3HRN A;  3JSV C;  2FYU K;  2HOD B;  2Y0E A;  1VQ6 P;  1SQP K;  1DD3 A;  5C39 A;  2O3J A;  2WVR A;  4KJM A;  1JCC A;  3CCE P;  4WWI A;  1JMB A;  2V7Q J;  1S9K E;  5B5E E;  3GF3 A;  5KLV J;  3ZDM A;  2OTK E;  3V4W A;  1ZXG A;  5GTI E;  3WU2 E;  3AEB C;  2E75 B;  4K3A A;  2Z4E A;  5KJ7 C;  2LXC B;  2QJK B;  1P84 D;  1DX7 A;  1CI6 B;  3A0H H;  3EQ2 A;  1JEK A;  3T97 B;  1SQB D;  2Q5U A;  2FXP A;  5L8R J;  3RL0 D;  3RK2 B;  2SPZ A;  1KIL D;  4OH8 B;  4H44 D;  3HD7 D;  1IC2 A;  2P7J A;  1CSB A;  4N78 D;  2E76 D;  1OVU A;  2WIT A;  1IFI A;  3H1H G;  1LJ2 A;  2MKV A;  1BE3 G;  1M7L A;  1YIJ P;  1YJN P;  3VP8 A;  4D6T G;  2KS1 B;  1FOS E;  1SQX E;  4LHF A;  3RK3 B;  1ZLL A;  4R22 B;  3R8J A;  2OGU A;  1E79 H;  1ZW0 A;  1NKZ B;  1NTM J;  2M5A B;  1M90 Q;  1X22 A;  2P1J A;  2PRR A;  3HTK B;  3H1J G;  2ZYG A;  3F89 A;  1CZQ A;  4JF7 A;  1SFC A;  1URQ B;  1T6A A;  3FWL A;  2WSF J;  2QEX P;  4I7Z C;  1YJW P;  1FAV A;  3V2R A;  1IFP A;  4ZNC A;  1FZC C;  4Y99 B;  3GP4 A;  2XND H;  1YI2 P;  1BCC D;  3AEA C;  1VQO P;  3QWO C;  3H1I E;  3QH9 A;  2YXR B; 
#chains in the Genus database with same CATH homology
 2E75 D;  2IEF A;  1PIX A;  3AE6 C;  1NYH A;  2QJP C;  3IN6 A;  4R4E A;  1YQ4 C;  2H88 C;  3AEB C;  1Q09 A;  4H0L B;  2FYN C;  2WSC J;  1KQG B;  2E75 B;  1TU3 F;  3AE4 C;  1EXI A;  3AE9 C;  5KAW A;  4KT0 J;  1Q90 D;  5M1B A;  5D8C A;  3D6Z A;  4H44 B;  3RK3 E;  2BEQ D;  1Y9B A;  3E0H A;  5E01 A;  3FGA D;  4PV1 D;  5KLI C;  5KCB A;  3Q5P A;  3QAO A;  5KKZ C;  3AEF C;  3T97 B;  2E74 D;  1VF5 C;  2E76 B;  5I41 B;  4J2N A;  2FXP A;  2JP3 A;  1S5L X;  4TT3 H;  1VL2 A;  3AE2 C;  4H0L D;  5L8R J;  5GQQ A;  2DG6 A;  4PV1 B;  3EWK A;  1KTM A;  3Q5R A;  1HJ0 A;  1OMI A;  2ZT9 C;  2ZHG A;  2E75 C;  2IDB A;  3Q3D A;  2VZ4 A;  3D6Y A;  2E74 B;  3SFD C;  3Q1M A;  4H44 D;  3LW5 J;  1D5Y A;  1R8E A;  1RQU A;  2QSI A;  1YQ3 C;  4H13 D;  3IAO A;  2E76 D;  2QJY C;  2FBW C;  4Y28 J;  1RH6 A;  4YTP C;  4Z1M H;  3GMA A;  3EZF A;  4GDO A;  1RQV A;  1AJY A;  4AYZ A;  4AYZ B;  2NZ2 A;  3D71 A;  3B71 A;  1OW8 A;  1EXJ A;  3Q5S A;  1PV3 A;  2QIW A;  4H13 B;  2MKV A;  3R8K A;  2BEZ F;  3GPV A;  1U57 A;  3AE8 C;  1Q05 A;  3AEC C;  4OGQ B;  1ZME C;  1DIP A;  1KMI Z;  3HH0 A;  1JBG A;  1GMJ A;  2G8Y A;  2H89 C;  4H0L C;  2HVA A;  2K9Y A;  1JYH A;  3AE1 C;  3O6Q A;  1PM6 A;  3B49 A;  1IK7 A;  2WPV B;  1S1C X;  5KAU A;  4LHF A;  4IL6 X;  1OW7 A;  4H44 C;  4R22 B;  1OW6 A;  2KVV A;  3GLM A;  3R8J A;  4B0Y A;  2O01 J;  4I7Z B;  3H25 A;  3G9R A;  2QJK C;  1NGM B;  5KAX A;  2D2C D;  5D90 A;  5KAV A;  2OG0 A;  1KOR A;  2YMK A;  2WSE J;  1LX8 A;  1K05 A;  4H13 C;  1MKM A;  2P10 A;  2E76 C;  2G3A A;  4OGQ D;  2JO1 A;  3AEE C;  1VF5 D;  4R4M A;  1FDO A;  1ZP0 C;  3AED C;  3ABV C;  3R4Y A;  5KAT A;  2KCU A;  3C8V A;  1UIX A;  2D2C B;  2ZHH A;  1DD4 A;  4PV1 C;  3RL0 g;  1Y6U A;  2E74 C;  1ZRT E;  4R4L A;  1WMK A;  2J5U A;  1VF5 B;  2OQQ A;  1Q08 A;  2GOV A;  1FDI A;  1PL5 A;  2WSF J;  3GF7 A;  2BOW A;  4R24 B;  4I7Z C;  3EZ2 A;  4U7J A;  3EZ9 A;  2WQY C;  1JB0 J;  3AE3 C;  3AEG C;  3GK6 A;  4WLS A;  2YIU C;  2ZT9 B;  3Q2Y A;  3EZ7 A;  1DD3 A;  4YXD C;  4DCZ A;  1HF9 A;  5I44 A;  2JML A;  1K04 A;  3SFE C;  4XFJ A;  2D2C C;  3AE7 C;  3LUR A;  3GP4 A;  1ZOY C;  4RKU J;  3D70 A;  2V7Q J;  1KQF B;  3EZ6 A;  1Q07 A;  3UCS A;  4A1M A;  1Q06 A;  4WLW A;  3GF3 A;  3S9O A;  1BOW A;  4OGQ C;  1KIL E;  3AEA C;  1Q0A A;  3AE5 C;  1R8D A;  2ZT9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...