3D6ZA

Crystal structure of r275e mutant of bmrr bound to dna and rhodamine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
277
Chain Sequence
b'KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
total genus 76
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d6zA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d6zA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d6zA03
3R8JA 1EXIA 1Q08A 3QAOA 3GPVA 2GOVA 2KCUA 3D6ZA 3G9RA 3Q3DA 4J2NA 4R4MA 2HVAA 1JBGA 1BOWA 3D70A 3HH0A 1D5YA 5E01A 4R22B 3UCSA 3LURA 3R8KA 5I41B 3GP4A 4AYZA 3Q5SA 4WLWA 1R8EA 3D71A 2VZ4A 1Q05A 5KCBA 5KATA 5D90A 4R24B 2OQQA 5GQQA 2ZHHA 3Q5RA 5KAWA 3IAOA 1Q09A 3Q1MA 1EXJA 1R8DA 4AYZB 1Q07A 2JMLA 4R4EA 1DIPA 3Q5PA 5D8CA 3Q2YA 3D6YA 5I44A 2J5UA 2BOWA 5KAUA 4R4LA 3T97B 4B0YA 1JYHA 5KAVA 5KAXA 4A1MA 2ZHGA 3E0HA 1Q06A 3B49A 2DG6A 4WLSA 3GK6A 1Q0AA
chains in the Genus database with same CATH superfamily
1P84E 1EZVG 1SQBJ 3M91A 2KVVA 2ZVNB 4H44D 3HD7B 1LWUC 4OGQD 3GHGA 1J1EB 4I1LA 3TGUD 1EXJA 3AEGC 1LGHB 2QEXP 2H8PD 5I44A 1ZV8A 1FDOA 2K9JA 1EXIA 5AW9B 5AW8B 4DCZA 2R44A 2CK3H 4R24B 2RKLA 2FXPA 2OTKE 1L4AC 5CCGA 1NU1G 5KLIC 2ITAA 2Y9YA 1K05A 1M1KQ 2OG0A 2FYNB 1X79B 1KQSO 3TYYA 4WY4C 1FZFA 3A0BE 3AE6C 1AFOA 2K88A 1H0TA 2FKWB 2NPSD 3PP5A 1J1DC 3N7NA 1QEXA 4H0LB 1M8OB 2B87A 3CCMP 1D5YA 3USSA 1CZQA 3S1KA 1GMJA 1HBWA 1X0TA 1KFNA 4EYYQ 3GF3A 3F89A 5KAUA 2IZ1A 1SQVE 5TISH 3L75E 2PFXA 3A2AA 4ZKPA 4Y99C 3ZDMA 1FZBA 4R22B 2W8ZA 2YMYA 4OGQB 3M0DC 3AEBC 3V6IA 1PL5A 2QM7A 3L75J 1R8DA 4XFJA 3Q2YA 1NVOA 3MGNA 1L4AD 4B86A 1LNQA 1SFCC 3F5HA 4AYCA 3CCJP 1BE3D 1Q0AA 1Q2NA 4JYBA 2QJPB 1EDKA 2N9YB 5I41B 1SQPJ 1L0LD 4PJ0E 1NO4A 3D71A 1VL2A 3MUDA 3H1LD 1T3UA 4R4EA 1M1JB 2KZIA 1G1IA 4L75A 5KKZB 2W90A 1BGYG 2QSIA 1SQQK 3RGUA 3U59A 2WPQA 2M3EA 2C0WA 3EZFA 3R4YA 1NTZD 3R2PA 1LT9C 5EFWB 3L70D 3E1IA 2N9BA 2LR2A 1S5LE 3CX5E 5KJ7C 4GODA 2YKQA 1BSNA 1RQUA 1S1CX 3TF5A 1YHQP 1KILE 2Q6QA 1KTMA 1NU1J 1LWUB 2YKOA 3AE9C 3L74D 3L73D 3NMDA 4L74A 2QA4P 1SFCD 2V7QH 3A0HE 4U3FD 2D2CC 5H2FE 1IO4A 1FDMA 1NTZK 4BWNA 2V4HA 4QMAA 1NGMB 2AEFA 5CMZA 3M9QA 1L4AB 1DEEG 3EZ9A 4JPZB 3CD6P 2O1JA 5KLIB 2A45I 1FZAA 3L71D 1AV1A 1LTBC 2W27A 4PD4E 3IN6A 3SFEC 3H1KE 5DJTB 3V4QA 3L72D 3VMZA 4YXWH 4WY4B 1E5WA 1VQMP 3CI9A 3H1KJ 3H1HG 4ZNCA 3EFFK 1SQXE 2N1TD 2O01J 1J1DB 1AVYA 4CPGA 1Q81Q 5D90A 2HPCB 3VP9A 3RBZA 1T8ZA 1SQVK 3NTNA 2JMLA 4W80A 2E43A 1DD4A 3HUSA 2M5AB 2B9BA 2JEEA 2L5GB 1LTJB 2WT7B 3B49A 2FXOA 1BGYE 4HB1A 3BASA 4PV1C 4Y99B 2XU6A 1DX7A 2D2CD 1PV3A 2PRRA 3H1IE 1BGYJ 2MKVA 5TISE 2BOWA 2OTJP 2W83C 2QJYC 1K8AQ 3RL0D 1YI2P 1SFCB 1KYOD 2QIWA 3KPEA 3M06A 1VQOP 1EDIA 2WPRA 1NH4A 3CCLP 2BCCG 1L0ND 2A45H 1PIXA 4OWFA 2RMZA 4KT0J 3AE4C 1AQ5A 3V2RA 3GG2A 3E0HA 2NRGA 3OA7A 2M0BA 1NAYA 1BCCG 1GU5A 1LTIC 2CPSA 1GW3A 4AUWA 5AW1B 1LT9B 1HGVA 1AQTA 1ZR4A 1EQ7A 3AEDC 3VTPC 2WQYC 2OTLP 1Q06A 1SLQA 2K9YA 2QM8A 2OYHC 3H32B 4PV1D 5KLVE 3EZ6A 1BDDA 2GUSA 2FYUD 3CC4P 1E79H 1L0NK 1YIJP 5AW3B 4DCKA 5KLVJ 1N73A 3P7KA 2D2CB 3H1JG 2RN0A 3O6QA 2JR8A 2Y0DA 5APTA 1JCCA 1KQFB 1PP9E 1FJPA 2JWDA 3OJAB 3IF4A 5KAFH 3P8CD 3CWBD 1WT6A 1HJ0A 5CCHC 1IFPA 1A02J 2QRXA 4ZMDA 4N6JA 1JOCA 2A06D 2FYUK 2IDBA 1FC2C 2IBZG 5APQA 3V5BA 1NTKK 2N1TA 5AVQB 1KZUB 2KNCA 3BATA 3TGUE 2WWWA 2FFDA 3EFGA 1VQKP 2ZJSE 3UCSA 3LURA 2H89C 3HD7D 3AEEC 3KYQA 1N7LA 4W7ZA 4YXDC 1FE6A 3CXHD 4WB4A 2BCCJ 3C9IA 5AW4B 3VYIA 3A5TA 1YJ9P 3EZ2A 3M9HA 2Q5UA 2C9NY 4PV1B 2Q7CA 1FDIA 1JM0A 4D6TD 3JCUH 1KD1Q 2K3RA 2M3BA 4UB6E 1BCCJ 2IEFA 2QJYB 2IFMA 3AE8C 3WU2H 1URQA 4MN4C 5AVZB 1OIPA 1RE3A 4K35A 2JO1A 1DIPA 1N8RQ 4Z1MH 2H7HA 1SQVG 1QL1A 5GTHH 1T3JA 5AVTB 4DOJA 4H0LD 1PM6A 1FZCA 1EC5A 3H1HD 5BU8B 1SQQE 1NTMD 1YITP 4C46A 3FWLA 1Q86Q 2SPZA 3GMAA 1ZR2A 2JDIH 2YXRB 3SWFA 1VQ9P 3H1JJ 1SQQJ 2KS1A 2Q3EA 3D6ZA 2E5TA 2OYHB 4TLFA 3OW2O 3FGAD 1QLED 1OZHA 2IBZE 5APVA 2HYNA 2DW3A 2HODA 3H1LE 1ZRTD 3TNUB 4C7NB 3U1AA 1JMMA 3PLNA 3V2PA 3M0AA 3AE3C 5E79H 1NTZE 1H8AA 3CXHI 3UIAA 2Q9IA 3L70E 2KI7B 4K3AA 4EOTA 1KB9D 3HRNA 1JEKA 1BDCA 3CMEP 3CL3D 1GU4A 3AE7C 2KUBA 1LP1B 4EDFA 1Y8AA 2HFED 3GK6A 1N7SD 3HD7A 3L74E 3L73E 3D70A 1OXZA 3RK2C 3Q1MA 4IL6H 1FOSE 2WSEJ 2W6JH 4U3FE 2I1KA 2WSFJ 3FXEA 3CCSP 1S3JA 3BVHA 3PJSK 1YTZT 5KAWA 3B5NC 3P8MC 1JBGA 2ZXXA 3BCCD 1SS1A 2YNYA 1CSBA 3H1KG 1TU3F 1SQVJ 3PH0A 4LLHA 3LW5H 2E76C 3H25A 3CC2P 2B88A 1HJBA 1PPJD 1SQBD 1NKZB 1SQXG 4JF7A 3KZIE 2W6BA 3KHUA 3CXHH 1T2KC 2WVRA 4WY4D 2WSCJ 1DEBA 3E1RA 1NJIQ 4KHXA 2C0XA 1YQ3C 1AVOA 2KXPB 3SSUA 2WPSA 3H1IG 3EQ2A 1S9KD 3G71P 5GTHE 1GZLA 3AECC 1N7SB 1Q08A 1CI6B 1SQBK 3GF7A 1KC8Q 1KB9I 1IK7A 4OH8B 4UB8H 4YPCA 1KYOE 1L0LK 1KFMA 3L4FA 4XA4A 2IX7C 3Q5PA 5AVVB 1ZXGA 4HH2A 2E76D 1L0NE 5KTBA 3S4RA 4BRYA 1RQVA 1OW8A 3FXDA 3HE5B 3KQGA 1M1JA 2E74C 2Z5HA 1T2KD 3WUVA 1Y6UA 4HKZH 2FY8A 2AEJA 1RH6A 1S72P 2AXTH 5KLVG 5B5EH 3G4SP 3L75D 1NOHA 1GL2C 5E79E 3WUUA 2QG4A 1KILC 1X8YA 1ZOYC 2J59M 2NPSA 1LTTC 4DT0A 4HYTB 5KAXA 2FYUE 2QE7H 2OGUA 5APUA 1NTKE 1RH5B 5KJ7D 4ZKUA 1LWUA 4YTPC 1SQPD 1URQC 1D7MA 1EZVD 1NTKJ 1RE3C 1YJWP 1SQXJ 1AA0A 3I5CA 4Y28J 2AXCA 1KB9H 1PP9G 1RF1C 1BSHA 2XKMA 2KCUA 2OYIC 2PGDA 5KAIH 3V4WA 3B5NB 1SVFA 2VZ4A 1FS0E 1L4AA 3CWBE 2R5DA 1NYHA 2E74D 1MKMA 3T97B 5CHXA 2A06E 4HJGH 3RL0g 2E76B 2DG6A 3RBXA 3CCRP 3TGUG 3H1IJ 3L35A 4N78D 4NPEA 2YO2A 3FWNA 2L91A 2KLVA 1YJNP 1K04A 1NU1D 1RE4A 4WY4A 5KCBA 1GL2D 2E75C 3GHGC 5GTIH 1KILD 3KXDA 1FOSF 1MZ9A 1XTGB 2HPCA 3CXHE 3CCEP 4DJGA 2M5AA 1LTJA 2WT7A 1RHZB 4B0YA 1T6AA 2R32A 1GD2E 4D6TE 2R3SA 4L73A 5CCGC 1PZQA 3CC7P 1NU1K 1DH3A 2KOGA 1VF5C 2P7JA 4PD4D 2J5UA 1SFCA 2UWJE 1S2EA 3H1KD 2O1KA 4ASVA 4IFMA 2XV5A 3M9BA 2LXCB 3SWYA 2CPBA 3P32A 2R3CA 4RKUJ 1ZLLA 2Y9ZA 5AW6B 3RK3C 1SQQG 2KB7P 2E74B 1EZVI 2LKMA 2E75D 3HTKB 4R4LA 3G6EP 1NTME 1WMKA 1OMIA 1K9MQ 3Q3DA 1U7MA 1LT9A 1N2DC 1Q05A 3GW6A 4KJMA 1PP9J 1BGYD 4IFFA 1GL2B 4AYZB 2V7QJ 1KILB 1ZW0A 5KJ7A 3CLQA 3II6A 1H89A 4IFDK 2G8YA 1RF0A 3H32A 1IZNB 2XZRA 3H1LG 5CCGD 2RH0A 2WSFH 1YTZI 5B5EE 3VMXA 5DJUB 3CX5I 4A7PA 3L37A 1R5SA 1VQNP 2XNXA 1G2CB 1K73Q 1FZEA 2WSSH 3MUDC 1VF5D 1PGJA 3TGUJ 2E5YA 1NTZG 1FJKA 1RF1B 3QH9A 3L70G 1PGOA 1PFIA 2OYIB 1JTHB 2P10A 3Q5SA 1M56D 3RK3D 3BRVB 1KB9E 4NPDA 2ZT9C 3KDPB 2BEQD 2WPVB 1S4XA 3HE4A 4H44C 3G9RA 3L74G 3L73G 5CCHD 4W7YA 1VQ7P 1IFDA 4H13C 2KLUA 2J58A 2E75B 3GHGB 1Y9BA 3I56P 2ZAEB 4PD4I 3C1LA 5AW0B 4U3FG 5KLVD 4GOFA 2QJPC 1USDA 2K9JB 4JYCA 1VPCA 4O9BA 3S9OA 1HTLC 4WWIA 2WTYA 5GQQA 2KYVA 1AJYA 3GLMA 2YMKA 5B66H 3BCCE 2KZJA 1MUUA 2Z4EA 3CX5H 1MFTA 4R4MA 3QAOA 2E42A 2GA1A 4GKGA 3R8KA 2I8DA 1BE3E 1PPJE 1SQBE 1VF5B 4WBAA 1JY3O 3AE1C 4IL6X 2NPSC 1L0LE 2ZT9D 3IFMA 3VN0A 1BE3J 3IR9A 1H0TB 3A0HH 1WRGA 4WLWA 5H2FH 1IK9A 1L0LJ 1YYCA 2B87B 3RK3B 3OAKA 1KV4A 4H13D 1LJ2A 1NTMK 1KORA 3H1LJ 3BRTB 3D6YA 2BCCD 3HUSC 2KIKA 4LHFA 2O3JA 1N86A 1S9KE 4I2LC 4PD4H 5M1BA 3EZ7A 1NTZJ 2OQQA 2G3AA 5AVYB 1OW6A 2O01H 4DZOA 1VDFA 1BCCD 1IFNA 2Z5IA 3L70J 5KAFE 2OYHA 2JP3A 4M3LA 1IFJA 2IYOA 1L0NG 4I6MC 3B8EB 1VQPP 2KP8A 1X9VA 3CCVP 1RE4C 1IFMA 1Q90D 1M90Q 1OVVA 4L76A 1OW7A 2IFNA 4RO0A 3L74J 1JYHA 2Q3IA 3L73J 3VMAA 2BEZF 2P67A 3TNUA 1MFZA 4C7NA 1NAFA 3G3ZA 1G1JA 3TDKA 5C39A 3I55P 1R8EA 4U3FJ 1ZMEC 1OVRA 5CBNA 3MTUE 3L71E 2QJKC 1OFCX 1YQ4C 5APYA 1A02F 1LTJC 2ZYDA 1LT1A 2XDJA 3PRJA 2M8RA 3H1JD 2ZT9B 1SQQD 2FYUG 5CCHA 3L72E 2HR3A 2QVAA 1NTKG 1U57A 4OVNF 3L71J 4H44B 1NWQA 3U1CA 3B4SA 1RY3A 2LXBA 4RJTA 2PP6A 3B71A 3JCUE 3IAOA 1OVUA 1P84D 3L72J 1LP1A 4H13B 5K5GB 3MD0A 1SQPE 1HF9A 4XE5B 1JY2N 3WU2E 1EZVE 5KATA 2IBZD 1JUNA 1N73C 1M7LA 3GP4A 1PGQA 4BRYB 3PHLA 1JY3N 3RK2D 3CWBG 3AEAC 4JBZA 3O8ZA 3MP7B 1LX8A 1NHLA 1EDLA 2A06G 3NFQA 3LIDA 1HH0A 5AVWB 1MV8A 1BOWA 3B5ND 5APWA 2OYOA 4GOEA 2P2UA 1JY2P 2K37A 5B66E 4N78E 1W2BO 1NU1E 2VRSA 1HUCA 3MHVA 2N1TC 2NPSB 1JY3P 2JWAA 4I7ZC 4WVZA 1RF0C 3E7KA 5BVZA 1QVGO 2JJLA 5E01A 2FFDC 1QVFO 2WMMA 3AE5C 3TK1A 1LTGC 2FXMA 1L0NJ 1IFIA 1W2EA 3W67A 5BU5A 4A1MA 2ZHGA 4D6TG 1IJDB 4WLSA 3HUSB 2P58A 4GIFA 4N3YB 1W5CE 2GUVA 1SQVD 3WUTA 1LTAC 3VP8A 1VQ6P 5AW5B 3RL0C 1N7SA 2MJZA 1CI6A 1ZP0C 4GDOA 1FU1A 2P1JA 2XNDH 3MIWA 3R8JA 1KN7A 5AVXB 3CPWO 4J2NA 1U7JA 1OWAA 5AVSB 5AW7B 3RK2B 2FYUJ 1Q07A 1P84I 3WMM0 1DD3A 1YBKA 2FBWC 1NTMG 2POHA 1FZGA 1OX3A 2IBZI 2FYZA 2HVAA 3HE5A 1XTCC 2B89A 4IOIH 4U7JA 2R5BA 4IL6E 2ZHHA 1VQLP 4EI2A 1Q82Q 1FZCC 3P8CE 1VQ4P 2QJKB 5AW2B 1L2PA 4UB6H 5AVUB 2KK7A 5L8RJ 3CWBJ 3CX5D 1UIXA 1SQPK 2KSJA 1Y47A 1HWTC 3VMYA 3ABVC 3AE2C 4LGDE 1GTWA 4JQ0D 4TT3H 1N73B 4NPFX 1M57D 1SP4A 1JB0J 2W6AA 3LW5J 1URQD 2NZ2A 3K5BA 2YIUC 1Z56A 1KQGB 1GW4A 2IPPA 3O6QB 1FAVA 2H43A 2AEMA 3B5NA 3RK3E 1VQ8P 3JSVC 1P84H 3M0DA 2ZVOB 2WITA 1Q7YQ 4D6TJ 1VQ5P 3T97A 3SWKA 3CCUP 1Q09A 2HG5D 1GK4A 3L36A 2YXQB 1JO5A 4EIJA 5CBOA 3QWOC 2C9LY 2Y0EA 2N1TB 4I7ZB 2KNCB 1FBMA 3HD7C 4ASWA 4UB8E 1J1EC 2FFDB 1NTKD 2A45G 4AQRD 1X22A 1SQXD 1QL2A 3A7OA 1EDJA 3BCCG 5KAVA 3H1HE 1QGKB 5CJ4A 1UIIA 2ZYAA 2I1JA 1H88A 3Q5RA 3H1HJ 5APXA 1BE3G 1PPJG 1NTMJ 1SQBG 4BXLA 3AEFC 3SFDC 2WZ7A 3A0BH 3RL0B 1L0LG 2JKVA 2OARA 3CCQP 3H1ID 3GPVA 2WSEH 2GM4A 3JC22 2AXTE 3HE4B 3A3YB 3VOPA 2FYNC 1URQB 5TJHA 3LIEA 3CMAP 2H88C 1QX8A 1ZN5A 1J2JB 1SQXK 2ZXEB 1ZRTE 1KQLA 1GK6A 2Y0CA 1KMIZ 1KYOI 4LC1A 1S5LX 4H0LC 5APSA 1CW5A 3NXSA 2BCCE 2BASA 3HTKA 3W68A 3MZWB 1FZCB 1IC2A 3C8VA 3EWKA 1HVVA 1PGPA 3TSIA 2IYPA 5KAIE 1BCCE 2PAJA 4RESB 4C7RA 3HH0A 3KZIH 2WSCH 2K1AA 4OGQC 1LTSC 1GL2A 2KS1B 4AYZA 2ZYGA 1KILA 2ZFCA 4PJ0H 2YO3A 2IZ0A 5D8CA 1GDTA 3FX0A 1USEA 3ITKA 3V2QA 2HODB 1G2CA 3PTZA 3N4XA 5GTIE 3H6PA 3L71G 2YIUB 1HGZA 1M1JC 1RF1A 1JMBA 5KKZC 1S5LH 2OYIA 3L75G 4GT1A 1JTHA 1R5LA 3L72G 2GOVA 2YKPA 1JY2O 2HLOA 1JCDA 2Q1KA 1PP9D 3BCCJ 3H1JE 1JNMA 2KSEA 1KYOH 5AVRB 3V2NA 1SQPG 2O01N 1N7SC 5CJ0A 1NKNA 5KLVK
chains in the Genus database with same CATH topology
3RK3E 3AECC 3R8JA 4LHFA 1Q08A 2WPVB 4H44C 2QIWA 2KCUA 1S5LX 4H0LC 3G9RA 1HJ0A 4J2NA 2KVVA 4H44D 3D70A 3GF7A 4H0LD 2D2CC 4R22B 1PM6A 5M1BA 1IK7A 3EZ7A 3GP4A 4RKUJ 4OGQB 4OGQD 2VZ4A 3AEBC 2OQQA 2G3AA 4H13C 1PL5A 1PIXA 2IDBA 1Q09A 3Q1MA 1OW6A 1EXJA 1R8DA 1Q07A 1NYHA 2E74B 2E74D 3AEGC 4KT0J 2WSEJ 1NGMB 1MKMA 3AEAC 3AE4C 2E75B 2E75D 3Q5PA 3Q2YA 3C8VA 3EWKA 5I44A 1Y9BA 2WSFJ 4R4LA 3T97B 3GMAA 1FDOA 1DD3A 3EZ9A 3E0HA 1LX8A 2E76B 2E76D 1WMKA 2JP3A 2DG6A 3RL0g 5KAWA 1Q0AA 2FBWC 2QJPC 1EXIA 1OMIA 3D6ZA 4I7ZB 2HVAA 3Q3DA 4DCZA 1JBGA 1BOWA 3HH0A 3IN6A 3S9OA 3UCSA 4OGQC 1K04A 1RQVA 3LURA 5I41B 4AYZA 2H89C 1OW8A 3FGAD 3SFEC 1VL2A 3D71A 1Q05A 4U7JA 3AEEC 5KCBA 4XFJA 4R24B 5GQQA 2ZHHA 1Q90D 1TU3F 2E74C 1AJYA 4AYZB 1OW7A 4R4EA 2E75C 3GLMA 2V7QJ 2FXPA 2YMKA 5D8CA 3AEDC 4YXDC 1Y6UA 2WQYC 1JYHA 5KAVA 2E76C 3H25A 5KLIC 2BEZF 1Q06A 2G8YA 4R4MA 2K9YA 4I7ZC 1RH6A 3QAOA 1K05A 2QSIA 2O01J 3EZ2A 5L8RJ 4PV1B 4PV1D 5E01A 3EZFA 1FDIA 3R4YA 3R8KA 1R8EA 3EZ6A 2OG0A 1UIXA 1ZMEC 3AE5C 5D90A 3Q5RA 2QJKC 2JMLA 1DD4A 1VF5D 1VF5B 1YQ4C 1ZOYC 3AEFC 3AE3C 3ABVC 3AE6C 3AE2C 4B0YA 2WSCJ 3SFDC 2IEFA 3AE1C 4IL6X 5KAXA 5KKZC 4A1MA 2ZHGA 2ZT9B 2ZT9D 3B49A 4WLSA 3AE8C 1YQ3C 1U57A 3GPVA 1RQUA 2GOVA 4H44B 4PV1C 1S1CX 4TT3H 4H0LB 1KILE 4YTPC 2P10A 1D5YA 1JB0J 2FYNC 3LW5J 2D2CB 3Q5SA 4WLWA 1PV3A 2D2CD 1KTMA 2NZ2A 3B71A 1GMJA 3O6QA 3AE7C 3IAOA 3AE9C 2YIUC 2JO1A 1VF5C 2H88C 4H13B 4H13D 1KQGB 1DIPA 1KORA 3GF3A 2J5UA 1ZRTE 3D6YA 2MKVA 1HF9A 5KAUA 2BOWA 1KQFB 4Z1MH 4Y28J 2ZT9C 2QJYC 1ZP0C 4GDOA 2BEQD 1KMIZ 3GK6A 5KATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R8J A;  1EXI A;  1Q08 A;  3QAO A;  3GPV A;  2GOV A;  2KCU A;  3D6Z A;  3G9R A;  3Q3D A;  4J2N A;  4R4M A;  2HVA A;  1JBG A;  1BOW A;  3D70 A;  3HH0 A;  1D5Y A;  5E01 A;  4R22 B;  3UCS A;  3LUR A;  3R8K A;  5I41 B;  3GP4 A;  4AYZ A;  3Q5S A;  4WLW A;  1R8E A;  3D71 A;  2VZ4 A;  1Q05 A;  5KCB A;  5KAT A;  5D90 A;  4R24 B;  2OQQ A;  5GQQ A;  2ZHH A;  3Q5R A;  5KAW A;  3IAO A;  1Q09 A;  3Q1M A;  1EXJ A;  1R8D A;  4AYZ B;  1Q07 A;  2JML A;  4R4E A;  1DIP A;  3Q5P A;  5D8C A;  3Q2Y A;  3D6Y A;  5I44 A;  2J5U A;  2BOW A;  5KAU A;  4R4L A;  3T97 B;  4B0Y A;  1JYH A;  5KAV A;  5KAX A;  4A1M A;  2ZHG A;  3E0H A;  1Q06 A;  3B49 A;  2DG6 A;  4WLS A;  3GK6 A;  1Q0A A; 
#chains in the Genus database with same CATH topology
 1P84 E;  1EZV G;  1SQB J;  3M91 A;  2KVV A;  2ZVN B;  4H44 D;  3HD7 B;  1LWU C;  4OGQ D;  3GHG A;  1J1E B;  4I1L A;  3TGU D;  1EXJ A;  3AEG C;  1LGH B;  2QEX P;  2H8P D;  5I44 A;  1ZV8 A;  1FDO A;  2K9J A;  1EXI A;  5AW9 B;  5AW8 B;  4DCZ A;  2R44 A;  2CK3 H;  4R24 B;  2RKL A;  2FXP A;  2OTK E;  1L4A C;  5CCG A;  1NU1 G;  5KLI C;  2ITA A;  2Y9Y A;  1K05 A;  1M1K Q;  2OG0 A;  2FYN B;  1X79 B;  1KQS O;  3TYY A;  4WY4 C;  1FZF A;  3A0B E;  3AE6 C;  1AFO A;  2K88 A;  1H0T A;  2FKW B;  2NPS D;  3PP5 A;  1J1D C;  3N7N A;  1QEX A;  4H0L B;  1M8O B;  2B87 A;  3CCM P;  1D5Y A;  3USS A;  1CZQ A;  3S1K A;  1GMJ A;  1HBW A;  1X0T A;  1KFN A;  4EYY Q;  3GF3 A;  3F89 A;  5KAU A;  2IZ1 A;  1SQV E;  5TIS H;  3L75 E;  2PFX A;  3A2A A;  4ZKP A;  4Y99 C;  3ZDM A;  1FZB A;  4R22 B;  2W8Z A;  2YMY A;  4OGQ B;  3M0D C;  3AEB C;  3V6I A;  1PL5 A;  2QM7 A;  3L75 J;  1R8D A;  4XFJ A;  3Q2Y A;  1NVO A;  3MGN A;  1L4A D;  4B86 A;  1LNQ A;  1SFC C;  3F5H A;  4AYC A;  3CCJ P;  1BE3 D;  1Q0A A;  1Q2N A;  4JYB A;  2QJP B;  1EDK A;  2N9Y B;  5I41 B;  1SQP J;  1L0L D;  4PJ0 E;  1NO4 A;  3D71 A;  1VL2 A;  3MUD A;  3H1L D;  1T3U A;  4R4E A;  1M1J B;  2KZI A;  1G1I A;  4L75 A;  5KKZ B;  2W90 A;  1BGY G;  2QSI A;  1SQQ K;  3RGU A;  3U59 A;  2WPQ A;  2M3E A;  2C0W A;  3EZF A;  3R4Y A;  1NTZ D;  3R2P A;  1LT9 C;  5EFW B;  3L70 D;  3E1I A;  2N9B A;  2LR2 A;  1S5L E;  3CX5 E;  5KJ7 C;  4GOD A;  2YKQ A;  1BSN A;  1RQU A;  1S1C X;  3TF5 A;  1YHQ P;  1KIL E;  2Q6Q A;  1KTM A;  1NU1 J;  1LWU B;  2YKO A;  3AE9 C;  3L74 D;  3L73 D;  3NMD A;  4L74 A;  2QA4 P;  1SFC D;  2V7Q H;  3A0H E;  4U3F D;  2D2C C;  5H2F E;  1IO4 A;  1FDM A;  1NTZ K;  4BWN A;  2V4H A;  4QMA A;  1NGM B;  2AEF A;  5CMZ A;  3M9Q A;  1L4A B;  1DEE G;  3EZ9 A;  4JPZ B;  3CD6 P;  2O1J A;  5KLI B;  2A45 I;  1FZA A;  3L71 D;  1AV1 A;  1LTB C;  2W27 A;  4PD4 E;  3IN6 A;  3SFE C;  3H1K E;  5DJT B;  3V4Q A;  3L72 D;  3VMZ A;  4YXW H;  4WY4 B;  1E5W A;  1VQM P;  3CI9 A;  3H1K J;  3H1H G;  4ZNC A;  3EFF K;  1SQX E;  2N1T D;  2O01 J;  1J1D B;  1AVY A;  4CPG A;  1Q81 Q;  5D90 A;  2HPC B;  3VP9 A;  3RBZ A;  1T8Z A;  1SQV K;  3NTN A;  2JML A;  4W80 A;  2E43 A;  1DD4 A;  3HUS A;  2M5A B;  2B9B A;  2JEE A;  2L5G B;  1LTJ B;  2WT7 B;  3B49 A;  2FXO A;  1BGY E;  4HB1 A;  3BAS A;  4PV1 C;  4Y99 B;  2XU6 A;  1DX7 A;  2D2C D;  1PV3 A;  2PRR A;  3H1I E;  1BGY J;  2MKV A;  5TIS E;  2BOW A;  2OTJ P;  2W83 C;  2QJY C;  1K8A Q;  3RL0 D;  1YI2 P;  1SFC B;  1KYO D;  2QIW A;  3KPE A;  3M06 A;  1VQO P;  1EDI A;  2WPR A;  1NH4 A;  3CCL P;  2BCC G;  1L0N D;  2A45 H;  1PIX A;  4OWF A;  2RMZ A;  4KT0 J;  3AE4 C;  1AQ5 A;  3V2R A;  3GG2 A;  3E0H A;  2NRG A;  3OA7 A;  2M0B A;  1NAY A;  1BCC G;  1GU5 A;  1LTI C;  2CPS A;  1GW3 A;  4AUW A;  5AW1 B;  1LT9 B;  1HGV A;  1AQT A;  1ZR4 A;  1EQ7 A;  3AED C;  3VTP C;  2WQY C;  2OTL P;  1Q06 A;  1SLQ A;  2K9Y A;  2QM8 A;  2OYH C;  3H32 B;  4PV1 D;  5KLV E;  3EZ6 A;  1BDD A;  2GUS A;  2FYU D;  3CC4 P;  1E79 H;  1L0N K;  1YIJ P;  5AW3 B;  4DCK A;  5KLV J;  1N73 A;  3P7K A;  2D2C B;  3H1J G;  2RN0 A;  3O6Q A;  2JR8 A;  2Y0D A;  5APT A;  1JCC A;  1KQF B;  1PP9 E;  1FJP A;  2JWD A;  3OJA B;  3IF4 A;  5KAF H;  3P8C D;  3CWB D;  1WT6 A;  1HJ0 A;  5CCH C;  1IFP A;  1A02 J;  2QRX A;  4ZMD A;  4N6J A;  1JOC A;  2A06 D;  2FYU K;  2IDB A;  1FC2 C;  2IBZ G;  5APQ A;  3V5B A;  1NTK K;  2N1T A;  5AVQ B;  1KZU B;  2KNC A;  3BAT A;  3TGU E;  2WWW A;  2FFD A;  3EFG A;  1VQK P;  2ZJS E;  3UCS A;  3LUR A;  2H89 C;  3HD7 D;  3AEE C;  3KYQ A;  1N7L A;  4W7Z A;  4YXD C;  1FE6 A;  3CXH D;  4WB4 A;  2BCC J;  3C9I A;  5AW4 B;  3VYI A;  3A5T A;  1YJ9 P;  3EZ2 A;  3M9H A;  2Q5U A;  2C9N Y;  4PV1 B;  2Q7C A;  1FDI A;  1JM0 A;  4D6T D;  3JCU H;  1KD1 Q;  2K3R A;  2M3B A;  4UB6 E;  1BCC J;  2IEF A;  2QJY B;  2IFM A;  3AE8 C;  3WU2 H;  1URQ A;  4MN4 C;  5AVZ B;  1OIP A;  1RE3 A;  4K35 A;  2JO1 A;  1DIP A;  1N8R Q;  4Z1M H;  2H7H A;  1SQV G;  1QL1 A;  5GTH H;  1T3J A;  5AVT B;  4DOJ A;  4H0L D;  1PM6 A;  1FZC A;  1EC5 A;  3H1H D;  5BU8 B;  1SQQ E;  1NTM D;  1YIT P;  4C46 A;  3FWL A;  1Q86 Q;  2SPZ A;  3GMA A;  1ZR2 A;  2JDI H;  2YXR B;  3SWF A;  1VQ9 P;  3H1J J;  1SQQ J;  2KS1 A;  2Q3E A;  3D6Z A;  2E5T A;  2OYH B;  4TLF A;  3OW2 O;  3FGA D;  1QLE D;  1OZH A;  2IBZ E;  5APV A;  2HYN A;  2DW3 A;  2HOD A;  3H1L E;  1ZRT D;  3TNU B;  4C7N B;  3U1A A;  1JMM A;  3PLN A;  3V2P A;  3M0A A;  3AE3 C;  5E79 H;  1NTZ E;  1H8A A;  3CXH I;  3UIA A;  2Q9I A;  3L70 E;  2KI7 B;  4K3A A;  4EOT A;  1KB9 D;  3HRN A;  1JEK A;  1BDC A;  3CME P;  3CL3 D;  1GU4 A;  3AE7 C;  2KUB A;  1LP1 B;  4EDF A;  1Y8A A;  2HFE D;  3GK6 A;  1N7S D;  3HD7 A;  3L74 E;  3L73 E;  3D70 A;  1OXZ A;  3RK2 C;  3Q1M A;  4IL6 H;  1FOS E;  2WSE J;  2W6J H;  4U3F E;  2I1K A;  2WSF J;  3FXE A;  3CCS P;  1S3J A;  3BVH A;  3PJS K;  1YTZ T;  5KAW A;  3B5N C;  3P8M C;  1JBG A;  2ZXX A;  3BCC D;  1SS1 A;  2YNY A;  1CSB A;  3H1K G;  1TU3 F;  1SQV J;  3PH0 A;  4LLH A;  3LW5 H;  2E76 C;  3H25 A;  3CC2 P;  2B88 A;  1HJB A;  1PPJ D;  1SQB D;  1NKZ B;  1SQX G;  4JF7 A;  3KZI E;  2W6B A;  3KHU A;  3CXH H;  1T2K C;  2WVR A;  4WY4 D;  2WSC J;  1DEB A;  3E1R A;  1NJI Q;  4KHX A;  2C0X A;  1YQ3 C;  1AVO A;  2KXP B;  3SSU A;  2WPS A;  3H1I G;  3EQ2 A;  1S9K D;  3G71 P;  5GTH E;  1GZL A;  3AEC C;  1N7S B;  1Q08 A;  1CI6 B;  1SQB K;  3GF7 A;  1KC8 Q;  1KB9 I;  1IK7 A;  4OH8 B;  4UB8 H;  4YPC A;  1KYO E;  1L0L K;  1KFM A;  3L4F A;  4XA4 A;  2IX7 C;  3Q5P A;  5AVV B;  1ZXG A;  4HH2 A;  2E76 D;  1L0N E;  5KTB A;  3S4R A;  4BRY A;  1RQV A;  1OW8 A;  3FXD A;  3HE5 B;  3KQG A;  1M1J A;  2E74 C;  2Z5H A;  1T2K D;  3WUV A;  1Y6U A;  4HKZ H;  2FY8 A;  2AEJ A;  1RH6 A;  1S72 P;  2AXT H;  5KLV G;  5B5E H;  3G4S P;  3L75 D;  1NOH A;  1GL2 C;  5E79 E;  3WUU A;  2QG4 A;  1KIL C;  1X8Y A;  1ZOY C;  2J59 M;  2NPS A;  1LTT C;  4DT0 A;  4HYT B;  5KAX A;  2FYU E;  2QE7 H;  2OGU A;  5APU A;  1NTK E;  1RH5 B;  5KJ7 D;  4ZKU A;  1LWU A;  4YTP C;  1SQP D;  1URQ C;  1D7M A;  1EZV D;  1NTK J;  1RE3 C;  1YJW P;  1SQX J;  1AA0 A;  3I5C A;  4Y28 J;  2AXC A;  1KB9 H;  1PP9 G;  1RF1 C;  1BSH A;  2XKM A;  2KCU A;  2OYI C;  2PGD A;  5KAI H;  3V4W A;  3B5N B;  1SVF A;  2VZ4 A;  1FS0 E;  1L4A A;  3CWB E;  2R5D A;  1NYH A;  2E74 D;  1MKM A;  3T97 B;  5CHX A;  2A06 E;  4HJG H;  3RL0 g;  2E76 B;  2DG6 A;  3RBX A;  3CCR P;  3TGU G;  3H1I J;  3L35 A;  4N78 D;  4NPE A;  2YO2 A;  3FWN A;  2L91 A;  2KLV A;  1YJN P;  1K04 A;  1NU1 D;  1RE4 A;  4WY4 A;  5KCB A;  1GL2 D;  2E75 C;  3GHG C;  5GTI H;  1KIL D;  3KXD A;  1FOS F;  1MZ9 A;  1XTG B;  2HPC A;  3CXH E;  3CCE P;  4DJG A;  2M5A A;  1LTJ A;  2WT7 A;  1RHZ B;  4B0Y A;  1T6A A;  2R32 A;  1GD2 E;  4D6T E;  2R3S A;  4L73 A;  5CCG C;  1PZQ A;  3CC7 P;  1NU1 K;  1DH3 A;  2KOG A;  1VF5 C;  2P7J A;  4PD4 D;  2J5U A;  1SFC A;  2UWJ E;  1S2E A;  3H1K D;  2O1K A;  4ASV A;  4IFM A;  2XV5 A;  3M9B A;  2LXC B;  3SWY A;  2CPB A;  3P32 A;  2R3C A;  4RKU J;  1ZLL A;  2Y9Z A;  5AW6 B;  3RK3 C;  1SQQ G;  2KB7 P;  2E74 B;  1EZV I;  2LKM A;  2E75 D;  3HTK B;  4R4L A;  3G6E P;  1NTM E;  1WMK A;  1OMI A;  1K9M Q;  3Q3D A;  1U7M A;  1LT9 A;  1N2D C;  1Q05 A;  3GW6 A;  4KJM A;  1PP9 J;  1BGY D;  4IFF A;  1GL2 B;  4AYZ B;  2V7Q J;  1KIL B;  1ZW0 A;  5KJ7 A;  3CLQ A;  3II6 A;  1H89 A;  4IFD K;  2G8Y A;  1RF0 A;  3H32 A;  1IZN B;  2XZR A;  3H1L G;  5CCG D;  2RH0 A;  2WSF H;  1YTZ I;  5B5E E;  3VMX A;  5DJU B;  3CX5 I;  4A7P A;  3L37 A;  1R5S A;  1VQN P;  2XNX A;  1G2C B;  1K73 Q;  1FZE A;  2WSS H;  3MUD C;  1VF5 D;  1PGJ A;  3TGU J;  2E5Y A;  1NTZ G;  1FJK A;  1RF1 B;  3QH9 A;  3L70 G;  1PGO A;  1PFI A;  2OYI B;  1JTH B;  2P10 A;  3Q5S A;  1M56 D;  3RK3 D;  3BRV B;  1KB9 E;  4NPD A;  2ZT9 C;  3KDP B;  2BEQ D;  2WPV B;  1S4X A;  3HE4 A;  4H44 C;  3G9R A;  3L74 G;  3L73 G;  5CCH D;  4W7Y A;  1VQ7 P;  1IFD A;  4H13 C;  2KLU A;  2J58 A;  2E75 B;  3GHG B;  1Y9B A;  3I56 P;  2ZAE B;  4PD4 I;  3C1L A;  5AW0 B;  4U3F G;  5KLV D;  4GOF A;  2QJP C;  1USD A;  2K9J B;  4JYC A;  1VPC A;  4O9B A;  3S9O A;  1HTL C;  4WWI A;  2WTY A;  5GQQ A;  2KYV A;  1AJY A;  3GLM A;  2YMK A;  5B66 H;  3BCC E;  2KZJ A;  1MUU A;  2Z4E A;  3CX5 H;  1MFT A;  4R4M A;  3QAO A;  2E42 A;  2GA1 A;  4GKG A;  3R8K A;  2I8D A;  1BE3 E;  1PPJ E;  1SQB E;  1VF5 B;  4WBA A;  1JY3 O;  3AE1 C;  4IL6 X;  2NPS C;  1L0L E;  2ZT9 D;  3IFM A;  3VN0 A;  1BE3 J;  3IR9 A;  1H0T B;  3A0H H;  1WRG A;  4WLW A;  5H2F H;  1IK9 A;  1L0L J;  1YYC A;  2B87 B;  3RK3 B;  3OAK A;  1KV4 A;  4H13 D;  1LJ2 A;  1NTM K;  1KOR A;  3H1L J;  3BRT B;  3D6Y A;  2BCC D;  3HUS C;  2KIK A;  4LHF A;  2O3J A;  1N86 A;  1S9K E;  4I2L C;  4PD4 H;  5M1B A;  3EZ7 A;  1NTZ J;  2OQQ A;  2G3A A;  5AVY B;  1OW6 A;  2O01 H;  4DZO A;  1VDF A;  1BCC D;  1IFN A;  2Z5I A;  3L70 J;  5KAF E;  2OYH A;  2JP3 A;  4M3L A;  1IFJ A;  2IYO A;  1L0N G;  4I6M C;  3B8E B;  1VQP P;  2KP8 A;  1X9V A;  3CCV P;  1RE4 C;  1IFM A;  1Q90 D;  1M90 Q;  1OVV A;  4L76 A;  1OW7 A;  2IFN A;  4RO0 A;  3L74 J;  1JYH A;  2Q3I A;  3L73 J;  3VMA A;  2BEZ F;  2P67 A;  3TNU A;  1MFZ A;  4C7N A;  1NAF A;  3G3Z A;  1G1J A;  3TDK A;  5C39 A;  3I55 P;  1R8E A;  4U3F J;  1ZME C;  1OVR A;  5CBN A;  3MTU E;  3L71 E;  2QJK C;  1OFC X;  1YQ4 C;  5APY A;  1A02 F;  1LTJ C;  2ZYD A;  1LT1 A;  2XDJ A;  3PRJ A;  2M8R A;  3H1J D;  2ZT9 B;  1SQQ D;  2FYU G;  5CCH A;  3L72 E;  2HR3 A;  2QVA A;  1NTK G;  1U57 A;  4OVN F;  3L71 J;  4H44 B;  1NWQ A;  3U1C A;  3B4S A;  1RY3 A;  2LXB A;  4RJT A;  2PP6 A;  3B71 A;  3JCU E;  3IAO A;  1OVU A;  1P84 D;  3L72 J;  1LP1 A;  4H13 B;  5K5G B;  3MD0 A;  1SQP E;  1HF9 A;  4XE5 B;  1JY2 N;  3WU2 E;  1EZV E;  5KAT A;  2IBZ D;  1JUN A;  1N73 C;  1M7L A;  3GP4 A;  1PGQ A;  4BRY B;  3PHL A;  1JY3 N;  3RK2 D;  3CWB G;  3AEA C;  4JBZ A;  3O8Z A;  3MP7 B;  1LX8 A;  1NHL A;  1EDL A;  2A06 G;  3NFQ A;  3LID A;  1HH0 A;  5AVW B;  1MV8 A;  1BOW A;  3B5N D;  5APW A;  2OYO A;  4GOE A;  2P2U A;  1JY2 P;  2K37 A;  5B66 E;  4N78 E;  1W2B O;  1NU1 E;  2VRS A;  1HUC A;  3MHV A;  2N1T C;  2NPS B;  1JY3 P;  2JWA A;  4I7Z C;  4WVZ A;  1RF0 C;  3E7K A;  5BVZ A;  1QVG O;  2JJL A;  5E01 A;  2FFD C;  1QVF O;  2WMM A;  3AE5 C;  3TK1 A;  1LTG C;  2FXM A;  1L0N J;  1IFI A;  1W2E A;  3W67 A;  5BU5 A;  4A1M A;  2ZHG A;  4D6T G;  1IJD B;  4WLS A;  3HUS B;  2P58 A;  4GIF A;  4N3Y B;  1W5C E;  2GUV A;  1SQV D;  3WUT A;  1LTA C;  3VP8 A;  1VQ6 P;  5AW5 B;  3RL0 C;  1N7S A;  2MJZ A;  1CI6 A;  1ZP0 C;  4GDO A;  1FU1 A;  2P1J A;  2XND H;  3MIW A;  3R8J A;  1KN7 A;  5AVX B;  3CPW O;  4J2N A;  1U7J A;  1OWA A;  5AVS B;  5AW7 B;  3RK2 B;  2FYU J;  1Q07 A;  1P84 I;  3WMM 0;  1DD3 A;  1YBK A;  2FBW C;  1NTM G;  2POH A;  1FZG A;  1OX3 A;  2IBZ I;  2FYZ A;  2HVA A;  3HE5 A;  1XTC C;  2B89 A;  4IOI H;  4U7J A;  2R5B A;  4IL6 E;  2ZHH A;  1VQL P;  4EI2 A;  1Q82 Q;  1FZC C;  3P8C E;  1VQ4 P;  2QJK B;  5AW2 B;  1L2P A;  4UB6 H;  5AVU B;  2KK7 A;  5L8R J;  3CWB J;  3CX5 D;  1UIX A;  1SQP K;  2KSJ A;  1Y47 A;  1HWT C;  3VMY A;  3ABV C;  3AE2 C;  4LGD E;  1GTW A;  4JQ0 D;  4TT3 H;  1N73 B;  4NPF X;  1M57 D;  1SP4 A;  1JB0 J;  2W6A A;  3LW5 J;  1URQ D;  2NZ2 A;  3K5B A;  2YIU C;  1Z56 A;  1KQG B;  1GW4 A;  2IPP A;  3O6Q B;  1FAV A;  2H43 A;  2AEM A;  3B5N A;  3RK3 E;  1VQ8 P;  3JSV C;  1P84 H;  3M0D A;  2ZVO B;  2WIT A;  1Q7Y Q;  4D6T J;  1VQ5 P;  3T97 A;  3SWK A;  3CCU P;  1Q09 A;  2HG5 D;  1GK4 A;  3L36 A;  2YXQ B;  1JO5 A;  4EIJ A;  5CBO A;  3QWO C;  2C9L Y;  2Y0E A;  2N1T B;  4I7Z B;  2KNC B;  1FBM A;  3HD7 C;  4ASW A;  4UB8 E;  1J1E C;  2FFD B;  1NTK D;  2A45 G;  4AQR D;  1X22 A;  1SQX D;  1QL2 A;  3A7O A;  1EDJ A;  3BCC G;  5KAV A;  3H1H E;  1QGK B;  5CJ4 A;  1UII A;  2ZYA A;  2I1J A;  1H88 A;  3Q5R A;  3H1H J;  5APX A;  1BE3 G;  1PPJ G;  1NTM J;  1SQB G;  4BXL A;  3AEF C;  3SFD C;  2WZ7 A;  3A0B H;  3RL0 B;  1L0L G;  2JKV A;  2OAR A;  3CCQ P;  3H1I D;  3GPV A;  2WSE H;  2GM4 A;  3JC2 2;  2AXT E;  3HE4 B;  3A3Y B;  3VOP A;  2FYN C;  1URQ B;  5TJH A;  3LIE A;  3CMA P;  2H88 C;  1QX8 A;  1ZN5 A;  1J2J B;  1SQX K;  2ZXE B;  1ZRT E;  1KQL A;  1GK6 A;  2Y0C A;  1KMI Z;  1KYO I;  4LC1 A;  1S5L X;  4H0L C;  5APS A;  1CW5 A;  3NXS A;  2BCC E;  2BAS A;  3HTK A;  3W68 A;  3MZW B;  1FZC B;  1IC2 A;  3C8V A;  3EWK A;  1HVV A;  1PGP A;  3TSI A;  2IYP A;  5KAI E;  1BCC E;  2PAJ A;  4RES B;  4C7R A;  3HH0 A;  3KZI H;  2WSC H;  2K1A A;  4OGQ C;  1LTS C;  1GL2 A;  2KS1 B;  4AYZ A;  2ZYG A;  1KIL A;  2ZFC A;  4PJ0 H;  2YO3 A;  2IZ0 A;  5D8C A;  1GDT A;  3FX0 A;  1USE A;  3ITK A;  3V2Q A;  2HOD B;  1G2C A;  3PTZ A;  3N4X A;  5GTI E;  3H6P A;  3L71 G;  2YIU B;  1HGZ A;  1M1J C;  1RF1 A;  1JMB A;  5KKZ C;  1S5L H;  2OYI A;  3L75 G;  4GT1 A;  1JTH A;  1R5L A;  3L72 G;  2GOV A;  2YKP A;  1JY2 O;  2HLO A;  1JCD A;  2Q1K A;  1PP9 D;  3BCC J;  3H1J E;  1JNM A;  2KSE A;  1KYO H;  5AVR B;  3V2N A;  1SQP G;  2O01 N;  1N7S C;  5CJ0 A;  1NKN A;  5KLV K; 
#chains in the Genus database with same CATH homology
 3RK3 E;  3AEC C;  3R8J A;  4LHF A;  1Q08 A;  2WPV B;  4H44 C;  2QIW A;  2KCU A;  1S5L X;  4H0L C;  3G9R A;  1HJ0 A;  4J2N A;  2KVV A;  4H44 D;  3D70 A;  3GF7 A;  4H0L D;  2D2C C;  4R22 B;  1PM6 A;  5M1B A;  1IK7 A;  3EZ7 A;  3GP4 A;  4RKU J;  4OGQ B;  4OGQ D;  2VZ4 A;  3AEB C;  2OQQ A;  2G3A A;  4H13 C;  1PL5 A;  1PIX A;  2IDB A;  1Q09 A;  3Q1M A;  1OW6 A;  1EXJ A;  1R8D A;  1Q07 A;  1NYH A;  2E74 B;  2E74 D;  3AEG C;  4KT0 J;  2WSE J;  1NGM B;  1MKM A;  3AEA C;  3AE4 C;  2E75 B;  2E75 D;  3Q5P A;  3Q2Y A;  3C8V A;  3EWK A;  5I44 A;  1Y9B A;  2WSF J;  4R4L A;  3T97 B;  3GMA A;  1FDO A;  1DD3 A;  3EZ9 A;  3E0H A;  1LX8 A;  2E76 B;  2E76 D;  1WMK A;  2JP3 A;  2DG6 A;  3RL0 g;  5KAW A;  1Q0A A;  2FBW C;  2QJP C;  1EXI A;  1OMI A;  3D6Z A;  4I7Z B;  2HVA A;  3Q3D A;  4DCZ A;  1JBG A;  1BOW A;  3HH0 A;  3IN6 A;  3S9O A;  3UCS A;  4OGQ C;  1K04 A;  1RQV A;  3LUR A;  5I41 B;  4AYZ A;  2H89 C;  1OW8 A;  3FGA D;  3SFE C;  1VL2 A;  3D71 A;  1Q05 A;  4U7J A;  3AEE C;  5KCB A;  4XFJ A;  4R24 B;  5GQQ A;  2ZHH A;  1Q90 D;  1TU3 F;  2E74 C;  1AJY A;  4AYZ B;  1OW7 A;  4R4E A;  2E75 C;  3GLM A;  2V7Q J;  2FXP A;  2YMK A;  5D8C A;  3AED C;  4YXD C;  1Y6U A;  2WQY C;  1JYH A;  5KAV A;  2E76 C;  3H25 A;  5KLI C;  2BEZ F;  1Q06 A;  2G8Y A;  4R4M A;  2K9Y A;  4I7Z C;  1RH6 A;  3QAO A;  1K05 A;  2QSI A;  2O01 J;  3EZ2 A;  5L8R J;  4PV1 B;  4PV1 D;  5E01 A;  3EZF A;  1FDI A;  3R4Y A;  3R8K A;  1R8E A;  3EZ6 A;  2OG0 A;  1UIX A;  1ZME C;  3AE5 C;  5D90 A;  3Q5R A;  2QJK C;  2JML A;  1DD4 A;  1VF5 D;  1VF5 B;  1YQ4 C;  1ZOY C;  3AEF C;  3AE3 C;  3ABV C;  3AE6 C;  3AE2 C;  4B0Y A;  2WSC J;  3SFD C;  2IEF A;  3AE1 C;  4IL6 X;  5KAX A;  5KKZ C;  4A1M A;  2ZHG A;  2ZT9 B;  2ZT9 D;  3B49 A;  4WLS A;  3AE8 C;  1YQ3 C;  1U57 A;  3GPV A;  1RQU A;  2GOV A;  4H44 B;  4PV1 C;  1S1C X;  4TT3 H;  4H0L B;  1KIL E;  4YTP C;  2P10 A;  1D5Y A;  1JB0 J;  2FYN C;  3LW5 J;  2D2C B;  3Q5S A;  4WLW A;  1PV3 A;  2D2C D;  1KTM A;  2NZ2 A;  3B71 A;  1GMJ A;  3O6Q A;  3AE7 C;  3IAO A;  3AE9 C;  2YIU C;  2JO1 A;  1VF5 C;  2H88 C;  4H13 B;  4H13 D;  1KQG B;  1DIP A;  1KOR A;  3GF3 A;  2J5U A;  1ZRT E;  3D6Y A;  2MKV A;  1HF9 A;  5KAU A;  2BOW A;  1KQF B;  4Z1M H;  4Y28 J;  2ZT9 C;  2QJY C;  1ZP0 C;  4GDO A;  2BEQ D;  1KMI Z;  3GK6 A;  5KAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...