3D6ZA

Crystal structure of r275e mutant of bmrr bound to dna and rhodamine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
total genus 76
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d6zA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d6zA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d6zA03
5I41B 5GQQA 5D90A 3B49A 2JMLA 5KATA 3R8JA 1Q07A 1Q06A 1D5YA 5KAUA 3Q5SA 1JBGA 3GK6A 2ZHGA 4B0YA 1Q05A 4A1MA 5I44A 3UCSA 3G9RA 3Q2YA 5KAXA 2VZ4A 2J5UA 4R22B 3D71A 1DIPA 1JYHA 5KAWA 1R8DA 3GP4A 1Q08A 4R24B 3Q1MA 3D70A 3Q5RA 2DG6A 4WLWA 3R8KA 3QAOA 1R8EA 2OQQA 3HH0A 2HVAA 5KAVA 4R4MA 1Q0AA 2ZHHA 1EXIA 4R4EA 1Q09A 5E01A 3E0HA 3Q3DA 2BOWA 2KCUA 3LURA 3IAOA 4WLSA 5D8CA 3D6YA 4AYZA 2GOVA 1BOWA 4AYZB 5KCBA 3D6ZA 4R4LA 4J2NA 3Q5PA 3T97B 3GPVA 1EXJA
chains in the Genus database with same CATH superfamily
4D6TG 1SQBD 2YMYA 2YO3A 1T8ZA 4UB6E 3AE8C 1EQ7A 2O3JA 3I55P 2M8RA 4Y99C 1SQQE 3L70G 1M1JB 3L4FA 1K8AQ 2WMMA 3D6YA 1KILA 2YIUC 1VQKP 5GQQA 1NAYA 2J58A 4HYTB 1S5LE 2KIKA 5BVZA 1LTGC 1PP9J 2KI7B 2KZIA 2AEMA 1DX7A 3H1JE 3TDKA 4A7PA 4R4LA 1PGOA 4JYBA 4C7NA 1YBKA 5TISH 3C8VA 4WVZA 3D70A 1NAFA 4ASWA 4WY4A 3CCQP 3CLQA 2W27A 4ZKUA 4TLFA 2Q7CA 4J2NA 1YIJP 3CL3D 1T3UA 5AVSB 3M0DA 2FYUG 2KOGA 3B5NA 2P67A 3P32A 2R44A 2CPBA 3KYQA 3A5TA 1X22A 3CMEP 2P1JA 3NTNA 2QRXA 1KQFB 2D2CC 1EZVI 3KXDA 3CCSP 1T3JA 1CI6A 3HE4B 4EI2A 1Q86Q 1AQTA 1JTHA 2Q9IA 3R8JA 1JY3N 1P84E 1SQBE 4H44D 1SFCC 4UB8E 2HFED 1GL2A 2KCUA 3PP5A 1YQ4C 2OARA 3AE4C 3G71P 1LTJB 4Z1MH 3RL0g 5B66H 2IBZI 4PV1D 1BCCD 2K88A 4R4EA 3TGUD 2IBZD 3O6QA 3G6EP 3M0AA 4PD4D 1TU3F 4H13B 1PPJE 5KAXA 3H1ID 1FDOA 3CCEP 3IF4A 2N1TB 4XFJA 3D6ZA 1R5SA 3PTZA 1GDTA 3B5ND 1G1JA 3GHGA 2Z4EA 3SWFA 1NWQA 1YYCA 2WSFH 2UWJE 1IJDB 1J2JB 2E43A 2ZYDA 1EC5A 2WITA 2B88A 2IFMA 1SP4A 1S9KE 4DJGA 1VQ8P 1LT9C 1BGYG 2ZYGA 3P8CD 1S2EA 3H1LD 2R32A 1FE6A 2H88C 2N9BA 3V2RA 2KS1B 2AEJA 1NO4A 1EZVE 3SSUA 3S9OA 1OIPA 4WLWA 3ITKA 1GU5A 3OJAB 3L71D 3LIEA 1Q7YQ 3U59A 2ZT9B 1H0TB 2QEXP 2E75B 1NJIQ 4IFMA 2NPSD 2Y9ZA 2QVAA 1NTZG 3TNUA 3A7OA 1L0LG 5CCHC 3LIDA 2R5BA 2RKLA 3MUDC 1URQA 4H44B 1X8YA 2FBWC 1WMKA 2QJPC 4I7ZC 3EZ2A 2KSEA 2N9YB 1KILB 4GOFA 1SQQG 5AVUB 1QVFO 2OTLP 2IBZE 2LXCB 3Q5SA 1YHQP 3PJSK 3WMM0 4IL6H 1QEXA 3H1IE 4RJTA 1YQ3C 1RE3C 2ZHHA 3CCLP 5APWA 4WBAA 5GTHH 4PV1B 5KAIE 1NYHA 3R2PA 1PM6A 3R4YA 5CBOA 3L72J 4GODA 2HPCA 4JYCA 2K3RA 1N73C 1FZFA 2OYHC 4WY4B 1Q0AA 1E79H 2O1KA 1FZEA 5KLVK 3RK3E 1AVYA 1L4AC 2QJYB 5TISE 3L74D 3L75D 1SQXJ 1H88A 4XE5B 1YI2P 3B5NB 3UCSA 1GMJA 2PAJA 1RH6A 1LTSC 4L74A 1IFNA 1IFDA 1OVVA 2BEZF 2HYNA 2XU6A 2G8YA 2FYZA 4K35A 1CI6B 1JTHB 2ZFCA 2OYIB 2JKVA 2WSEJ 5KLIC 1ZN5A 4DOJA 2WZ7A 1PP9G 1JOCA 3L74J 3L75J 1GL2B 3IAOA 2KNCA 2V4HA 4IL6X 4W7YA 2V7QJ 4W80A 3EZ9A 4ASVA 1PGQA 5APUA 3GLMA 4R24B 2RH0A 1NTKK 1R8EA 1T2KD 3BCCJ 1SQXE 3Q3DA 2A45H 4QMAA 1VF5D 1FZAA 2WSCH 4GOEA 1BOWA 3O6QB 3A0HH 1M1KQ 3U1CA 1UIXA 5B66E 4BWNA 3Q2YA 2WVRA 1A02F 1L0NK 1BE3J 4U3FD 1N8RQ 3MGNA 1ZP0C 2WPQA 4CPGA 2OG0A 3VMXA 1PPJG 5E01A 1FZGA 2YMKA 4BRYA 3RK3C 3H25A 3KQGA 3HUSC 1S5LX 1AFOA 2C0WA 1VQ9P 3BATA 3II6A 1QVGO 3GHGB 5AVZB 2JO1A 3L74E 3D71A 3L75E 3L73J 2C9LY 2E76D 1GTWA 3E1IA 4BXLA 3A0BH 1FU1A 1VQNP 2GA1A 3CWBD 2XKMA 1JY2O 1SQVJ 4H0LC 3HTKA 3S1KA 1G2CA 3B8EB 3CCMP 1LT1A 2Z5IA 3FWLA 2LXBA 1BE3E 4K3AA 4AQRD 2ZYAA 2M5AA 2Q3EA 2KXPB 4IFFA 3TNUB 3H1KD 2QM8A 1OMIA 4N3YB 5KJ7C 3CCJP 5B5EH 1JB0J 5D8CA 4WB4A 1VQPP 2JEEA 4EOTA 2QJKC 5KLVD 5AVTB 1LTTC 5CCHA 5AVVB 4ZMDA 1RE4A 4LC1A 2AXCA 2K9JA 1NTMJ 4W7ZA 3VP9A 4U3FE 1SQVE 3OW2O 2A45I 1Y9BA 1Q2NA 2E5TA 1VF5B 2K1AA 3FXDA 1LTIC 5CCGA 2I1KA 1N7SA 3H1JJ 4IL6E 1GK6A 5AW7B 5APXA 2HPCB 3GG2A 2A06E 1LNQA 5GTHE 1SQPJ 1KYOD 3G4SP 1J1DC 1EXJA 5KAUA 3MTUE 1FZCA 1NU1G 2M3EA 4R22B 1N73A 1ZV8A 3CWBE 3CMAP 4KJMA 4PD4H 5AW8B 2W6AA 1NTKD 2E76B 3AE3C 3AECC 1DD4A 1L2PA 5GTIH 2B9BA 4H13D 5AW1B 2WSCJ 3K5BA 3NXSA 5KAIH 1NTME 4XA4A 1W2BO 1NU1K 2E74C 3KPEA 3VP8A 1OXZA 1JYHA 2FFDB 2Z5HA 1CW5A 1G1IA 3HH0A 2HVAA 1L0ND 2N1TD 3RL0C 2Q5UA 1SQBJ 4DCZA 1T2KC 1J1EC 2KNCB 5KCBA 3Q5PA 3CX5I 3AE2C 5APYA 1ZW0A 1SQPE 3P8MC 3CX5D 3L72G 3TF5A 3QAOA 1VQ5P 2WTYA 1RF1B 5CCGD 3T97A 1KQLA 3B49A 1SQXG 3CCRP 2Q6QA 3GF3A 1SLQA 4GIFA 2QIWA 3AEEC 3UIAA 2ZT9D 1M1JC 2E75D 4JQ0D 4RO0A 2H7HA 3A0HE 1VDFA 4BRYB 2FXPA 4OH8B 4RESB 3CPWO 2FYUK 1S72P 1JCDA 2OGUA 1GZLA 2KP8A 1KILD 3E0HA 1HJBA 3LURA 3HUSA 5BU5A 1QLED 1ZMEC 2C9NY 3VMYA 3HD7A 1K04A 1VQLP 1M8OB 3FGAD 3H1HD 2GUSA 3USSA 2AEFA 1JY3O 3BCCG 1X9VA 1G2CB 5C39A 2IZ1A 4PD4I 3A0BE 1YJ9P 1IFIA 1LTAC 1SVFA 2BEQD 1QL2A 1YTZT 2KLVA 3MZWB 1LWUA 4Y28J 4WY4D 2WWWA 1UIIA 4OGQB 1BE3G 1FOSF 2P7JA 2WT7A 1U7JA 3TK1A 4OWFA 5CJ0A 2RMZA 1RQUA 2XV5A 3IFMA 1QL1A 1BCCJ 5B5EE 1GK4A 5KJ7A 1MUUA 3TGUJ 3W67A 3L73G 2FYNB 2BOWA 3NFQA 1HH0A 3NMDA 4R4MA 5AVXB 1D5YA 3H1IJ 1PV3A 3QH9A 3CXHI 1N7SB 3G3ZA 4GT1A 4D6TD 1SQVG 5BU8B 1LTJC 3MP7B 3Q1MA 3Q5RA 4JBZA 1KFNA 3CXHD 1PFIA 1GL2D 1LJ2A 1USEA 4HJGH 3L70D 1N86A 4LGDE 1DEBA 4DT0A 3RK2D 2BCCG 1KILE 2A06G 2KVVA 2O01H 3AE1C 1JUNA 4H13C 1ZLLA 2VZ4A 1FZCB 1FZBA 3FXEA 3HE5A 4YPCA 4HKZH 3I56P 3H1LJ 2N1TC 4L75A 1BCCE 3TGUE 3IR9A 4LHFA 1X0TA 4TT3H 1NTZK 2WPVB 1L0LK 5L8RJ 3L71J 4PD4E 3RBZA 2CPSA 3CI9A 1NTMG 2LR2A 5GTIE 2QA4P 2QG4A 5KKZB 1EDIA 3N4XA 1SQQK 1FJPA 5EFWB 3V5BA 1KFMA 2P10A 3H1JG 4C7NB 1M90Q 1S1CX 1AA0A 2FYUD 1RF0C 2QE7H 2L5GB 1R5LA 1SQPG 2ZT9C 2OTJP 1FBMA 2E75C 3T97B 3A3YB 2KK7A 2K37A 2WPRA 3P8CE 4C7RA 2HODA 3H1LE 2XNXA 3M06A 5APTA 4D6TE 4H44C 3LW5H 5KAVA 2XDJA 1MKMA 1M7LA 2NRGA 2QSIA 2Q1KA 2ZVOB 3C9IA 1KILC 3PRJA 3L71E 1A02J 1OW7A 2ITAA 3OAKA 1URQD 2IYOA 2WQYC 3B4SA 2Y0DA 5AVRB 1SQBG 1KC8Q 4PV1C 2B87A 1YJNP 3ABVC 3M9HA 2YKOA 3HD7B 1W2EA 4B86A 3RK2B 4A1MA 1SFCA 2Y0EA 4PJ0H 5DJUB 1KQGB 1FJKA 4WY4C 2WSFJ 1FC2C 1KMIZ 3V2QA 1OX3A 2QJYC 1XTCC 3M0DC 3KZIE 3B5NC 1KYOH 5CJ4A 1LWUB 5CBNA 5KAFH 1HUCA 4C46A 1JM0A 3E1RA 3WUVA 4EYYQ 1IZNB 3BRTB 4M3LA 1U7MA 2VRSA 2SPZA 3BASA 5D90A 3JCUH 1KTMA 1BGYD 1JBGA 2O01J 5KAWA 2OYIC 1NGMB 2DG6A 1Q90D 1BSHA 3L36A 1GL2C 4HH2A 3EWKA 2IX7C 2WPSA 2LKMA 1LTBC 1FDIA 1OFCX 1ZR2A 4U3FJ 2L91A 4JPZB 5AW9B 2PFXA 3AEBC 2NPSC 1XTGB 2D2CD 1S3JA 1NTZD 3JSVC 1L0LD 1H8AA 1LT9A 4RKUJ 3WUTA 3CX5H 1EZVG 3E7KA 5I41B 1SQQD 1AQ5A 1MFTA 4LLHA 2G3AA 1VQ6P 4IFDK 3HE5B 1VQ4P 1URQB 1OVRA 2E42A 1RY3A 3CD6P 1ZR4A 1K05A 3CWBJ 1HF9A 2IDBA 3V2PA 2RN0A 3GHGC 4Y99B 1Q82Q 1W5CE 4I1LA 1BCCG 3MUDA 1YJWP 3TGUG 4WWIA 2IBZG 2R3SA 3PLNA 2YKQA 1KB9H 3LW5J 3M91A 1QX8A 1FDMA 2ZAEB 2YIUB 3AEFC 1DEEG 3H1IG 3H1KJ 1NHLA 2YO2A 2W6JH 3L37A 3AEGC 1OZHA 1KYOI 2JWDA 4GKGA 1RE3A 1LGHB 5KLVJ 3GPVA 3PHLA 4NPEA 2KS1A 1OW6A 1RF0A 3AE7C 3VMZA 2HODB 3HRNA 1P84I 2M0BA 2R3CA 2OYHA 3O8ZA 2FXOA 3H1LG 2YKPA 1PP9D 1P84D 1PGJA 1L4AA 4KHXA 5APQA 1NVOA 3GW6A 1FAVA 1AVOA 4OGQD 2H43A 2CK3H 1NKZB 3L71G 3GP4A 1KN7A 1IK9A 4YTPC 3MD0A 2AXTH 2M3BA 4JF7A 3H1KE 2D2CB 3FWNA 1DH3A 3GK6A 2B87B 5AW5B 1HWTC 2ZJSE 1VF5C 5CCHD 1RHZB 2H89C 3N7NA 5I44A 1VL2A 3VYIA 1SFCB 5KLVE 2JP3A 3VMAA 1IC2A 1EDLA 1NTKJ 3JC22 1HVVA 3C1LA 1PPJD 1LX8A 1N7SD 3RGUA 3CXHH 3WUUA 1E5WA 3WU2H 4PJ0E 1HGVA 3G9RA 2J5UA 1L0NJ 1R8DA 1T6AA 3CC4P 4AYCA 2PGDA 1LP1A 3I5CA 3BVHA 2E76C 1KB9I 3M9BA 2JJLA 1X79B 3MIWA 3AEAC 1Q07A 1KYOE 3KDPB 1SQXK 1KB9D 2NZ2A 5KAFE 1RQVA 1S9KD 3EZ6A 5AW3B 2FFDC 2W83C 4ZKPA 2P2UA 1L4AD 3L74G 1USDA 3QWOC 3JCUE 3L75G 1YITP 5KTBA 3RBXA 1EZVD 1KORA 1NTKE 1PP9E 4ZNCA 2OYIA 1EDJA 3HTKB 2KUBA 3KZIH 1N7LA 2IPPA 2Y0CA 1Y47A 2IFNA 1S4XA 1LT9B 1RF1C 4AYZA 3P7KA 1AJYA 1VQMP 1L0NE 2KB7P 3SFDC 4YXWH 1CSBA 2NPSA 3CC7P 1PGPA 2Q3IA 2M5AB 3V2NA 2IZ0A 2W8ZA 3CX5E 3VTPC 1BSNA 1KV4A 1FOSE 1ZRTD 1HGZA 1JO5A 5AW4B 1RH5B 3H1HJ 2WSEH 3H6PA 4DZOA 2WSSH 2QM7A 2GM4A 1JY2P 2K9JB 2V7QH 1MZ9A 1CZQA 2QJPB 4I7ZB 2KSJA 2P58A 5AW0B 2W90A 2JR8A 3GF7A 1FS0E 5APVA 4U3FG 1MV8A 2FXMA 2KYVA 1N2DC 3U1AA 3CCVP 3H32A 1KB9E 1NU1D 3RK3D 1Q81Q 5APSA 3EFGA 5E79H 3A2AA 3HD7D 1OWAA 5DJTB 3CC2P 4I2LC 3OA7A 2ZHGA 3SFEC 1QGKB 1ZOYC 1SQVK 3KHUA 4OGQC 1N73B 2OYHB 2DW3A 1EXIA 3H1HE 1MFZA 5K5GB 1JNMA 2J59M 3BRVB 1JMMA 3CWBG 1L4AB 1JCCA 4D6TJ 4H0LD 4GDOA 2PP6A 1NU1J 1PIXA 1WRGA 1IFPA 4HB1A 2Y9YA 1RE4C 2IEFA 2FYNC 3L70J 3FX0A 3R8KA 3L72D 3AE9C 3VN0A 1Q09A 1WT6A 4KT0J 1U57A 4NPDA 5H2FH 3L35A 1ZRTE 3H1KG 5CCGC 1N7SC 5KJ7D 2HLOA 3IN6A 1DD3A 1SQXD 2O1JA 2AXTE 1HBWA 5KLIB 1VQOP 1KZUB 1NTMK 1BDCA 3AE5C 1GW3A 2GOVA 5KLVG 5TJHA 2KZJA 1Y8AA 5AVQB 3V4QA 4UB6H 1FZCC 2C0XA 2ZXXA 5AW6B 1BDDA 1LP1B 2POHA 1SQPK 2H8PD 1NU1E 2ZXEB 3CXHE 1PZQA 3WU2E 1Q06A 2A45G 2FYUJ 3L70E 4B0YA 4EIJA 1HJ0A 1DIPA 3VOPA 2HR3A 1S5LH 2ZVNB 1M1JA 2KLUA 5KKZC 4O9BA 4WLSA 3RK3B 1ZXGA 3HUSB 3BCCD 5KATA 1HTLC 1Q05A 1JEKA 4L73A 3EZFA 1EDKA 2FFDA 4AUWA 1Q08A 1NTKG 3MHVA 5M1BA 1BE3D 1SQBK 3L72E 4AYZB 2OTKE 2K9YA 2E74D 2B89A 4MN4C 2NPSB 4H0LB 1OVUA 5CHXA 1L0NG 3RL0D 1NOHA 3W68A 2WT7B 2FYUE 1RF1A 3L73D 3F89A 2MJZA 1GW4A 1NKNA 3AE6C 1PL5A 3TSIA 4IOIH 2HG5D 3TYYA 1AV1A 3ZDMA 3B71A 1P84H 1K9MQ 5AW2B 1KD1Q 4NPFX 1SQVD 3V4WA 3S4RA 1JY2N 4YXDC 3F5HA 4UB8H 3HE4A 3EFFK 1JY3P 4N78D 2QJKB 3HD7C 4EDFA 1D7MA 4L76A 3RK2C 2BCCD 1Y6UA 2A06D 2MKVA 3H32B 2PRRA 1SS1A 1YTZI 1BGYJ 2JWAA 2OYOA 1M56D 1IFJA 1IK7A 1SFCD 3BCCE 2IYPA 1KQSO 1LTJA 1VPCA 1H89A 1LWUC 2BASA 2R5DA 2JDIH 3EQ2A 5E79E 1NH4A 1OW8A 2XZRA 1J1DB 2E5YA 1NTMD 2BCCJ 4OVNF 2W6BA 5CMZA 1M57D 3H1HG 2YNYA 1GD2E 3SWKA 1GU4A 2XNDH 1NTZJ 2YXRB 1L0LJ 3V6IA 3H1JD 4N6JA 2N1TA 1SQQJ 1SQPD 3L73E 1VQ7P 2I1JA 4DCKA 5AVYB 1IO4A 2E74B 3GMAA 2YXQB 1BGYE 1IFMA 2GUVA 2OQQA 3RL0B 1K73Q 2FY8A 5H2FE 1J1EB 3EZ7A 4I6MC 2JMLA 3PH0A 1JMBA 4N78E 3SWYA 3AEDC 2I8DA 2BCCE 2FKWB 1URQC 3M9QA 1H0TA 4U7JA 1NTZE 2O01N 1L0LE 3CCUP 1Z56A 5AVWB
chains in the Genus database with same CATH topology
5KATA 3B49A 4H0LD 1VF5B 2QJYC 3SFDC 1VF5C 3R8JA 4GDOA 1RQUA 2IDBA 2H89C 2H88C 1Q05A 1IK7A 3AE8C 2P10A 3GF3A 5I44A 3UCSA 1GMJA 1PIXA 1S1CX 1VL2A 2JO1A 4H44D 2QIWA 3EZFA 3D71A 1RH6A 1Q08A 3AEEC 2JP3A 3S9OA 2IEFA 2FYNC 4WLWA 3R8KA 2E76D 2ZT9D 5M1BA 3AE9C 2BEZF 2E75D 2G8YA 1OW8A 1Q09A 2ZT9B 2BOWA 3LW5J 2ZT9C 2KCUA 4KT0J 3D6YA 2E75B 4AYZB 2E75C 1YQ4C 2FXPA 1U57A 2K9YA 2YIUC 4R4MA 2E74D 1LX8A 1EXJA 3AEFC 3T97B 5D90A 1KTMA 5GQQA 1D5YA 1ZRTE 5KAUA 1JBGA 1PV3A 3AE4C 2O01J 3G9RA 4H0LB 2J5UA 3AEGC 4H0LC 4R22B 5KAWA 1R8DA 3IN6A 1DD3A 3RL0g 4Z1MH 3Q1MA 3Q5RA 1NGMB 2WSEJ 2DG6A 1Q90D 4H44B 5KLIC 4H44C 4PV1D 5KAVA 2FBWC 1WMKA 4R4EA 3AE5C 1MKMA 2QJPC 4I7ZB 4I7ZC 3EZ2A 2QSIA 3E0HA 3LURA 2E76B 3IAOA 3AE3C 2E76C 3AECC 4IL6X 1DD4A 2GOVA 1ZMEC 3EWKA 3O6QA 4R4LA 2V7QJ 1KILE 3AE6C 3GPVA 1PL5A 4H13D 2KVVA 3AEAC 3GF7A 1Q07A 1K04A 2WSCJ 1FDIA 1OW7A 3Q5SA 1TU3F 4H13B 2E74B 3EZ9A 3AE1C 2E74C 3B71A 2NZ2A 3C8VA 4H13C 5KAXA 2VZ4A 1OW6A 3GMAA 1FDOA 3AEBC 1JYHA 1RQVA 1Y9BA 3AE7C 3EZ6A 3FGAD 3GLMA 4R24B 3D70A 2D2CD 2WQYC 1OMIA 1R8EA 2OQQA 3HH0A 1YQ3C 2HVAA 1JB0J 2ZHHA 4YXDC 4RKUJ 3Q3DA 1VF5D 4DCZA 5D8CA 3EZ7A 4PV1B 4XFJA 1BOWA 4PV1C 5KCBA 3D6ZA 4J2NA 3Q5PA 3ABVC 5I41B 1NYHA 3AE2C 2JMLA 1Q06A 1KORA 2QJKC 1PM6A 2ZHGA 1UIXA 3R4YA 4LHFA 4B0YA 4A1MA 2BEQD 1HJ0A 1Y6UA 4OGQD 3Q2YA 4TT3H 2WPVB 3SFEC 1ZOYC 4Y28J 2G3AA 1DIPA 5L8RJ 3AEDC 3GP4A 2MKVA 4OGQB 4OGQC 1KQGB 3QAOA 1ZP0C 4YTPC 2OG0A 2WSFJ 1Q0AA 1EXIA 2D2CB 1KQFB 2D2CC 1KMIZ 5E01A 5KKZC 1K05A 4WLSA 2YMKA 4U7JA 4AYZA 3H25A 1AJYA 3RK3E 1S5LX 3GK6A 1HF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I41 B;  5GQQ A;  5D90 A;  3B49 A;  2JML A;  5KAT A;  3R8J A;  1Q07 A;  1Q06 A;  1D5Y A;  5KAU A;  3Q5S A;  1JBG A;  3GK6 A;  2ZHG A;  4B0Y A;  1Q05 A;  4A1M A;  5I44 A;  3UCS A;  3G9R A;  3Q2Y A;  5KAX A;  2VZ4 A;  2J5U A;  4R22 B;  3D71 A;  1DIP A;  1JYH A;  5KAW A;  1R8D A;  3GP4 A;  1Q08 A;  4R24 B;  3Q1M A;  3D70 A;  3Q5R A;  2DG6 A;  4WLW A;  3R8K A;  3QAO A;  1R8E A;  2OQQ A;  3HH0 A;  2HVA A;  5KAV A;  4R4M A;  1Q0A A;  2ZHH A;  1EXI A;  4R4E A;  1Q09 A;  5E01 A;  3E0H A;  3Q3D A;  2BOW A;  2KCU A;  3LUR A;  3IAO A;  4WLS A;  5D8C A;  3D6Y A;  4AYZ A;  2GOV A;  1BOW A;  4AYZ B;  5KCB A;  3D6Z A;  4R4L A;  4J2N A;  3Q5P A;  3T97 B;  3GPV A;  1EXJ A; 
#chains in the Genus database with same CATH topology
 4D6T G;  1SQB D;  2YMY A;  2YO3 A;  1T8Z A;  4UB6 E;  3AE8 C;  1EQ7 A;  2O3J A;  3I55 P;  2M8R A;  4Y99 C;  1SQQ E;  3L70 G;  1M1J B;  3L4F A;  1K8A Q;  2WMM A;  3D6Y A;  1KIL A;  2YIU C;  1VQK P;  5GQQ A;  1NAY A;  2J58 A;  4HYT B;  1S5L E;  2KIK A;  5BVZ A;  1LTG C;  1PP9 J;  2KI7 B;  2KZI A;  2AEM A;  1DX7 A;  3H1J E;  3TDK A;  4A7P A;  4R4L A;  1PGO A;  4JYB A;  4C7N A;  1YBK A;  5TIS H;  3C8V A;  4WVZ A;  3D70 A;  1NAF A;  4ASW A;  4WY4 A;  3CCQ P;  3CLQ A;  2W27 A;  4ZKU A;  4TLF A;  2Q7C A;  4J2N A;  1YIJ P;  3CL3 D;  1T3U A;  5AVS B;  3M0D A;  2FYU G;  2KOG A;  3B5N A;  2P67 A;  3P32 A;  2R44 A;  2CPB A;  3KYQ A;  3A5T A;  1X22 A;  3CME P;  2P1J A;  3NTN A;  2QRX A;  1KQF B;  2D2C C;  1EZV I;  3KXD A;  3CCS P;  1T3J A;  1CI6 A;  3HE4 B;  4EI2 A;  1Q86 Q;  1AQT A;  1JTH A;  2Q9I A;  3R8J A;  1JY3 N;  1P84 E;  1SQB E;  4H44 D;  1SFC C;  4UB8 E;  2HFE D;  1GL2 A;  2KCU A;  3PP5 A;  1YQ4 C;  2OAR A;  3AE4 C;  3G71 P;  1LTJ B;  4Z1M H;  3RL0 g;  5B66 H;  2IBZ I;  4PV1 D;  1BCC D;  2K88 A;  4R4E A;  3TGU D;  2IBZ D;  3O6Q A;  3G6E P;  3M0A A;  4PD4 D;  1TU3 F;  4H13 B;  1PPJ E;  5KAX A;  3H1I D;  1FDO A;  3CCE P;  3IF4 A;  2N1T B;  4XFJ A;  3D6Z A;  1R5S A;  3PTZ A;  1GDT A;  3B5N D;  1G1J A;  3GHG A;  2Z4E A;  3SWF A;  1NWQ A;  1YYC A;  2WSF H;  2UWJ E;  1IJD B;  1J2J B;  2E43 A;  2ZYD A;  1EC5 A;  2WIT A;  2B88 A;  2IFM A;  1SP4 A;  1S9K E;  4DJG A;  1VQ8 P;  1LT9 C;  1BGY G;  2ZYG A;  3P8C D;  1S2E A;  3H1L D;  2R32 A;  1FE6 A;  2H88 C;  2N9B A;  3V2R A;  2KS1 B;  2AEJ A;  1NO4 A;  1EZV E;  3SSU A;  3S9O A;  1OIP A;  4WLW A;  3ITK A;  1GU5 A;  3OJA B;  3L71 D;  3LIE A;  1Q7Y Q;  3U59 A;  2ZT9 B;  1H0T B;  2QEX P;  2E75 B;  1NJI Q;  4IFM A;  2NPS D;  2Y9Z A;  2QVA A;  1NTZ G;  3TNU A;  3A7O A;  1L0L G;  5CCH C;  3LID A;  2R5B A;  2RKL A;  3MUD C;  1URQ A;  4H44 B;  1X8Y A;  2FBW C;  1WMK A;  2QJP C;  4I7Z C;  3EZ2 A;  2KSE A;  2N9Y B;  1KIL B;  4GOF A;  1SQQ G;  5AVU B;  1QVF O;  2OTL P;  2IBZ E;  2LXC B;  3Q5S A;  1YHQ P;  3PJS K;  3WMM 0;  4IL6 H;  1QEX A;  3H1I E;  4RJT A;  1YQ3 C;  1RE3 C;  2ZHH A;  3CCL P;  5APW A;  4WBA A;  5GTH H;  4PV1 B;  5KAI E;  1NYH A;  3R2P A;  1PM6 A;  3R4Y A;  5CBO A;  3L72 J;  4GOD A;  2HPC A;  4JYC A;  2K3R A;  1N73 C;  1FZF A;  2OYH C;  4WY4 B;  1Q0A A;  1E79 H;  2O1K A;  1FZE A;  5KLV K;  3RK3 E;  1AVY A;  1L4A C;  2QJY B;  5TIS E;  3L74 D;  3L75 D;  1SQX J;  1H88 A;  4XE5 B;  1YI2 P;  3B5N B;  3UCS A;  1GMJ A;  2PAJ A;  1RH6 A;  1LTS C;  4L74 A;  1IFN A;  1IFD A;  1OVV A;  2BEZ F;  2HYN A;  2XU6 A;  2G8Y A;  2FYZ A;  4K35 A;  1CI6 B;  1JTH B;  2ZFC A;  2OYI B;  2JKV A;  2WSE J;  5KLI C;  1ZN5 A;  4DOJ A;  2WZ7 A;  1PP9 G;  1JOC A;  3L74 J;  3L75 J;  1GL2 B;  3IAO A;  2KNC A;  2V4H A;  4IL6 X;  4W7Y A;  2V7Q J;  4W80 A;  3EZ9 A;  4ASV A;  1PGQ A;  5APU A;  3GLM A;  4R24 B;  2RH0 A;  1NTK K;  1R8E A;  1T2K D;  3BCC J;  1SQX E;  3Q3D A;  2A45 H;  4QMA A;  1VF5 D;  1FZA A;  2WSC H;  4GOE A;  1BOW A;  3O6Q B;  3A0H H;  1M1K Q;  3U1C A;  1UIX A;  5B66 E;  4BWN A;  3Q2Y A;  2WVR A;  1A02 F;  1L0N K;  1BE3 J;  4U3F D;  1N8R Q;  3MGN A;  1ZP0 C;  2WPQ A;  4CPG A;  2OG0 A;  3VMX A;  1PPJ G;  5E01 A;  1FZG A;  2YMK A;  4BRY A;  3RK3 C;  3H25 A;  3KQG A;  3HUS C;  1S5L X;  1AFO A;  2C0W A;  1VQ9 P;  3BAT A;  3II6 A;  1QVG O;  3GHG B;  5AVZ B;  2JO1 A;  3L74 E;  3D71 A;  3L75 E;  3L73 J;  2C9L Y;  2E76 D;  1GTW A;  3E1I A;  4BXL A;  3A0B H;  1FU1 A;  1VQN P;  2GA1 A;  3CWB D;  2XKM A;  1JY2 O;  1SQV J;  4H0L C;  3HTK A;  3S1K A;  1G2C A;  3B8E B;  3CCM P;  1LT1 A;  2Z5I A;  3FWL A;  2LXB A;  1BE3 E;  4K3A A;  4AQR D;  2ZYA A;  2M5A A;  2Q3E A;  2KXP B;  4IFF A;  3TNU B;  3H1K D;  2QM8 A;  1OMI A;  4N3Y B;  5KJ7 C;  3CCJ P;  5B5E H;  1JB0 J;  5D8C A;  4WB4 A;  1VQP P;  2JEE A;  4EOT A;  2QJK C;  5KLV D;  5AVT B;  1LTT C;  5CCH A;  5AVV B;  4ZMD A;  1RE4 A;  4LC1 A;  2AXC A;  2K9J A;  1NTM J;  4W7Z A;  3VP9 A;  4U3F E;  1SQV E;  3OW2 O;  2A45 I;  1Y9B A;  1Q2N A;  2E5T A;  1VF5 B;  2K1A A;  3FXD A;  1LTI C;  5CCG A;  2I1K A;  1N7S A;  3H1J J;  4IL6 E;  1GK6 A;  5AW7 B;  5APX A;  2HPC B;  3GG2 A;  2A06 E;  1LNQ A;  5GTH E;  1SQP J;  1KYO D;  3G4S P;  1J1D C;  1EXJ A;  5KAU A;  3MTU E;  1FZC A;  1NU1 G;  2M3E A;  4R22 B;  1N73 A;  1ZV8 A;  3CWB E;  3CMA P;  4KJM A;  4PD4 H;  5AW8 B;  2W6A A;  1NTK D;  2E76 B;  3AE3 C;  3AEC C;  1DD4 A;  1L2P A;  5GTI H;  2B9B A;  4H13 D;  5AW1 B;  2WSC J;  3K5B A;  3NXS A;  5KAI H;  1NTM E;  4XA4 A;  1W2B O;  1NU1 K;  2E74 C;  3KPE A;  3VP8 A;  1OXZ A;  1JYH A;  2FFD B;  2Z5H A;  1CW5 A;  1G1I A;  3HH0 A;  2HVA A;  1L0N D;  2N1T D;  3RL0 C;  2Q5U A;  1SQB J;  4DCZ A;  1T2K C;  1J1E C;  2KNC B;  5KCB A;  3Q5P A;  3CX5 I;  3AE2 C;  5APY A;  1ZW0 A;  1SQP E;  3P8M C;  3CX5 D;  3L72 G;  3TF5 A;  3QAO A;  1VQ5 P;  2WTY A;  1RF1 B;  5CCG D;  3T97 A;  1KQL A;  3B49 A;  1SQX G;  3CCR P;  2Q6Q A;  3GF3 A;  1SLQ A;  4GIF A;  2QIW A;  3AEE C;  3UIA A;  2ZT9 D;  1M1J C;  2E75 D;  4JQ0 D;  4RO0 A;  2H7H A;  3A0H E;  1VDF A;  4BRY B;  2FXP A;  4OH8 B;  4RES B;  3CPW O;  2FYU K;  1S72 P;  1JCD A;  2OGU A;  1GZL A;  2KP8 A;  1KIL D;  3E0H A;  1HJB A;  3LUR A;  3HUS A;  5BU5 A;  1QLE D;  1ZME C;  2C9N Y;  3VMY A;  3HD7 A;  1K04 A;  1VQL P;  1M8O B;  3FGA D;  3H1H D;  2GUS A;  3USS A;  2AEF A;  1JY3 O;  3BCC G;  1X9V A;  1G2C B;  5C39 A;  2IZ1 A;  4PD4 I;  3A0B E;  1YJ9 P;  1IFI A;  1LTA C;  1SVF A;  2BEQ D;  1QL2 A;  1YTZ T;  2KLV A;  3MZW B;  1LWU A;  4Y28 J;  4WY4 D;  2WWW A;  1UII A;  4OGQ B;  1BE3 G;  1FOS F;  2P7J A;  2WT7 A;  1U7J A;  3TK1 A;  4OWF A;  5CJ0 A;  2RMZ A;  1RQU A;  2XV5 A;  3IFM A;  1QL1 A;  1BCC J;  5B5E E;  1GK4 A;  5KJ7 A;  1MUU A;  3TGU J;  3W67 A;  3L73 G;  2FYN B;  2BOW A;  3NFQ A;  1HH0 A;  3NMD A;  4R4M A;  5AVX B;  1D5Y A;  3H1I J;  1PV3 A;  3QH9 A;  3CXH I;  1N7S B;  3G3Z A;  4GT1 A;  4D6T D;  1SQV G;  5BU8 B;  1LTJ C;  3MP7 B;  3Q1M A;  3Q5R A;  4JBZ A;  1KFN A;  3CXH D;  1PFI A;  1GL2 D;  1LJ2 A;  1USE A;  4HJG H;  3L70 D;  1N86 A;  4LGD E;  1DEB A;  4DT0 A;  3RK2 D;  2BCC G;  1KIL E;  2A06 G;  2KVV A;  2O01 H;  3AE1 C;  1JUN A;  4H13 C;  1ZLL A;  2VZ4 A;  1FZC B;  1FZB A;  3FXE A;  3HE5 A;  4YPC A;  4HKZ H;  3I56 P;  3H1L J;  2N1T C;  4L75 A;  1BCC E;  3TGU E;  3IR9 A;  4LHF A;  1X0T A;  4TT3 H;  1NTZ K;  2WPV B;  1L0L K;  5L8R J;  3L71 J;  4PD4 E;  3RBZ A;  2CPS A;  3CI9 A;  1NTM G;  2LR2 A;  5GTI E;  2QA4 P;  2QG4 A;  5KKZ B;  1EDI A;  3N4X A;  1SQQ K;  1FJP A;  5EFW B;  3V5B A;  1KFM A;  2P10 A;  3H1J G;  4C7N B;  1M90 Q;  1S1C X;  1AA0 A;  2FYU D;  1RF0 C;  2QE7 H;  2L5G B;  1R5L A;  1SQP G;  2ZT9 C;  2OTJ P;  1FBM A;  2E75 C;  3T97 B;  3A3Y B;  2KK7 A;  2K37 A;  2WPR A;  3P8C E;  4C7R A;  2HOD A;  3H1L E;  2XNX A;  3M06 A;  5APT A;  4D6T E;  4H44 C;  3LW5 H;  5KAV A;  2XDJ A;  1MKM A;  1M7L A;  2NRG A;  2QSI A;  2Q1K A;  2ZVO B;  3C9I A;  1KIL C;  3PRJ A;  3L71 E;  1A02 J;  1OW7 A;  2ITA A;  3OAK A;  1URQ D;  2IYO A;  2WQY C;  3B4S A;  2Y0D A;  5AVR B;  1SQB G;  1KC8 Q;  4PV1 C;  2B87 A;  1YJN P;  3ABV C;  3M9H A;  2YKO A;  3HD7 B;  1W2E A;  4B86 A;  3RK2 B;  4A1M A;  1SFC A;  2Y0E A;  4PJ0 H;  5DJU B;  1KQG B;  1FJK A;  4WY4 C;  2WSF J;  1FC2 C;  1KMI Z;  3V2Q A;  1OX3 A;  2QJY C;  1XTC C;  3M0D C;  3KZI E;  3B5N C;  1KYO H;  5CJ4 A;  1LWU B;  5CBN A;  5KAF H;  1HUC A;  4C46 A;  1JM0 A;  3E1R A;  3WUV A;  4EYY Q;  1IZN B;  3BRT B;  4M3L A;  1U7M A;  2VRS A;  2SPZ A;  3BAS A;  5D90 A;  3JCU H;  1KTM A;  1BGY D;  1JBG A;  2O01 J;  5KAW A;  2OYI C;  1NGM B;  2DG6 A;  1Q90 D;  1BSH A;  3L36 A;  1GL2 C;  4HH2 A;  3EWK A;  2IX7 C;  2WPS A;  2LKM A;  1LTB C;  1FDI A;  1OFC X;  1ZR2 A;  4U3F J;  2L91 A;  4JPZ B;  5AW9 B;  2PFX A;  3AEB C;  2NPS C;  1XTG B;  2D2C D;  1S3J A;  1NTZ D;  3JSV C;  1L0L D;  1H8A A;  1LT9 A;  4RKU J;  3WUT A;  3CX5 H;  1EZV G;  3E7K A;  5I41 B;  1SQQ D;  1AQ5 A;  1MFT A;  4LLH A;  2G3A A;  1VQ6 P;  4IFD K;  3HE5 B;  1VQ4 P;  1URQ B;  1OVR A;  2E42 A;  1RY3 A;  3CD6 P;  1ZR4 A;  1K05 A;  3CWB J;  1HF9 A;  2IDB A;  3V2P A;  2RN0 A;  3GHG C;  4Y99 B;  1Q82 Q;  1W5C E;  4I1L A;  1BCC G;  3MUD A;  1YJW P;  3TGU G;  4WWI A;  2IBZ G;  2R3S A;  3PLN A;  2YKQ A;  1KB9 H;  3LW5 J;  3M91 A;  1QX8 A;  1FDM A;  2ZAE B;  2YIU B;  3AEF C;  1DEE G;  3H1I G;  3H1K J;  1NHL A;  2YO2 A;  2W6J H;  3L37 A;  3AEG C;  1OZH A;  1KYO I;  2JWD A;  4GKG A;  1RE3 A;  1LGH B;  5KLV J;  3GPV A;  3PHL A;  4NPE A;  2KS1 A;  1OW6 A;  1RF0 A;  3AE7 C;  3VMZ A;  2HOD B;  3HRN A;  1P84 I;  2M0B A;  2R3C A;  2OYH A;  3O8Z A;  2FXO A;  3H1L G;  2YKP A;  1PP9 D;  1P84 D;  1PGJ A;  1L4A A;  4KHX A;  5APQ A;  1NVO A;  3GW6 A;  1FAV A;  1AVO A;  4OGQ D;  2H43 A;  2CK3 H;  1NKZ B;  3L71 G;  3GP4 A;  1KN7 A;  1IK9 A;  4YTP C;  3MD0 A;  2AXT H;  2M3B A;  4JF7 A;  3H1K E;  2D2C B;  3FWN A;  1DH3 A;  3GK6 A;  2B87 B;  5AW5 B;  1HWT C;  2ZJS E;  1VF5 C;  5CCH D;  1RHZ B;  2H89 C;  3N7N A;  5I44 A;  1VL2 A;  3VYI A;  1SFC B;  5KLV E;  2JP3 A;  3VMA A;  1IC2 A;  1EDL A;  1NTK J;  3JC2 2;  1HVV A;  3C1L A;  1PPJ D;  1LX8 A;  1N7S D;  3RGU A;  3CXH H;  3WUU A;  1E5W A;  3WU2 H;  4PJ0 E;  1HGV A;  3G9R A;  2J5U A;  1L0N J;  1R8D A;  1T6A A;  3CC4 P;  4AYC A;  2PGD A;  1LP1 A;  3I5C A;  3BVH A;  2E76 C;  1KB9 I;  3M9B A;  2JJL A;  1X79 B;  3MIW A;  3AEA C;  1Q07 A;  1KYO E;  3KDP B;  1SQX K;  1KB9 D;  2NZ2 A;  5KAF E;  1RQV A;  1S9K D;  3EZ6 A;  5AW3 B;  2FFD C;  2W83 C;  4ZKP A;  2P2U A;  1L4A D;  3L74 G;  1USD A;  3QWO C;  3JCU E;  3L75 G;  1YIT P;  5KTB A;  3RBX A;  1EZV D;  1KOR A;  1NTK E;  1PP9 E;  4ZNC A;  2OYI A;  1EDJ A;  3HTK B;  2KUB A;  3KZI H;  1N7L A;  2IPP A;  2Y0C A;  1Y47 A;  2IFN A;  1S4X A;  1LT9 B;  1RF1 C;  4AYZ A;  3P7K A;  1AJY A;  1VQM P;  1L0N E;  2KB7 P;  3SFD C;  4YXW H;  1CSB A;  2NPS A;  3CC7 P;  1PGP A;  2Q3I A;  2M5A B;  3V2N A;  2IZ0 A;  2W8Z A;  3CX5 E;  3VTP C;  1BSN A;  1KV4 A;  1FOS E;  1ZRT D;  1HGZ A;  1JO5 A;  5AW4 B;  1RH5 B;  3H1H J;  2WSE H;  3H6P A;  4DZO A;  2WSS H;  2QM7 A;  2GM4 A;  1JY2 P;  2K9J B;  2V7Q H;  1MZ9 A;  1CZQ A;  2QJP B;  4I7Z B;  2KSJ A;  2P58 A;  5AW0 B;  2W90 A;  2JR8 A;  3GF7 A;  1FS0 E;  5APV A;  4U3F G;  1MV8 A;  2FXM A;  2KYV A;  1N2D C;  3U1A A;  3CCV P;  3H32 A;  1KB9 E;  1NU1 D;  3RK3 D;  1Q81 Q;  5APS A;  3EFG A;  5E79 H;  3A2A A;  3HD7 D;  1OWA A;  5DJT B;  3CC2 P;  4I2L C;  3OA7 A;  2ZHG A;  3SFE C;  1QGK B;  1ZOY C;  1SQV K;  3KHU A;  4OGQ C;  1N73 B;  2OYH B;  2DW3 A;  1EXI A;  3H1H E;  1MFZ A;  5K5G B;  1JNM A;  2J59 M;  3BRV B;  1JMM A;  3CWB G;  1L4A B;  1JCC A;  4D6T J;  4H0L D;  4GDO A;  2PP6 A;  1NU1 J;  1PIX A;  1WRG A;  1IFP A;  4HB1 A;  2Y9Y A;  1RE4 C;  2IEF A;  2FYN C;  3L70 J;  3FX0 A;  3R8K A;  3L72 D;  3AE9 C;  3VN0 A;  1Q09 A;  1WT6 A;  4KT0 J;  1U57 A;  4NPD A;  5H2F H;  3L35 A;  1ZRT E;  3H1K G;  5CCG C;  1N7S C;  5KJ7 D;  2HLO A;  3IN6 A;  1DD3 A;  1SQX D;  2O1J A;  2AXT E;  1HBW A;  5KLI B;  1VQO P;  1KZU B;  1NTM K;  1BDC A;  3AE5 C;  1GW3 A;  2GOV A;  5KLV G;  5TJH A;  2KZJ A;  1Y8A A;  5AVQ B;  3V4Q A;  4UB6 H;  1FZC C;  2C0X A;  2ZXX A;  5AW6 B;  1BDD A;  1LP1 B;  2POH A;  1SQP K;  2H8P D;  1NU1 E;  2ZXE B;  3CXH E;  1PZQ A;  3WU2 E;  1Q06 A;  2A45 G;  2FYU J;  3L70 E;  4B0Y A;  4EIJ A;  1HJ0 A;  1DIP A;  3VOP A;  2HR3 A;  1S5L H;  2ZVN B;  1M1J A;  2KLU A;  5KKZ C;  4O9B A;  4WLS A;  3RK3 B;  1ZXG A;  3HUS B;  3BCC D;  5KAT A;  1HTL C;  1Q05 A;  1JEK A;  4L73 A;  3EZF A;  1EDK A;  2FFD A;  4AUW A;  1Q08 A;  1NTK G;  3MHV A;  5M1B A;  1BE3 D;  1SQB K;  3L72 E;  4AYZ B;  2OTK E;  2K9Y A;  2E74 D;  2B89 A;  4MN4 C;  2NPS B;  4H0L B;  1OVU A;  5CHX A;  1L0N G;  3RL0 D;  1NOH A;  3W68 A;  2WT7 B;  2FYU E;  1RF1 A;  3L73 D;  3F89 A;  2MJZ A;  1GW4 A;  1NKN A;  3AE6 C;  1PL5 A;  3TSI A;  4IOI H;  2HG5 D;  3TYY A;  1AV1 A;  3ZDM A;  3B71 A;  1P84 H;  1K9M Q;  5AW2 B;  1KD1 Q;  4NPF X;  1SQV D;  3V4W A;  3S4R A;  1JY2 N;  4YXD C;  3F5H A;  4UB8 H;  3HE4 A;  3EFF K;  1JY3 P;  4N78 D;  2QJK B;  3HD7 C;  4EDF A;  1D7M A;  4L76 A;  3RK2 C;  2BCC D;  1Y6U A;  2A06 D;  2MKV A;  3H32 B;  2PRR A;  1SS1 A;  1YTZ I;  1BGY J;  2JWA A;  2OYO A;  1M56 D;  1IFJ A;  1IK7 A;  1SFC D;  3BCC E;  2IYP A;  1KQS O;  1LTJ A;  1VPC A;  1H89 A;  1LWU C;  2BAS A;  2R5D A;  2JDI H;  3EQ2 A;  5E79 E;  1NH4 A;  1OW8 A;  2XZR A;  1J1D B;  2E5Y A;  1NTM D;  2BCC J;  4OVN F;  2W6B A;  5CMZ A;  1M57 D;  3H1H G;  2YNY A;  1GD2 E;  3SWK A;  1GU4 A;  2XND H;  1NTZ J;  2YXR B;  1L0L J;  3V6I A;  3H1J D;  4N6J A;  2N1T A;  1SQQ J;  1SQP D;  3L73 E;  1VQ7 P;  2I1J A;  4DCK A;  5AVY B;  1IO4 A;  2E74 B;  3GMA A;  2YXQ B;  1BGY E;  1IFM A;  2GUV A;  2OQQ A;  3RL0 B;  1K73 Q;  2FY8 A;  5H2F E;  1J1E B;  3EZ7 A;  4I6M C;  2JML A;  3PH0 A;  1JMB A;  4N78 E;  3SWY A;  3AED C;  2I8D A;  2BCC E;  2FKW B;  1URQ C;  3M9Q A;  1H0T A;  4U7J A;  1NTZ E;  2O01 N;  1L0L E;  3CCU P;  1Z56 A;  5AVW B; 
#chains in the Genus database with same CATH homology
 5KAT A;  3B49 A;  4H0L D;  1VF5 B;  2QJY C;  3SFD C;  1VF5 C;  3R8J A;  4GDO A;  1RQU A;  2IDB A;  2H89 C;  2H88 C;  1Q05 A;  1IK7 A;  3AE8 C;  2P10 A;  3GF3 A;  5I44 A;  3UCS A;  1GMJ A;  1PIX A;  1S1C X;  1VL2 A;  2JO1 A;  4H44 D;  2QIW A;  3EZF A;  3D71 A;  1RH6 A;  1Q08 A;  3AEE C;  2JP3 A;  3S9O A;  2IEF A;  2FYN C;  4WLW A;  3R8K A;  2E76 D;  2ZT9 D;  5M1B A;  3AE9 C;  2BEZ F;  2E75 D;  2G8Y A;  1OW8 A;  1Q09 A;  2ZT9 B;  2BOW A;  3LW5 J;  2ZT9 C;  2KCU A;  4KT0 J;  3D6Y A;  2E75 B;  4AYZ B;  2E75 C;  1YQ4 C;  2FXP A;  1U57 A;  2K9Y A;  2YIU C;  4R4M A;  2E74 D;  1LX8 A;  1EXJ A;  3AEF C;  3T97 B;  5D90 A;  1KTM A;  5GQQ A;  1D5Y A;  1ZRT E;  5KAU A;  1JBG A;  1PV3 A;  3AE4 C;  2O01 J;  3G9R A;  4H0L B;  2J5U A;  3AEG C;  4H0L C;  4R22 B;  5KAW A;  1R8D A;  3IN6 A;  1DD3 A;  3RL0 g;  4Z1M H;  3Q1M A;  3Q5R A;  1NGM B;  2WSE J;  2DG6 A;  1Q90 D;  4H44 B;  5KLI C;  4H44 C;  4PV1 D;  5KAV A;  2FBW C;  1WMK A;  4R4E A;  3AE5 C;  1MKM A;  2QJP C;  4I7Z B;  4I7Z C;  3EZ2 A;  2QSI A;  3E0H A;  3LUR A;  2E76 B;  3IAO A;  3AE3 C;  2E76 C;  3AEC C;  4IL6 X;  1DD4 A;  2GOV A;  1ZME C;  3EWK A;  3O6Q A;  4R4L A;  2V7Q J;  1KIL E;  3AE6 C;  3GPV A;  1PL5 A;  4H13 D;  2KVV A;  3AEA C;  3GF7 A;  1Q07 A;  1K04 A;  2WSC J;  1FDI A;  1OW7 A;  3Q5S A;  1TU3 F;  4H13 B;  2E74 B;  3EZ9 A;  3AE1 C;  2E74 C;  3B71 A;  2NZ2 A;  3C8V A;  4H13 C;  5KAX A;  2VZ4 A;  1OW6 A;  3GMA A;  1FDO A;  3AEB C;  1JYH A;  1RQV A;  1Y9B A;  3AE7 C;  3EZ6 A;  3FGA D;  3GLM A;  4R24 B;  3D70 A;  2D2C D;  2WQY C;  1OMI A;  1R8E A;  2OQQ A;  3HH0 A;  1YQ3 C;  2HVA A;  1JB0 J;  2ZHH A;  4YXD C;  4RKU J;  3Q3D A;  1VF5 D;  4DCZ A;  5D8C A;  3EZ7 A;  4PV1 B;  4XFJ A;  1BOW A;  4PV1 C;  5KCB A;  3D6Z A;  4J2N A;  3Q5P A;  3ABV C;  5I41 B;  1NYH A;  3AE2 C;  2JML A;  1Q06 A;  1KOR A;  2QJK C;  1PM6 A;  2ZHG A;  1UIX A;  3R4Y A;  4LHF A;  4B0Y A;  4A1M A;  2BEQ D;  1HJ0 A;  1Y6U A;  4OGQ D;  3Q2Y A;  4TT3 H;  2WPV B;  3SFE C;  1ZOY C;  4Y28 J;  2G3A A;  1DIP A;  5L8R J;  3AED C;  3GP4 A;  2MKV A;  4OGQ B;  4OGQ C;  1KQG B;  3QAO A;  1ZP0 C;  4YTP C;  2OG0 A;  2WSF J;  1Q0A A;  1EXI A;  2D2C B;  1KQF B;  2D2C C;  1KMI Z;  5E01 A;  5KKZ C;  1K05 A;  4WLS A;  2YMK A;  4U7J A;  4AYZ A;  3H25 A;  1AJY A;  3RK3 E;  1S5L X;  3GK6 A;  1HF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...