3D6ZA

Crystal structure of r275e mutant of bmrr bound to dna and rhodamine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
total genus 76
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d6zA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d6zA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d6zA03
3T97B 2JMLA 4WLWA 4A1MA 2ZHHA 2GOVA 3Q5PA 3GPVA 3D6ZA 5KAWA 1JBGA 1EXIA 4R4EA 5I41B 3D6YA 2OQQA 3E0HA 3HH0A 5I44A 5D90A 1R8EA 1DIPA 1BOWA 2BOWA 4R24B 3Q5RA 3QAOA 4WLSA 5KATA 3UCSA 3GP4A 2VZ4A 2DG6A 4J2NA 1Q05A 3B49A 4R4MA 1D5YA 5E01A 3Q2YA 4R4LA 3D70A 1Q06A 4R22B 5D8CA 4AYZA 1Q07A 1JYHA 1Q0AA 2ZHGA 3LURA 5GQQA 3IAOA 1EXJA 3G9RA 3R8JA 3R8KA 5KAXA 1Q09A 4AYZB 3Q3DA 3D71A 5KCBA 2HVAA 1Q08A 3Q5SA 5KAUA 2J5UA 1R8DA 5KAVA 3GK6A 4B0YA 3Q1MA 2KCUA
chains in the Genus database with same CATH superfamily
2QM8A 3TNUB 3H1IG 3I55P 1XTGB 2BEQD 5B5EE 2Q9IA 3RL0g 4CPGA 3E1IA 2A45I 3MP7B 1M57D 2FXMA 2WTYA 3CD6P 1D7MA 1Q08A 3CL3D 3CWBG 5BU8B 1DD4A 2QE7H 1ZRTE 1PPJE 4XE5B 1J1DB 1HF9A 1FDIA 3A7OA 2P10A 2I8DA 3IFMA 2WPRA 4IOIH 1RF0A 2Y9ZA 1AV1A 4HYTB 3CLQA 3R8KA 1FU1A 3L71D 4OWFA 1USDA 4EDFA 3KDPB 2NPSC 2QEXP 2QM7A 5KAWA 1N73C 2XZRA 5I44A 2HODA 2FYUG 4GDOA 3NFQA 1FZAA 4WWIA 2WT7A 1VQOP 5KKZC 4KHXA 4L74A 4QMAA 1IFJA 2V7QH 1SQPD 1NTKG 2RN0A 3H1HJ 4H44C 3CCSP 1ZW0A 1Q06A 1GDTA 3L74D 1RQUA 2WVRA 1BDDA 1RQVA 3FWNA 1KORA 1GK4A 2JEEA 4M3LA 2Y0EA 1MZ9A 1VQ4P 3L71E 2PP6A 1LTJA 1SQBG 3TYYA 2O01H 3HE5B 2V4HA 4BXLA 5GQQA 1EXJA 3L37A 1NO4A 2KUBA 3GHGA 3NXSA 3PH0A 5KJ7A 1L4AB 1VQKP 2E42A 1FOSF 5KLVD 1YTZT 1NTZK 1FJKA 4JPZB 2B87A 3F5HA 1KTMA 1LJ2A 1Y9BA 1NU1K 4OVNF 4W7YA 3WUUA 3CC7P 1GW4A 4IL6H 3HTKA 2SPZA 3LIDA 2AXTH 1N7SA 3TDKA 1SQPE 4H0LB 3T97B 4HKZH 3TGUG 4DCZA 2KLUA 5AVUB 2Z4EA 1QL2A 3W68A 4LHFA 1SQXE 2FYZA 3SWKA 2P7JA 2Q3IA 4KT0J 1NWQA 4JF7A 4ZNCA 3RBZA 3B5ND 3NTNA 1PFIA 3D71A 1RH6A 1MFTA 2PRRA 1Z56A 1KB9D 2I1KA 4IL6E 1T2KC 1MFZA 3HRNA 4Y28J 2AXTE 3OJAB 1LP1B 1URQD 1H8AA 4IFDK 2FFDC 3QWOC 3L73D 3FXEA 1KB9H 2BCCG 3GMAA 1IFNA 1EXIA 3H1IJ 3CCLP 2H88C 3CCRP 1N7LA 3H1HD 2LXCB 5GTHH 1GW3A 5BU5A 5APTA 2E75D 1SLQA 1BGYG 2ITAA 4B86A 2KK7A 1OVRA 1CI6B 1ZOYC 2NPSA 1YITP 1VF5B 1Y6UA 1KB9E 1S9KE 1N73A 2ZJSE 1QEXA 1YHQP 1OX3A 1IFIA 2B89A 5GTHE 2JJLA 1AQ5A 1HJBA 2W6AA 4RKUJ 3S4RA 3PLNA 1SQVK 3WUVA 1JM0A 3RK2D 5M1BA 4XFJA 5CJ4A 3AE9C 1EDJA 3MHVA 2Y0DA 3L70D 3TF5A 3H1HE 1GD2E 2WSEJ 3FX0A 1W2EA 3VMYA 1LTIC 1XTCC 1NTZG 3H1KJ 1YJWP 4JYBA 4D6TG 4GODA 5GTIH 1NU1G 4AQRD 2FYUJ 1GU5A 3G6EP 1KYOD 1TU3F 1KN7A 1FAVA 2GOVA 1U7JA 2R32A 3O6QB 2ZYDA 1Q7YQ 2KS1B 3SFEC 5DJTB 4OGQD 1NTKJ 3N4XA 4OH8B 3IAOA 1KYOH 2DW3A 3BCCD 3M91A 3LW5J 1ZXGA 2W27A 3VYIA 1BSHA 5GTIE 1HGVA 1NJIQ 3MIWA 2R5BA 1EQ7A 2CK3H 3L72G 2IBZE 1K05A 2IBZI 4RO0A 1NH4A 3CCUP 1M1JB 2R5DA 2C9NY 1Q82Q 2E75B 3EZ7A 2N1TD 5KAIH 1KYOE 2BOWA 3MZWB 1N86A 2DG6A 1AQTA 3USSA 2QJYC 2G3AA 1JY3N 2JKVA 3VOPA 3N7NA 2WSCJ 4YTPC 1VQPP 2Q6QA 2FFDA 1EZVG 3TGUJ 3BCCE 1T8ZA 2KZJA 1PGQA 2WPVB 3CMEP 3GLMA 2Q3EA 5KAIE 3O8ZA 1AFOA 1KFMA 4WLWA 3RK2B 1L0NK 4LC1A 2RH0A 2QJKB 3H1KD 3B5NC 1Q05A 1FDMA 3AEDC 4Y99C 3V4WA 1LTGC 2I1JA 1SQQK 2WSFJ 4C46A 1SQVG 3JC22 2OYIB 4K35A 5KCBA 2N9BA 1YYCA 5AW0B 4LLHA 2WSEH 2B9BA 3GW6A 4L75A 1USEA 3CX5D 2OYHC 4Z1MH 1URQC 2HPCB 5AVWB 2KOGA 4ZKPA 2CPSA 4PJ0E 1HBWA 2IDBA 3CCJP 1HUCA 1SFCB 3H32A 3U1CA 1K04A 1RH5B 1GL2D 3SSUA 3TK1A 5CCGD 3EWKA 3M06A 3KZIH 2E75C 3BRTB 2P67A 3B8EB 5AW5B 3A0HH 3L4FA 3RK3D 5B5EH 1NTMD 3E7KA 4I6MC 3W67A 3OA7A 1L0LK 2A45H 3H1KE 3WMM0 2FYUE 2OTKE 2E43A 3TSIA 2XNXA 2FYNB 4YXDC 1NOHA 1T3UA 2HVAA 1LT9B 2IPPA 3CXHI 3KZIE 2J59M 2J58A 1GU4A 2KCUA 1NTKE 3VN0A 3A0HE 2YMYA 2FKWB 2YKOA 3RK2C 4DT0A 1NTZJ 4ASWA 2QJKC 2KXPB 4AYZA 3R8JA 3KXDA 1L4AD 1U7MA 2YMKA 1P84I 2K9JA 4EYYQ 1NKNA 3PRJA 3RK3E 2ZT9B 2KIKA 1NTME 2IZ1A 2XKMA 3KPEA 1JYHA 2AXCA 4H0LD 5AVVB 1FZBA 1RE3C 2Y0CA 3A0BH 2JR8A 2W83C 2HYNA 1YI2P 4C7NA 4OGQC 2IZ0A 4HB1A 1L0NG 5AVRB 4I1LA 3M9BA 2H7HA 1D5YA 5E01A 4I7ZB 1IFMA 5C39A 3RGUA 3L72J 1SQQG 3TGUE 4U3FG 3OW2O 4RJTA 5KLIB 3HUSC 1DD3A 2YO3A 2Z5HA 1BDCA 2KSJA 3AE2C 1LWUB 1GL2B 1U57A 1YQ3C 3A0BE 2E74D 3KHUA 5CBNA 1QLED 1Q0AA 2K88A 3JCUE 1RF1B 2N1TC 2M3BA 3B5NA 3AE5C 1R8DA 3RK3B 3HE4B 1LT9C 2OQQA 3H1LG 3UCSA 1FE6A 1N2DC 4NPEA 3EZ9A 5D8CA 1T3JA 3H1JD 3FWLA 3L75G 5APUA 3AEFC 2QG4A 2OYHA 1BCCD 1URQA 4AUWA 2IFNA 1SQXD 1L0LG 1AVYA 1YQ4C 1DEEG 4ZKUA 4H13B 2OGUA 1GTWA 5KAFH 1VF5D 2E5YA 3RL0B 1FOSE 1VQ9P 5TISH 1J1DC 1PIXA 1OXZA 1SQVJ 1KQSO 1QX8A 2ZAEB 1A02F 2GUVA 1SQPK 3AECC 1KMIZ 5CJ0A 1QL1A 1JY3O 2W90A 1G2CA 2W8ZA 1PPJG 4R22B 2R3CA 2YXRB 3B4SA 5KAFE 3CCEP 4B0YA 1VDFA 5TISE 3Q5PA 1Y47A 3D6ZA 2Y9YA 3E0HA 2HG5D 3H1JE 1PP9J 4GT1A 4YXWH 1DIPA 2MKVA 1BCCE 2AEJA 3M0AA 3CMAP 4R4LA 1LWUC 1GL2C 1RE4C 5CCGC 5CHXA 4EI2A 5KLVK 1OMIA 4JBZA 1S9KD 3HD7B 1IZNB 3RK3C 1NGMB 2O3JA 2IYPA 1OW6A 3M9QA 3G9RA 2JO1A 3AE4C 1PZQA 1JEKA 1YIJP 4MN4C 2E74B 3GK6A 2JMLA 5AVQB 3C8VA 1FZCB 1RE3A 3GG2A 3EZFA 1M90Q 1NHLA 1K73Q 3S1KA 3AEEC 2KNCA 4DOJA 4PV1B 3JSVC 1WRGA 3CWBJ 1K8AQ 1JY2O 3L72E 3G71P 5APQA 4WBAA 2KI7B 3Q5RA 2Q1KA 1L4AC 4NPFX 3GF3A 3F89A 3SWFA 4WY4D 3Q2YA 3HUSA 2MJZA 3L71G 2A06D 2O01N 1HGZA 5AW1B 2P58A 1Y8AA 1PL5A 1FBMA 3R4YA 1Q81Q 4H0LC 1L0NJ 2H89C 2N1TA 5CMZA 2KVVA 3BASA 3I56P 2H8PD 1LT9A 2QA4P 3IN6A 4BRYA 3TNUA 1EZVI 4U3FJ 3IR9A 2IBZD 3GPVA 1PP9D 2O1KA 1SQPG 3AE8C 1S4XA 1JOCA 2G8YA 3L74G 3HD7C 1UIIA 2WQYC 3ITKA 3MUDC 2JWAA 2JP3A 2WMMA 4DJGA 5KTBA 1JY3P 3PP5A 2E74C 1S1CX 2A06E 1YJ9P 1JB0J 2QVAA 1KFNA 1JTHB 1SQVE 3H1LJ 3V2PA 1E5WA 3VP8A 2IX7C 1FZCC 3E1RA 1SFCD 2HODB 2WZ7A 1ZV8A 2C9LY 3ABVC 3P8CE 3EQ2A 5KLVG 2XDJA 2WT7B 1L0LJ 2YKQA 1RY3A 3H1ID 1IK7A 2XU6A 1WMKA 1SQBJ 1KV4A 3VMAA 4A7PA 3EFFK 1FZEA 5BVZA 2PFXA 1PP9E 1VQNP 3WU2H 4WVZA 1VF5C 1IFPA 4ZMDA 4GKGA 3CWBD 1GL2A 3CCQP 1RE4A 5H2FE 5CCGA 1VL2A 4L73A 4N3YB 1VPCA 1LTJB 1S3JA 3HE4A 4WY4B 1JNMA 1H0TB 4A1MA 3GHGB 1KZUB 1VQLP 2PGDA 2C0WA 1QGKB 1FZFA 4WLSA 2D2CB 1SP4A 3WU2E 2XNDH 3U59A 3A5TA 1H88A 3L73G 1G1JA 3H1IE 2E76B 1E79H 3HTKB 3MGNA 5AW4B 2ZT9D 5KAVA 1N7SB 1AA0A 3EFGA 3A2AA 4PJ0H 1JMMA 4BWNA 2ZXEB 1R8EA 3H1HG 4R24B 3HE5A 2QRXA 3AE1C 3CWBE 1GK6A 2FYUD 3H6PA 1LTSC 4EOTA 2GM4A 1L4AA 4GIFA 5APXA 1J2JB 2BCCJ 3PTZA 5CBOA 3GP4A 1OW7A 1NTKD 3V5BA 1GMJA 1KILD 1CW5A 1A02J 4KJMA 4C7RA 1L0NE 3T97A 2N9YB 1GZLA 3G4SP 1EDKA 1YBKA 1BGYJ 3RBXA 1S5LX 1P84D 1M1JC 1JY2N 3CXHH 2IYOA 3NMDA 2KZIA 3PJSK 1SQBD 2PAJA 3R2PA 3L71J 3LW5H 5APWA 3L70G 2K9YA 1OWAA 3HD7A 2M5AB 2WSSH 3LIEA 4WY4C 1OVVA 4R4EA 1HJ0A 1P84H 1M7LA 2WPQA 3MUDA 1LP1A 5KATA 1BE3G 4PD4E 4PD4I 2ZHGA 2P1JA 2NPSB 2AEMA 3VMZA 4H13D 1N73B 4IFMA 1OFCX 2HFED 1KC8Q 3CXHE 3H1LE 1FZCA 2KSEA 3RL0D 1H89A 1DX7A 1KILE 2M3EA 1N7SC 3B71A 3TGUD 3CCVP 2W6JH 1NTMK 3BCCG 3L74J 2WPSA 1L0LE 4D6TJ 5KKZB 1NU1J 3CX5I 1P84E 2WSCH 4HH2A 1SQBE 4AYCA 4H44B 2OYIC 4K3AA 1CI6A 1KQFB 1M56D 3C1LA 1ZN5A 1R5LA 5APVA 2QSIA 2RMZA 5KLVJ 1SFCC 2BCCD 3JCUH 5I41B 1IK9A 3M9HA 3IF4A 2RKLA 1FS0E 3EZ2A 1LX8A 1M8OB 3OAKA 4U7JA 1MUUA 2WSFH 1MV8A 5AW6B 1IC2A 5CCHD 3HD7D 1KILB 2LKMA 1RHZB 1R5SA 1BGYD 2NRGA 4IFFA 2M8RA 1IO4A 1HVVA 1SS1A 1KQLA 2C0XA 3SWYA 2FYNC 5B66H 2J5UA 3O6QA 3U1AA 2KS1A 1JTHA 3H1KG 2KP8A 2KB7P 1OIPA 1WT6A 2UWJE 4PV1D 2BCCE 3L73J 3ZDMA 2K3RA 2WITA 3AEAC 4N78D 1JBGA 1JO5A 4L76A 1NKZB 2LXBA 2ZVOB 2FFDB 3L35A 3V2QA 1NTZD 4GOEA 5B66E 2ZT9C 4D6TD 2GUSA 3BVHA 1NU1D 1BGYE 1M1JA 2A45G 5AW2B 4XA4A 2ZHHA 2QJPB 4RESB 4W7ZA 4LGDE 3CC2P 1JMBA 2AEFA 5AW8B 3MTUE 3KQGA 4YPCA 1QVFO 1NTMG 4WY4A 1H0TA 1SQXK 2L5GB 4I7ZC 2WWWA 3V6IA 2POHA 2R3SA 1KILC 2BEZF 1NVOA 5KLIC 1K9MQ 1AVOA 3V4QA 3L72D 1JCDA 4N78E 3CI9A 2Z5IA 1X8YA 3L70J 2M0BA 3UIAA 3Q1MA 2LR2A 1NTZE 3H32B 1YTZI 2R44A 1RF1C 5EFWB 3L74E 1DEBA 4D6TE 3P32A 1NU1E 2IEFA 4ASVA 5TJHA 1BE3J 2ZXXA 3GF7A 2OYIA 1FZGA 1NYHA 2VRSA 1YJNP 1DH3A 5AVXB 1PM6A 2HPCA 2QIWA 1LTTC 3EZ6A 1S5LH 5AVSB 5K5GB 1LTBC 1EZVD 2ZYGA 1PGOA 4H13C 1X0TA 5DJUB 3MD0A 5KLVE 1SFCA 3BCCJ 3RL0C 5KAXA 2BASA 1L2PA 5KAUA 1PGJA 3AE6C 4UB6H 5AVZB 1EC5A 1IFDA 2QJPC 3L36A 5AW3B 1Q90D 2CPBA 4AYZB 3AE3C 1S5LE 2M5AA 3CPWO 1SQVD 5KJ7D 1ZMEC 1SVFA 2OYOA 2K9JB 5L8RJ 1X9VA 2D2CD 3CC4P 3P8CD 2E76D 1KB9I 3KYQA 1Q07A 1W5CE 2B88A 3LURA 1W2BO 1N7SD 3P7KA 1Q09A 4TT3H 4UB6E 1SQQJ 1KD1Q 1EZVE 3BRVB 3M0DC 2OARA 2KLVA 1CZQA 3A3YB 5AW9B 2QJYB 3QH9A 4C7NB 1HWTC 3L73E 4W80A 2VZ4A 1ZR4A 2YNYA 3H1JG 5CCHC 5APYA 5APSA 1JUNA 1BCCG 1EDIA 2JWDA 1SQXG 3SFDC 4O9BA 1CSBA 2K1AA 3HH0A 3I5CA 1LTAC 4J2NA 1BE3D 1S2EA 2XV5A 5H2FH 1HTLC 1X22A 1AJYA 3H25A 3VMXA 3L75J 3BATA 1LNQA 1VQ6P 4EIJA 3B5NB 1ZR2A 4Y99B 1QVGO 4PV1C 3QAOA 2L91A 3G3ZA 2ZVNB 3VTPC 2H43A 1IJDB 1KILA 1J1EB 3V2RA 3VP9A 1FDOA 3AEBC 4DCKA 2OYHB 1URQB 2YIUB 1LWUA 2K37A 2HR3A 4TLFA 2NPSD 1OZHA 3L70E 1HH0A 3D70A 1RF1A 1VQ5P 1NTMJ 2ZFCA 4JQ0D 2Q5UA 5AW7B 3PHLA 1BE3E 2YXQB 2FXPA 3II6A 2KYVA 1KYOI 1L0ND 3CCMP 1ZLLA 2B87B 3B49A 1Q86Q 1Q2NA 2OG0A 1G2CB 3S9OA 4N6JA 1JY2P 3FXDA 4GOFA 2YKPA 5E79H 2OTJP 4H44D 1SQQD 4UB8H 1RF0C 4U3FD 4DZOA 2Q7CA 2GA1A 1N8RQ 3D6YA 2ZYAA 1OW8A 1LT1A 2YO2A 4WB4A 1PV3A 4IL6X 1VQ8P 1PGPA 1LGHB 1EDLA 1S72P 1G1IA 1M1KQ 4PD4D 1FC2C 5D90A 2P2UA 3CXHD 3H1LD 4HJGH 5E79E 2A06G 1OVUA 3V2NA 2IFMA 2W6BA 3FGAD 4UB8E 3L75D 2JDIH 1ZP0C 1KQGB 4PD4H 1BSNA 1J1EC 1L0LD 2HLOA 2NZ2A 2E5TA 2YIUC 1SQQE 2FY8A 2FYUK 3WUTA 3M0DA 4U3FE 1T6AA 1UIXA 5AVYB 4OGQB 1LTJC 2KNCB 2IBZG 1JCCA 1PP9G 5CCHA 3C9IA 3CX5H 1BOWA 2O1JA 1NTKK 2V7QJ 3GHGC 5KJ7C 1ZRTD 1VQ7P 2D2CC 1PPJD 1T2KD 3HUSB 3K5BA 4NPDA 1NAYA 1FJPA 3AE7C 3Q3DA 1NAFA 4JYCA 2E76C 3AEGC 2OTLP 2FBWC 1SQBK 3L75E 1SQPJ 4R4MA 2N1TB 1X79B 2O01J 5AVTB 1MKMA 2FXOA 3H1JJ 4I2LC 3CX5E 1BCCJ 1VQMP 3P8MC 3Q5SA 1SQXJ 4BRYB
chains in the Genus database with same CATH topology
2WSEJ 2WSCJ 1DD3A 4YTPC 1PL5A 2ZHHA 3Q5PA 3D6ZA 3E0HA 5I41B 1S5LX 3R4YA 3AE6C 4PV1C 5D90A 1VL2A 2BEQD 4H0LC 1DIPA 3RL0g 3AE2C 2H89C 3QAOA 1U57A 2MKVA 2QJPC 1YQ3C 4Y28J 3EZ2A 1LX8A 4H44C 2KVVA 1Q90D 2E74D 2WPVB 3FGAD 4R4LA 1Q06A 4U7JA 4YXDC 1Q0AA 3IN6A 4AYZB 1RQUA 3GLMA 3AE3C 4I7ZC 1FDOA 2HVAA 3AEBC 3AE5C 1Q08A 1ZP0C 1KQGB 1ZMEC 1R8DA 2K9YA 5L8RJ 2KCUA 1OMIA 1RQVA 1TU3F 4WLWA 2D2CD 3GMAA 4A1MA 1DD4A 2GOVA 3GPVA 1ZRTE 1EXIA 4R4EA 1HJ0A 1KORA 2OQQA 2NZ2A 2H88C 3AE8C 3SFEC 2BEZF 1NGMB 4WLSA 2D2CB 5KLIC 2YIUC 5KATA 3UCSA 2G8YA 1Q05A 3AEDC 4OGQD 1UIXA 1HF9A 2E76D 2QJKC 3EZ9A 3D70A 5D8CA 4AYZA 2WQYC 1Q07A 3R8JA 2ZHGA 1OW6A 3LURA 3IAOA 1EXJA 2JO1A 3AE4C 3AEFC 3G9RA 2E75D 2WSFJ 5GQQA 1Q09A 1FDIA 2YMKA 4OGQB 3LW5J 2E76B 5KCBA 2JP3A 4TT3H 4H13D 2E74B 2FYNC 2J5UA 2P10A 2ZT9D 3O6QA 3GK6A 5KAVA 3Q1MA 2JMLA 1YQ4C 2E74C 4H13B 2FXPA 1S1CX 3C8VA 1KILE 3RK3E 2ZT9B 3EZFA 3B71A 1R8EA 2IEFA 1JB0J 1VF5D 4Z1MH 1KTMA 4R24B 1BOWA 2V7QJ 3AE1C 2VZ4A 1Y9BA 3B49A 1ZOYC 1VF5B 1Y6UA 2OG0A 1K05A 3AEEC 3GF7A 1JYHA 4PV1D 3R8KA 4H0LD 2D2CC 3S9OA 2IDBA 1PIXA 4H44D 1NYHA 3ABVC 3AE7C 4PV1B 4H0LB 1K04A 3Q3DA 3SFDC 3T97B 2E75B 1PM6A 4OGQC 3EZ7A 3AEAC 2QIWA 2E76C 1JBGA 4H44B 3AEGC 3EZ6A 4DCZA 3D6YA 3AECC 2FBWC 1KMIZ 3HH0A 5I44A 3EWKA 1IK7A 2BOWA 1KQFB 3Q5RA 2E75C 1WMKA 3GP4A 3GF3A 2DG6A 4J2NA 1OW7A 4LHFA 1OW8A 4R4MA 4H13C 4RKUJ 5E01A 2O01J 4I7ZB 1D5YA 3Q2YA 1MKMA 2G3AA 2QJYC 2ZT9C 4KT0J 4R22B 4GDOA 1PV3A 1GMJA 4IL6X 5KAXA 5KAWA 1AJYA 5M1BA 3H25A 2QSIA 4XFJA 3D71A 1RH6A 1VF5C 3Q5SA 3AE9C 5KAUA 5KKZC 4B0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T97 B;  2JML A;  4WLW A;  4A1M A;  2ZHH A;  2GOV A;  3Q5P A;  3GPV A;  3D6Z A;  5KAW A;  1JBG A;  1EXI A;  4R4E A;  5I41 B;  3D6Y A;  2OQQ A;  3E0H A;  3HH0 A;  5I44 A;  5D90 A;  1R8E A;  1DIP A;  1BOW A;  2BOW A;  4R24 B;  3Q5R A;  3QAO A;  4WLS A;  5KAT A;  3UCS A;  3GP4 A;  2VZ4 A;  2DG6 A;  4J2N A;  1Q05 A;  3B49 A;  4R4M A;  1D5Y A;  5E01 A;  3Q2Y A;  4R4L A;  3D70 A;  1Q06 A;  4R22 B;  5D8C A;  4AYZ A;  1Q07 A;  1JYH A;  1Q0A A;  2ZHG A;  3LUR A;  5GQQ A;  3IAO A;  1EXJ A;  3G9R A;  3R8J A;  3R8K A;  5KAX A;  1Q09 A;  4AYZ B;  3Q3D A;  3D71 A;  5KCB A;  2HVA A;  1Q08 A;  3Q5S A;  5KAU A;  2J5U A;  1R8D A;  5KAV A;  3GK6 A;  4B0Y A;  3Q1M A;  2KCU A; 
#chains in the Genus database with same CATH topology
 2QM8 A;  3TNU B;  3H1I G;  3I55 P;  1XTG B;  2BEQ D;  5B5E E;  2Q9I A;  3RL0 g;  4CPG A;  3E1I A;  2A45 I;  3MP7 B;  1M57 D;  2FXM A;  2WTY A;  3CD6 P;  1D7M A;  1Q08 A;  3CL3 D;  3CWB G;  5BU8 B;  1DD4 A;  2QE7 H;  1ZRT E;  1PPJ E;  4XE5 B;  1J1D B;  1HF9 A;  1FDI A;  3A7O A;  2P10 A;  2I8D A;  3IFM A;  2WPR A;  4IOI H;  1RF0 A;  2Y9Z A;  1AV1 A;  4HYT B;  3CLQ A;  3R8K A;  1FU1 A;  3L71 D;  4OWF A;  1USD A;  4EDF A;  3KDP B;  2NPS C;  2QEX P;  2QM7 A;  5KAW A;  1N73 C;  2XZR A;  5I44 A;  2HOD A;  2FYU G;  4GDO A;  3NFQ A;  1FZA A;  4WWI A;  2WT7 A;  1VQO P;  5KKZ C;  4KHX A;  4L74 A;  4QMA A;  1IFJ A;  2V7Q H;  1SQP D;  1NTK G;  2RN0 A;  3H1H J;  4H44 C;  3CCS P;  1ZW0 A;  1Q06 A;  1GDT A;  3L74 D;  1RQU A;  2WVR A;  1BDD A;  1RQV A;  3FWN A;  1KOR A;  1GK4 A;  2JEE A;  4M3L A;  2Y0E A;  1MZ9 A;  1VQ4 P;  3L71 E;  2PP6 A;  1LTJ A;  1SQB G;  3TYY A;  2O01 H;  3HE5 B;  2V4H A;  4BXL A;  5GQQ A;  1EXJ A;  3L37 A;  1NO4 A;  2KUB A;  3GHG A;  3NXS A;  3PH0 A;  5KJ7 A;  1L4A B;  1VQK P;  2E42 A;  1FOS F;  5KLV D;  1YTZ T;  1NTZ K;  1FJK A;  4JPZ B;  2B87 A;  3F5H A;  1KTM A;  1LJ2 A;  1Y9B A;  1NU1 K;  4OVN F;  4W7Y A;  3WUU A;  3CC7 P;  1GW4 A;  4IL6 H;  3HTK A;  2SPZ A;  3LID A;  2AXT H;  1N7S A;  3TDK A;  1SQP E;  4H0L B;  3T97 B;  4HKZ H;  3TGU G;  4DCZ A;  2KLU A;  5AVU B;  2Z4E A;  1QL2 A;  3W68 A;  4LHF A;  1SQX E;  2FYZ A;  3SWK A;  2P7J A;  2Q3I A;  4KT0 J;  1NWQ A;  4JF7 A;  4ZNC A;  3RBZ A;  3B5N D;  3NTN A;  1PFI A;  3D71 A;  1RH6 A;  1MFT A;  2PRR A;  1Z56 A;  1KB9 D;  2I1K A;  4IL6 E;  1T2K C;  1MFZ A;  3HRN A;  4Y28 J;  2AXT E;  3OJA B;  1LP1 B;  1URQ D;  1H8A A;  4IFD K;  2FFD C;  3QWO C;  3L73 D;  3FXE A;  1KB9 H;  2BCC G;  3GMA A;  1IFN A;  1EXI A;  3H1I J;  3CCL P;  2H88 C;  3CCR P;  1N7L A;  3H1H D;  2LXC B;  5GTH H;  1GW3 A;  5BU5 A;  5APT A;  2E75 D;  1SLQ A;  1BGY G;  2ITA A;  4B86 A;  2KK7 A;  1OVR A;  1CI6 B;  1ZOY C;  2NPS A;  1YIT P;  1VF5 B;  1Y6U A;  1KB9 E;  1S9K E;  1N73 A;  2ZJS E;  1QEX A;  1YHQ P;  1OX3 A;  1IFI A;  2B89 A;  5GTH E;  2JJL A;  1AQ5 A;  1HJB A;  2W6A A;  4RKU J;  3S4R A;  3PLN A;  1SQV K;  3WUV A;  1JM0 A;  3RK2 D;  5M1B A;  4XFJ A;  5CJ4 A;  3AE9 C;  1EDJ A;  3MHV A;  2Y0D A;  3L70 D;  3TF5 A;  3H1H E;  1GD2 E;  2WSE J;  3FX0 A;  1W2E A;  3VMY A;  1LTI C;  1XTC C;  1NTZ G;  3H1K J;  1YJW P;  4JYB A;  4D6T G;  4GOD A;  5GTI H;  1NU1 G;  4AQR D;  2FYU J;  1GU5 A;  3G6E P;  1KYO D;  1TU3 F;  1KN7 A;  1FAV A;  2GOV A;  1U7J A;  2R32 A;  3O6Q B;  2ZYD A;  1Q7Y Q;  2KS1 B;  3SFE C;  5DJT B;  4OGQ D;  1NTK J;  3N4X A;  4OH8 B;  3IAO A;  1KYO H;  2DW3 A;  3BCC D;  3M91 A;  3LW5 J;  1ZXG A;  2W27 A;  3VYI A;  1BSH A;  5GTI E;  1HGV A;  1NJI Q;  3MIW A;  2R5B A;  1EQ7 A;  2CK3 H;  3L72 G;  2IBZ E;  1K05 A;  2IBZ I;  4RO0 A;  1NH4 A;  3CCU P;  1M1J B;  2R5D A;  2C9N Y;  1Q82 Q;  2E75 B;  3EZ7 A;  2N1T D;  5KAI H;  1KYO E;  2BOW A;  3MZW B;  1N86 A;  2DG6 A;  1AQT A;  3USS A;  2QJY C;  2G3A A;  1JY3 N;  2JKV A;  3VOP A;  3N7N A;  2WSC J;  4YTP C;  1VQP P;  2Q6Q A;  2FFD A;  1EZV G;  3TGU J;  3BCC E;  1T8Z A;  2KZJ A;  1PGQ A;  2WPV B;  3CME P;  3GLM A;  2Q3E A;  5KAI E;  3O8Z A;  1AFO A;  1KFM A;  4WLW A;  3RK2 B;  1L0N K;  4LC1 A;  2RH0 A;  2QJK B;  3H1K D;  3B5N C;  1Q05 A;  1FDM A;  3AED C;  4Y99 C;  3V4W A;  1LTG C;  2I1J A;  1SQQ K;  2WSF J;  4C46 A;  1SQV G;  3JC2 2;  2OYI B;  4K35 A;  5KCB A;  2N9B A;  1YYC A;  5AW0 B;  4LLH A;  2WSE H;  2B9B A;  3GW6 A;  4L75 A;  1USE A;  3CX5 D;  2OYH C;  4Z1M H;  1URQ C;  2HPC B;  5AVW B;  2KOG A;  4ZKP A;  2CPS A;  4PJ0 E;  1HBW A;  2IDB A;  3CCJ P;  1HUC A;  1SFC B;  3H32 A;  3U1C A;  1K04 A;  1RH5 B;  1GL2 D;  3SSU A;  3TK1 A;  5CCG D;  3EWK A;  3M06 A;  3KZI H;  2E75 C;  3BRT B;  2P67 A;  3B8E B;  5AW5 B;  3A0H H;  3L4F A;  3RK3 D;  5B5E H;  1NTM D;  3E7K A;  4I6M C;  3W67 A;  3OA7 A;  1L0L K;  2A45 H;  3H1K E;  3WMM 0;  2FYU E;  2OTK E;  2E43 A;  3TSI A;  2XNX A;  2FYN B;  4YXD C;  1NOH A;  1T3U A;  2HVA A;  1LT9 B;  2IPP A;  3CXH I;  3KZI E;  2J59 M;  2J58 A;  1GU4 A;  2KCU A;  1NTK E;  3VN0 A;  3A0H E;  2YMY A;  2FKW B;  2YKO A;  3RK2 C;  4DT0 A;  1NTZ J;  4ASW A;  2QJK C;  2KXP B;  4AYZ A;  3R8J A;  3KXD A;  1L4A D;  1U7M A;  2YMK A;  1P84 I;  2K9J A;  4EYY Q;  1NKN A;  3PRJ A;  3RK3 E;  2ZT9 B;  2KIK A;  1NTM E;  2IZ1 A;  2XKM A;  3KPE A;  1JYH A;  2AXC A;  4H0L D;  5AVV B;  1FZB A;  1RE3 C;  2Y0C A;  3A0B H;  2JR8 A;  2W83 C;  2HYN A;  1YI2 P;  4C7N A;  4OGQ C;  2IZ0 A;  4HB1 A;  1L0N G;  5AVR B;  4I1L A;  3M9B A;  2H7H A;  1D5Y A;  5E01 A;  4I7Z B;  1IFM A;  5C39 A;  3RGU A;  3L72 J;  1SQQ G;  3TGU E;  4U3F G;  3OW2 O;  4RJT A;  5KLI B;  3HUS C;  1DD3 A;  2YO3 A;  2Z5H A;  1BDC A;  2KSJ A;  3AE2 C;  1LWU B;  1GL2 B;  1U57 A;  1YQ3 C;  3A0B E;  2E74 D;  3KHU A;  5CBN A;  1QLE D;  1Q0A A;  2K88 A;  3JCU E;  1RF1 B;  2N1T C;  2M3B A;  3B5N A;  3AE5 C;  1R8D A;  3RK3 B;  3HE4 B;  1LT9 C;  2OQQ A;  3H1L G;  3UCS A;  1FE6 A;  1N2D C;  4NPE A;  3EZ9 A;  5D8C A;  1T3J A;  3H1J D;  3FWL A;  3L75 G;  5APU A;  3AEF C;  2QG4 A;  2OYH A;  1BCC D;  1URQ A;  4AUW A;  2IFN A;  1SQX D;  1L0L G;  1AVY A;  1YQ4 C;  1DEE G;  4ZKU A;  4H13 B;  2OGU A;  1GTW A;  5KAF H;  1VF5 D;  2E5Y A;  3RL0 B;  1FOS E;  1VQ9 P;  5TIS H;  1J1D C;  1PIX A;  1OXZ A;  1SQV J;  1KQS O;  1QX8 A;  2ZAE B;  1A02 F;  2GUV A;  1SQP K;  3AEC C;  1KMI Z;  5CJ0 A;  1QL1 A;  1JY3 O;  2W90 A;  1G2C A;  2W8Z A;  1PPJ G;  4R22 B;  2R3C A;  2YXR B;  3B4S A;  5KAF E;  3CCE P;  4B0Y A;  1VDF A;  5TIS E;  3Q5P A;  1Y47 A;  3D6Z A;  2Y9Y A;  3E0H A;  2HG5 D;  3H1J E;  1PP9 J;  4GT1 A;  4YXW H;  1DIP A;  2MKV A;  1BCC E;  2AEJ A;  3M0A A;  3CMA P;  4R4L A;  1LWU C;  1GL2 C;  1RE4 C;  5CCG C;  5CHX A;  4EI2 A;  5KLV K;  1OMI A;  4JBZ A;  1S9K D;  3HD7 B;  1IZN B;  3RK3 C;  1NGM B;  2O3J A;  2IYP A;  1OW6 A;  3M9Q A;  3G9R A;  2JO1 A;  3AE4 C;  1PZQ A;  1JEK A;  1YIJ P;  4MN4 C;  2E74 B;  3GK6 A;  2JML A;  5AVQ B;  3C8V A;  1FZC B;  1RE3 A;  3GG2 A;  3EZF A;  1M90 Q;  1NHL A;  1K73 Q;  3S1K A;  3AEE C;  2KNC A;  4DOJ A;  4PV1 B;  3JSV C;  1WRG A;  3CWB J;  1K8A Q;  1JY2 O;  3L72 E;  3G71 P;  5APQ A;  4WBA A;  2KI7 B;  3Q5R A;  2Q1K A;  1L4A C;  4NPF X;  3GF3 A;  3F89 A;  3SWF A;  4WY4 D;  3Q2Y A;  3HUS A;  2MJZ A;  3L71 G;  2A06 D;  2O01 N;  1HGZ A;  5AW1 B;  2P58 A;  1Y8A A;  1PL5 A;  1FBM A;  3R4Y A;  1Q81 Q;  4H0L C;  1L0N J;  2H89 C;  2N1T A;  5CMZ A;  2KVV A;  3BAS A;  3I56 P;  2H8P D;  1LT9 A;  2QA4 P;  3IN6 A;  4BRY A;  3TNU A;  1EZV I;  4U3F J;  3IR9 A;  2IBZ D;  3GPV A;  1PP9 D;  2O1K A;  1SQP G;  3AE8 C;  1S4X A;  1JOC A;  2G8Y A;  3L74 G;  3HD7 C;  1UII A;  2WQY C;  3ITK A;  3MUD C;  2JWA A;  2JP3 A;  2WMM A;  4DJG A;  5KTB A;  1JY3 P;  3PP5 A;  2E74 C;  1S1C X;  2A06 E;  1YJ9 P;  1JB0 J;  2QVA A;  1KFN A;  1JTH B;  1SQV E;  3H1L J;  3V2P A;  1E5W A;  3VP8 A;  2IX7 C;  1FZC C;  3E1R A;  1SFC D;  2HOD B;  2WZ7 A;  1ZV8 A;  2C9L Y;  3ABV C;  3P8C E;  3EQ2 A;  5KLV G;  2XDJ A;  2WT7 B;  1L0L J;  2YKQ A;  1RY3 A;  3H1I D;  1IK7 A;  2XU6 A;  1WMK A;  1SQB J;  1KV4 A;  3VMA A;  4A7P A;  3EFF K;  1FZE A;  5BVZ A;  2PFX A;  1PP9 E;  1VQN P;  3WU2 H;  4WVZ A;  1VF5 C;  1IFP A;  4ZMD A;  4GKG A;  3CWB D;  1GL2 A;  3CCQ P;  1RE4 A;  5H2F E;  5CCG A;  1VL2 A;  4L73 A;  4N3Y B;  1VPC A;  1LTJ B;  1S3J A;  3HE4 A;  4WY4 B;  1JNM A;  1H0T B;  4A1M A;  3GHG B;  1KZU B;  1VQL P;  2PGD A;  2C0W A;  1QGK B;  1FZF A;  4WLS A;  2D2C B;  1SP4 A;  3WU2 E;  2XND H;  3U59 A;  3A5T A;  1H88 A;  3L73 G;  1G1J A;  3H1I E;  2E76 B;  1E79 H;  3HTK B;  3MGN A;  5AW4 B;  2ZT9 D;  5KAV A;  1N7S B;  1AA0 A;  3EFG A;  3A2A A;  4PJ0 H;  1JMM A;  4BWN A;  2ZXE B;  1R8E A;  3H1H G;  4R24 B;  3HE5 A;  2QRX A;  3AE1 C;  3CWB E;  1GK6 A;  2FYU D;  3H6P A;  1LTS C;  4EOT A;  2GM4 A;  1L4A A;  4GIF A;  5APX A;  1J2J B;  2BCC J;  3PTZ A;  5CBO A;  3GP4 A;  1OW7 A;  1NTK D;  3V5B A;  1GMJ A;  1KIL D;  1CW5 A;  1A02 J;  4KJM A;  4C7R A;  1L0N E;  3T97 A;  2N9Y B;  1GZL A;  3G4S P;  1EDK A;  1YBK A;  1BGY J;  3RBX A;  1S5L X;  1P84 D;  1M1J C;  1JY2 N;  3CXH H;  2IYO A;  3NMD A;  2KZI A;  3PJS K;  1SQB D;  2PAJ A;  3R2P A;  3L71 J;  3LW5 H;  5APW A;  3L70 G;  2K9Y A;  1OWA A;  3HD7 A;  2M5A B;  2WSS H;  3LIE A;  4WY4 C;  1OVV A;  4R4E A;  1HJ0 A;  1P84 H;  1M7L A;  2WPQ A;  3MUD A;  1LP1 A;  5KAT A;  1BE3 G;  4PD4 E;  4PD4 I;  2ZHG A;  2P1J A;  2NPS B;  2AEM A;  3VMZ A;  4H13 D;  1N73 B;  4IFM A;  1OFC X;  2HFE D;  1KC8 Q;  3CXH E;  3H1L E;  1FZC A;  2KSE A;  3RL0 D;  1H89 A;  1DX7 A;  1KIL E;  2M3E A;  1N7S C;  3B71 A;  3TGU D;  3CCV P;  2W6J H;  1NTM K;  3BCC G;  3L74 J;  2WPS A;  1L0L E;  4D6T J;  5KKZ B;  1NU1 J;  3CX5 I;  1P84 E;  2WSC H;  4HH2 A;  1SQB E;  4AYC A;  4H44 B;  2OYI C;  4K3A A;  1CI6 A;  1KQF B;  1M56 D;  3C1L A;  1ZN5 A;  1R5L A;  5APV A;  2QSI A;  2RMZ A;  5KLV J;  1SFC C;  2BCC D;  3JCU H;  5I41 B;  1IK9 A;  3M9H A;  3IF4 A;  2RKL A;  1FS0 E;  3EZ2 A;  1LX8 A;  1M8O B;  3OAK A;  4U7J A;  1MUU A;  2WSF H;  1MV8 A;  5AW6 B;  1IC2 A;  5CCH D;  3HD7 D;  1KIL B;  2LKM A;  1RHZ B;  1R5S A;  1BGY D;  2NRG A;  4IFF A;  2M8R A;  1IO4 A;  1HVV A;  1SS1 A;  1KQL A;  2C0X A;  3SWY A;  2FYN C;  5B66 H;  2J5U A;  3O6Q A;  3U1A A;  2KS1 A;  1JTH A;  3H1K G;  2KP8 A;  2KB7 P;  1OIP A;  1WT6 A;  2UWJ E;  4PV1 D;  2BCC E;  3L73 J;  3ZDM A;  2K3R A;  2WIT A;  3AEA C;  4N78 D;  1JBG A;  1JO5 A;  4L76 A;  1NKZ B;  2LXB A;  2ZVO B;  2FFD B;  3L35 A;  3V2Q A;  1NTZ D;  4GOE A;  5B66 E;  2ZT9 C;  4D6T D;  2GUS A;  3BVH A;  1NU1 D;  1BGY E;  1M1J A;  2A45 G;  5AW2 B;  4XA4 A;  2ZHH A;  2QJP B;  4RES B;  4W7Z A;  4LGD E;  3CC2 P;  1JMB A;  2AEF A;  5AW8 B;  3MTU E;  3KQG A;  4YPC A;  1QVF O;  1NTM G;  4WY4 A;  1H0T A;  1SQX K;  2L5G B;  4I7Z C;  2WWW A;  3V6I A;  2POH A;  2R3S A;  1KIL C;  2BEZ F;  1NVO A;  5KLI C;  1K9M Q;  1AVO A;  3V4Q A;  3L72 D;  1JCD A;  4N78 E;  3CI9 A;  2Z5I A;  1X8Y A;  3L70 J;  2M0B A;  3UIA A;  3Q1M A;  2LR2 A;  1NTZ E;  3H32 B;  1YTZ I;  2R44 A;  1RF1 C;  5EFW B;  3L74 E;  1DEB A;  4D6T E;  3P32 A;  1NU1 E;  2IEF A;  4ASV A;  5TJH A;  1BE3 J;  2ZXX A;  3GF7 A;  2OYI A;  1FZG A;  1NYH A;  2VRS A;  1YJN P;  1DH3 A;  5AVX B;  1PM6 A;  2HPC A;  2QIW A;  1LTT C;  3EZ6 A;  1S5L H;  5AVS B;  5K5G B;  1LTB C;  1EZV D;  2ZYG A;  1PGO A;  4H13 C;  1X0T A;  5DJU B;  3MD0 A;  5KLV E;  1SFC A;  3BCC J;  3RL0 C;  5KAX A;  2BAS A;  1L2P A;  5KAU A;  1PGJ A;  3AE6 C;  4UB6 H;  5AVZ B;  1EC5 A;  1IFD A;  2QJP C;  3L36 A;  5AW3 B;  1Q90 D;  2CPB A;  4AYZ B;  3AE3 C;  1S5L E;  2M5A A;  3CPW O;  1SQV D;  5KJ7 D;  1ZME C;  1SVF A;  2OYO A;  2K9J B;  5L8R J;  1X9V A;  2D2C D;  3CC4 P;  3P8C D;  2E76 D;  1KB9 I;  3KYQ A;  1Q07 A;  1W5C E;  2B88 A;  3LUR A;  1W2B O;  1N7S D;  3P7K A;  1Q09 A;  4TT3 H;  4UB6 E;  1SQQ J;  1KD1 Q;  1EZV E;  3BRV B;  3M0D C;  2OAR A;  2KLV A;  1CZQ A;  3A3Y B;  5AW9 B;  2QJY B;  3QH9 A;  4C7N B;  1HWT C;  3L73 E;  4W80 A;  2VZ4 A;  1ZR4 A;  2YNY A;  3H1J G;  5CCH C;  5APY A;  5APS A;  1JUN A;  1BCC G;  1EDI A;  2JWD A;  1SQX G;  3SFD C;  4O9B A;  1CSB A;  2K1A A;  3HH0 A;  3I5C A;  1LTA C;  4J2N A;  1BE3 D;  1S2E A;  2XV5 A;  5H2F H;  1HTL C;  1X22 A;  1AJY A;  3H25 A;  3VMX A;  3L75 J;  3BAT A;  1LNQ A;  1VQ6 P;  4EIJ A;  3B5N B;  1ZR2 A;  4Y99 B;  1QVG O;  4PV1 C;  3QAO A;  2L91 A;  3G3Z A;  2ZVN B;  3VTP C;  2H43 A;  1IJD B;  1KIL A;  1J1E B;  3V2R A;  3VP9 A;  1FDO A;  3AEB C;  4DCK A;  2OYH B;  1URQ B;  2YIU B;  1LWU A;  2K37 A;  2HR3 A;  4TLF A;  2NPS D;  1OZH A;  3L70 E;  1HH0 A;  3D70 A;  1RF1 A;  1VQ5 P;  1NTM J;  2ZFC A;  4JQ0 D;  2Q5U A;  5AW7 B;  3PHL A;  1BE3 E;  2YXQ B;  2FXP A;  3II6 A;  2KYV A;  1KYO I;  1L0N D;  3CCM P;  1ZLL A;  2B87 B;  3B49 A;  1Q86 Q;  1Q2N A;  2OG0 A;  1G2C B;  3S9O A;  4N6J A;  1JY2 P;  3FXD A;  4GOF A;  2YKP A;  5E79 H;  2OTJ P;  4H44 D;  1SQQ D;  4UB8 H;  1RF0 C;  4U3F D;  4DZO A;  2Q7C A;  2GA1 A;  1N8R Q;  3D6Y A;  2ZYA A;  1OW8 A;  1LT1 A;  2YO2 A;  4WB4 A;  1PV3 A;  4IL6 X;  1VQ8 P;  1PGP A;  1LGH B;  1EDL A;  1S72 P;  1G1I A;  1M1K Q;  4PD4 D;  1FC2 C;  5D90 A;  2P2U A;  3CXH D;  3H1L D;  4HJG H;  5E79 E;  2A06 G;  1OVU A;  3V2N A;  2IFM A;  2W6B A;  3FGA D;  4UB8 E;  3L75 D;  2JDI H;  1ZP0 C;  1KQG B;  4PD4 H;  1BSN A;  1J1E C;  1L0L D;  2HLO A;  2NZ2 A;  2E5T A;  2YIU C;  1SQQ E;  2FY8 A;  2FYU K;  3WUT A;  3M0D A;  4U3F E;  1T6A A;  1UIX A;  5AVY B;  4OGQ B;  1LTJ C;  2KNC B;  2IBZ G;  1JCC A;  1PP9 G;  5CCH A;  3C9I A;  3CX5 H;  1BOW A;  2O1J A;  1NTK K;  2V7Q J;  3GHG C;  5KJ7 C;  1ZRT D;  1VQ7 P;  2D2C C;  1PPJ D;  1T2K D;  3HUS B;  3K5B A;  4NPD A;  1NAY A;  1FJP A;  3AE7 C;  3Q3D A;  1NAF A;  4JYC A;  2E76 C;  3AEG C;  2OTL P;  2FBW C;  1SQB K;  3L75 E;  1SQP J;  4R4M A;  2N1T B;  1X79 B;  2O01 J;  5AVT B;  1MKM A;  2FXO A;  3H1J J;  4I2L C;  3CX5 E;  1BCC J;  1VQM P;  3P8M C;  3Q5S A;  1SQX J;  4BRY B; 
#chains in the Genus database with same CATH homology
 2WSE J;  2WSC J;  1DD3 A;  4YTP C;  1PL5 A;  2ZHH A;  3Q5P A;  3D6Z A;  3E0H A;  5I41 B;  1S5L X;  3R4Y A;  3AE6 C;  4PV1 C;  5D90 A;  1VL2 A;  2BEQ D;  4H0L C;  1DIP A;  3RL0 g;  3AE2 C;  2H89 C;  3QAO A;  1U57 A;  2MKV A;  2QJP C;  1YQ3 C;  4Y28 J;  3EZ2 A;  1LX8 A;  4H44 C;  2KVV A;  1Q90 D;  2E74 D;  2WPV B;  3FGA D;  4R4L A;  1Q06 A;  4U7J A;  4YXD C;  1Q0A A;  3IN6 A;  4AYZ B;  1RQU A;  3GLM A;  3AE3 C;  4I7Z C;  1FDO A;  2HVA A;  3AEB C;  3AE5 C;  1Q08 A;  1ZP0 C;  1KQG B;  1ZME C;  1R8D A;  2K9Y A;  5L8R J;  2KCU A;  1OMI A;  1RQV A;  1TU3 F;  4WLW A;  2D2C D;  3GMA A;  4A1M A;  1DD4 A;  2GOV A;  3GPV A;  1ZRT E;  1EXI A;  4R4E A;  1HJ0 A;  1KOR A;  2OQQ A;  2NZ2 A;  2H88 C;  3AE8 C;  3SFE C;  2BEZ F;  1NGM B;  4WLS A;  2D2C B;  5KLI C;  2YIU C;  5KAT A;  3UCS A;  2G8Y A;  1Q05 A;  3AED C;  4OGQ D;  1UIX A;  1HF9 A;  2E76 D;  2QJK C;  3EZ9 A;  3D70 A;  5D8C A;  4AYZ A;  2WQY C;  1Q07 A;  3R8J A;  2ZHG A;  1OW6 A;  3LUR A;  3IAO A;  1EXJ A;  2JO1 A;  3AE4 C;  3AEF C;  3G9R A;  2E75 D;  2WSF J;  5GQQ A;  1Q09 A;  1FDI A;  2YMK A;  4OGQ B;  3LW5 J;  2E76 B;  5KCB A;  2JP3 A;  4TT3 H;  4H13 D;  2E74 B;  2FYN C;  2J5U A;  2P10 A;  2ZT9 D;  3O6Q A;  3GK6 A;  5KAV A;  3Q1M A;  2JML A;  1YQ4 C;  2E74 C;  4H13 B;  2FXP A;  1S1C X;  3C8V A;  1KIL E;  3RK3 E;  2ZT9 B;  3EZF A;  3B71 A;  1R8E A;  2IEF A;  1JB0 J;  1VF5 D;  4Z1M H;  1KTM A;  4R24 B;  1BOW A;  2V7Q J;  3AE1 C;  2VZ4 A;  1Y9B A;  3B49 A;  1ZOY C;  1VF5 B;  1Y6U A;  2OG0 A;  1K05 A;  3AEE C;  3GF7 A;  1JYH A;  4PV1 D;  3R8K A;  4H0L D;  2D2C C;  3S9O A;  2IDB A;  1PIX A;  4H44 D;  1NYH A;  3ABV C;  3AE7 C;  4PV1 B;  4H0L B;  1K04 A;  3Q3D A;  3SFD C;  3T97 B;  2E75 B;  1PM6 A;  4OGQ C;  3EZ7 A;  3AEA C;  2QIW A;  2E76 C;  1JBG A;  4H44 B;  3AEG C;  3EZ6 A;  4DCZ A;  3D6Y A;  3AEC C;  2FBW C;  1KMI Z;  3HH0 A;  5I44 A;  3EWK A;  1IK7 A;  2BOW A;  1KQF B;  3Q5R A;  2E75 C;  1WMK A;  3GP4 A;  3GF3 A;  2DG6 A;  4J2N A;  1OW7 A;  4LHF A;  1OW8 A;  4R4M A;  4H13 C;  4RKU J;  5E01 A;  2O01 J;  4I7Z B;  1D5Y A;  3Q2Y A;  1MKM A;  2G3A A;  2QJY C;  2ZT9 C;  4KT0 J;  4R22 B;  4GDO A;  1PV3 A;  1GMJ A;  4IL6 X;  5KAX A;  5KAW A;  1AJY A;  5M1B A;  3H25 A;  2QSI A;  4XFJ A;  3D71 A;  1RH6 A;  1VF5 C;  3Q5S A;  3AE9 C;  5KAU A;  5KKZ C;  4B0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...