3D6ZA

Crystal structure of r275e mutant of bmrr bound to dna and rhodamine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
total genus 76
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d6zA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d6zA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d6zA03
3GPVA 3G9RA 2VZ4A 3QAOA 5E01A 3UCSA 1JYHA 5GQQA 3Q2YA 2GOVA 2DG6A 3Q3DA 3R8JA 4R24B 3Q5RA 1BOWA 4WLSA 3HH0A 2KCUA 3D70A 5KAVA 4R4EA 3Q5SA 5D90A 5I41B 5KAWA 2BOWA 3E0HA 4AYZB 4B0YA 5KATA 4R4LA 3D6ZA 4AYZA 4WLWA 1EXIA 3T97B 3IAOA 5I44A 3B49A 1R8EA 3Q5PA 3R8KA 2OQQA 5KAXA 1Q07A 2ZHGA 2ZHHA 5KAUA 3GP4A 5D8CA 1Q05A 3D6YA 1R8DA 2JMLA 4A1MA 1Q09A 1D5YA 1Q0AA 1Q06A 4R4MA 4J2NA 1DIPA 2J5UA 2HVAA 3GK6A 1Q08A 3LURA 3Q1MA 1EXJA 4R22B 1JBGA 5KCBA 3D71A
chains in the Genus database with same CATH superfamily
4D6TD 1VQNP 1YJNP 1IFNA 5GTIE 1JB0J 5B66H 4U3FD 1CZQA 5KLVJ 3H1JG 1VQ8P 2KNCB 5CJ4A 2A45G 1Z56A 4H44B 3H1HE 3N7NA 2QG4A 2C0WA 3LW5H 1SP4A 1YJ9P 1NU1E 1FOSF 2KK7A 1L0NJ 4ZKPA 3VMYA 1N7SA 4HJGH 1AQ5A 1NU1D 2KS1A 1JMBA 1AFOA 4H0LD 1R8DA 2Q7CA 3AE8C 2HODB 5CCHC 1QGKB 5AVQB 3G4SP 1BCCJ 4TLFA 1YITP 1LTSC 1OVRA 1RQVA 2LXBA 3O6QA 2PAJA 4Y99B 2Z5IA 3H1JD 1SQVG 1G1IA 2LR2A 1S5LE 1KYOH 4PJ0E 1BSHA 3BRVB 3ZDMA 1AV1A 2WSFJ 1OIPA 4UB6E 1PP9E 3Q5RA 1EZVI 3RBXA 3H1ID 3HRNA 2OTJP 3M0AA 2FXOA 5AVYB 1DH3A 1A02F 1S4XA 3TK1A 1XTCC 5E01A 3CCRP 1VF5C 3Q3DA 3D6ZA 1KILD 2YIUC 1GMJA 1IO4A 1GK6A 5CBOA 4TT3H 1NO4A 5H2FE 3TNUA 1KQLA 5TJHA 2YNYA 1J1DC 2K9YA 1M7LA 2WTYA 1AQTA 2O01H 3ITKA 4U3FE 1OWAA 1LWUB 5E79E 3H1LJ 1T8ZA 4WY4A 5CCHA 2AXTH 3H1KE 2OTKE 4N78E 1BOWA 1NTKK 3CC7P 4OVNF 3AE7C 4IL6H 2FBWC 1FS0E 1FZCA 1OMIA 2KVVA 2K88A 2FFDC 4BWNA 3CLQA 1SQVE 1JBGA 4JYCA 1JTHA 1OZHA 4C7NA 3A2AA 3HH0A 2XV5A 4UB8E 1SQQE 1LT9C 1DEEG 1FZCC 4HKZH 3N4XA 3UIAA 1NTZG 1NTMJ 1H0TA 3RK3E 1BE3E 1ZP0C 2BCCE 1N2DC 1SFCC 1L4AC 1KC8Q 4PD4D 2GM4A 3HE5A 1EDKA 3HE5B 5AVVB 3MTUE 1PZQA 2WQYC 3R8KA 5KTBA 2QJYB 1UIXA 2YIUB 2B87A 1NTZK 2WT7A 4MN4C 3MZWB 2I1JA 1FBMA 1PL5A 3B8EB 1BGYE 1BGYD 2Q6QA 2K9JB 2DW3A 3B49A 1NTZD 3CX5H 2E74B 4KHXA 2ZVNB 5AVWB 3CWBD 1MZ9A 3S1KA 3CWBG 3H25A 2A45H 4PD4E 3OAKA 4ASWA 1U7MA 5KLIC 2H7HA 5AVRB 4PV1D 3H1KG 5KKZB 1KMIZ 1RF0A 2W6AA 3RBZA 2OYIA 1S2EA 1KYOE 2FYUG 2O1KA 3HUSA 3V2PA 2Q1KA 1N73B 2FYZA 1RF1B 1IFMA 1JY2N 1WMKA 1KILC 1MV8A 1JCDA 2OYHB 2IEFA 3KZIH 2J59M 4N6JA 3LIDA 3WUTA 4QMAA 1N7SC 3KQGA 3EZ6A 2WZ7A 2KSJA 1PP9G 2Q3EA 3O6QB 3MIWA 5AW6B 2A45I 4GOFA 5DJTB 3CCVP 5CCGA 1RHZB 4H13B 1S9KD 2E76C 2L91A 1P84D 4LC1A 2ZVOB 2PRRA 2CPSA 1NKZB 2FXMA 2P10A 4RESB 3A3YB 3MUDC 3I56P 1NKNA 2B9BA 4YTPC 2W90A 3C8VA 3R2PA 4WY4C 3AEEC 5K5GB 5AVXB 1GU5A 1BSNA 1N86A 3R4YA 4OGQC 2NPSB 1G2CA 1M1JA 3M0DA 2HODA 1CI6B 1Q0AA 2H88C 3H1IG 2IFMA 3WU2H 2QM7A 2M3BA 4GODA 2E75D 1JEKA 3H1IE 4N3YB 1KD1Q 1JO5A 2IX7C 3BRTB 4I2LC 5BU5A 1SQXD 4KJMA 2HG5D 3TGUG 3EFFK 1OW6A 3EFGA 2C9NY 1HJ0A 2FFDB 1KILE 4EIJA 2K1AA 2D2CD 1SQPJ 1KB9E 1MUUA 2FKWB 2I8DA 1JY3P 3OA7A 2O3JA 1URQC 4OWFA 3U1AA 2OGUA 1H89A 1N7SD 1SQVD 1QVFO 2ZT9B 1SFCB 5H2FH 4DCKA 1IK7A 2QA4P 2N1TD 3EWKA 5TISE 1LWUC 1ZRTD 3CL3D 4PV1C 1FZEA 2ZHHA 1PPJD 1VQPP 1T3UA 2XU6A 3HE4A 1KN7A 1CSBA 3V2QA 1L2PA 1PP9D 1LT9A 1BDCA 3CI9A 1VDFA 1J2JB 3L70J 1X0TA 5AW7B 1OVVA 2Y0DA 4IL6E 4GKGA 3VMXA 2ZXEB 1NVOA 3CCEP 5CCGC 1VPCA 3L73G 2NPSA 3P7KA 3M9BA 3CCLP 1FU1A 3RL0C 2G8YA 2FY8A 1URQD 2IZ1A 1YTZI 2VZ4A 1OXZA 1A02J 3L71G 2E75C 2AXCA 3L74E 5KAXA 1KYOD 2N9YB 3HTKB 1URQB 4D6TG 1T2KD 4N78D 2Z5HA 2QIWA 4UB8H 1URQA 2ZXXA 5APYA 1FDIA 2RKLA 4AYCA 1FJPA 3EZ9A 4L75A 1NH4A 1EXIA 4JQ0D 3S9OA 3I5CA 3CXHE 1G1JA 2K37A 1GL2A 1NTZE 4R22B 1QL1A 3NMDA 3KHUA 2G3AA 1VQ5P 3TGUD 3VP8A 3L70D 3M9HA 1FDOA 1E5WA 4AUWA 2KUBA 1HJBA 3TGUJ 5D8CA 3D6YA 1N73A 3V2NA 1YQ3C 1OW7A 1P84I 1SQBK 2IYPA 3RL0B 2QVAA 5BU8B 2A06D 2A06E 1HVVA 3HD7D 1L0LG 1IFDA 2WPSA 4IL6X 1SQPG 2OYHC 3IAOA 3VOPA 1SS1A 3CX5E 4I6MC 1NTMG 2ZHGA 1SQVJ 3B71A 3V5BA 1QVGO 1L4AA 3FGAD 2XKMA 5APVA 3GHGB 3PHLA 2NRGA 1HF9A 1SQPD 1MFTA 1DX7A 4O9BA 1LP1B 1HBWA 1VL2A 4ASVA 1M56D 1EQ7A 1HUCA 5I41B 5KAWA 1HGVA 3CCSP 1FZAA 3VYIA 1KV4A 1PIXA 4ZNCA 3GMAA 1NTMK 2FYNC 2JWDA 2YO3A 1NU1K 2V7QJ 3V4QA 2PFXA 3BCCG 3LIEA 3CXHH 5AW9B 1L0ND 1PGQA 1VQ6P 2WT7B 2B87B 3EZFA 1LX8A 2XDJA 1Q82Q 1PPJE 3GF7A 1J1DB 2JR8A 4U3FJ 4BRYB 1R5LA 4HB1A 4L73A 1TU3F 1VF5D 1KB9D 2W27A 1PP9J 3TSIA 3TGUE 2WSEH 1ZW0A 1GW4A 3C9IA 1HTLC 2M5AB 5AVTB 3CXHD 5KAFE 1NU1G 1DEBA 1T3JA 3HD7A 3Q1MA 3LW5J 1FC2C 2KXPB 3KXDA 3T97A 5B5EH 2E5YA 1R8EA 3B5NC 3VTPC 1EZVG 3A0BE 1JY3N 1T2KC 1GW3A 1S72P 4A1MA 2E76D 1L0LJ 5APXA 2C0XA 2ZJSE 1KB9H 1JYHA 3W67A 2BCCJ 1BCCE 3QWOC 3SSUA 1RH6A 4DZOA 1SQXG 1Y8AA 4IFFA 2Z4EA 2N1TA 1IFJA 1KQGB 4Y28J 3WU2E 3NXSA 1GTWA 2YKPA 1SQXJ 1DIPA 2J5UA 1KYOI 3A0HE 1R5SA 4PD4I 1NTKJ 2E5TA 2YXRB 1EDIA 1SQQD 5EFWB 2B88A 1GL2B 5KAIH 2XNDH 1NTKD 2R44A 4H13C 1SQBJ 1RE3A 3RK2C 1L4AD 2O1JA 2WSCH 1K9MQ 5D90A 3AE1C 3B5ND 3FXEA 2BASA 4WBAA 2HPCA 4XFJA 3GP4A 3CWBJ 2MJZA 1P84H 3L74G 2N9BA 4K35A 1IK9A 1Q08A 2R5BA 2WSEJ 1H8AA 2IBZE 1PGPA 3AEFC 2QJKB 3KPEA 5GTHH 3TF5A 3IFMA 4W7YA 4H44C 1GZLA 2XZRA 5GTHE 3H32B 3WMM0 5APSA 1KQFB 3AEDC 4WLSA 2K9JA 2QJPB 4WVZA 1QLED 4C7RA 2M0BA 1EXJA 2RMZA 1ZOYC 3EZ2A 3MHVA 1LT9B 3EQ2A 1JMMA 3HE4B 5KLVK 2HR3A 5I44A 1IC2A 4EI2A 3G6EP 4A7PA 1Y9BA 3CCMP 1DD3A 1EC5A 5C39A 1YTZT 1T6AA 3EZ7A 3L75J 1NTME 1USDA 3USSA 5CCHD 5GQQA 2GOVA 5CMZA 1ZR4A 3MD0A 5AW4B 3SWFA 3CCJP 3QH9A 1PGJA 1VQLP 1JTHB 1Q2NA 1GD2E 3RK3C 3E1RA 3JCUH 4IFDK 5KJ7A 1D7MA 1BE3D 4JYBA 2FFDA 2OYOA 1ZR2A 4R24B 1PGOA 1FZCB 5AW8B 2WMMA 3F5HA 2BOWA 4R4LA 1LTGC 2FYUE 2E74C 1OX3A 1P84E 1K8AQ 3AE2C 3PRJA 4HYTB 1PM6A 2MKVA 2OG0A 3PH0A 3AE9C 3V6IA 2IBZD 2BEZF 4W80A 2CK3H 3AE5C 1LWUA 2E42A 1EZVE 5KJ7C 2XNXA 2OTLP 5AW2B 2I1KA 2KLUA 4C7NB 1S5LH 1YQ4C 1NYHA 1LGHB 1YYCA 3I55P 2IBZI 2Y9ZA 1M90Q 1N7LA 3JSVC 2O01J 2GUSA 2IZ0A 2KIKA 3A0HH 3BVHA 4PV1B 1NTKG 3H1IJ 3L72G 3Q5SA 4C46A 2WSSH 3RK2B 1JUNA 1RQUA 2W6BA 3RK3D 3M91A 2KI7B 1WT6A 3AE4C 4L76A 3U59A 2J58A 3R8JA 2HPCB 3WUUA 5B5EE 5CBNA 1PFIA 4BXLA 1Q86Q 2AXTE 1W2BO 3A0BH 2FYUK 3WUVA 3GLMA 3H1LG 3L71E 1YJWP 5APQA 1N73C 3AE3C 2HVAA 5KCBA 3OJAB 3QAOA 4YXWH 3H1HG 4WB4A 2Y0EA 2HLOA 3CMEP 3U1CA 3E7KA 4D6TE 2OARA 4B0YA 1SLQA 4I1LA 5KAFH 1PPJG 1AVOA 1L0NG 2P1JA 1LTIC 1USEA 1Q09A 1SQPK 1SFCD 2OYHA 1GU4A 1NJIQ 3H1JE 4YXDC 3G9RA 1S5LX 4NPFX 1SVFA 2IYOA 1KTMA 4R4EA 2KS1B 1RF1A 1SQVK 2OQQA 4HH2A 2AEFA 4YPCA 1SQBE 1E79H 4GIFA 3VMZA 1YIJP 2V4HA 1FOSE 3M9QA 4IOIH 3W68A 1JY3O 3GHGC 1VQMP 2KNCA 3FX0A 4EYYQ 2P7JA 1QL2A 1VQ4P 5KATA 5L8RJ 1RF1C 5KJ7D 5B66E 3T97B 1YBKA 4LGDE 1ZMEC 1IFIA 5AVUB 2QRXA 2A06G 3AEAC 1J1EC 3AE6C 3PLNA 4LHFA 3GK6A 1FZBA 1JNMA 3GF3A 1RY3A 2W8ZA 2RH0A 3H1KJ 2BEQD 2E74D 4I7ZC 1U57A 1NTKE 1SQXE 4XE5B 2R3CA 2ZT9C 1EDJA 2QEXP 3UCSA 1K04A 2RN0A 3L4FA 3PP5A 2IPPA 4GOEA 5AVZB 3L73D 1K05A 1HGZA 2Y9YA 1FZFA 1JOCA 4WY4D 1SQQK 3FXDA 1H0TB 2YKOA 5KLVG 4ZKUA 4U7JA 1CW5A 1M1KQ 4EDFA 1GK4A 1RH5B 4D6TJ 3OW2O 1L0LK 1RE4A 2HYNA 1NOHA 1Q81Q 3L70E 1X9VA 2B89A 2H8PD 3G71P 2FYNB 3LURA 4BRYA 3GHGA 1L0NE 3H1HJ 1NHLA 3H1HD 2IFNA 1Q90D 2Q9IA 4WLWA 4H0LC 2ZYAA 4OGQB 1LNQA 4J2NA 2M8RA 2ZAEB 5GTIH 3CD6P 3L71D 3GW6A 1EZVD 1KFNA 1IJDB 1U7JA 2R5DA 1KB9I 3L74J 1LT1A 3TNUB 4OGQD 2D2CC 4IFMA 4GDOA 3H32A 4R4MA 3L73J 5AW5B 1KZUB 1OVUA 2ZFCA 5KLIB 3B5NB 5TISH 1NGMB 3E0HA 1NAFA 2NZ2A 4LLHA 1KFMA 2PP6A 3H1KD 2SPZA 2ZT9D 3CC4P 2ITAA 2NPSC 4DT0A 1S1CX 3P8CE 3CCUP 2QJKC 3MUDA 1Q07A 2KOGA 2FXPA 1RE4C 2JDIH 3TDKA 3MGNA 3P32A 4CPGA 2OYIC 3D71A 2YMKA 2JWAA 1H88A 5KKZC 1LTJA 1JY2P 1LTAC 4AYZB 2Y0CA 3L72D 3VN0A 1NTZJ 2IBZG 1FE6A 4I7ZB 1FAVA 1KORA 3O8ZA 1BGYJ 5AW0B 3PTZA 1GL2C 1HH0A 1QEXA 1UIIA 2HFED 3A7OA 3HTKA 1N7SB 1DD4A 3FWLA 2QE7H 2R32A 3BATA 2KZJA 2JMLA 2H43A 4WWIA 4M3LA 3L37A 3GPVA 3C1LA 3HUSC 1NAYA 2P58A 2R3SA 3JCUE 2KCUA 1X8YA 3AECC 1NTMD 2JEEA 1IFPA 3SFEC 4ZMDA 1JY2O 1W5CE 3HD7B 1M57D 1SQXK 2N1TB 2QJPC 5DJUB 2JP3A 3BCCJ 4K3AA 1LTJC 2IDBA 4EOTA 3KZIE 4DOJA 1X79B 2W6JH 4KT0J 5APUA 2QSIA 2FYUD 3H1LE 2O01N 3P8CD 4L74A 1VQOP 2WPQA 5CCGD 2M3EA 1VQ7P 3H1LD 3ABVC 4B86A 1OFCX 1SFCA 3L70G 1RE3C 5AW3B 2KYVA 1Q05A 3L75E 3B4SA 3RL0D 5KAIE 2M5AA 1HWTC 2AEMA 2WPVB 2ZYGA 4RO0A 5AVSB 2YXQB 2DG6A 3F89A 4JF7A 1JM0A 4U3FG 4PD4H 3VMAA 3RK3B 2WWWA 3SFDC 1LP1A 3JC22 2H89C 1BGYG 1J1EB 4NPEA 2YKQA 1M1JC 3M0DC 2PGDA 3HD7C 2QM8A 1ZRTE 2WVRA 1GL2D 1BE3J 1W2EA 2NPSD 2LKMA 1FJKA 4DJGA 3D70A 1AJYA 1KILB 2WSFH 2FYUJ 2JJLA 1JCCA 1BDDA 2L5GB 2KSEA 2LXCB 3IR9A 3CX5D 3CXHI 2W83C 1CI6A 2C9LY 2WPRA 1G2CB 5KAVA 3BCCD 4PJ0H 2Q5UA 3L75D 1FZGA 4AYZA 1LTJB 3KDPB 4OH8B 2E75B 1BCCG 5KAUA 1YI2P 3H1JJ 2BCCG 3CPWO 1L4AB 2Q3IA 1M8OB 1BE3G 2JKVA 3L72E 1ZLLA 2E76B 3Q2YA 1VQKP 2AEJA 1S9KE 3CC2P 1BCCD 3L35A 1N8RQ 3L73E 3SWKA 2KP8A 3MP7B 4Y99C 5AW1B 1NU1J 2K3RA 3HUSB 2D2CB 4AQRD 3G3ZA 4W7ZA 4JBZA 1K73Q 1L0NK 2OYIB 1X22A 1LJ2A 3KYQA 2P2UA 3B5NA 2JO1A 3L71J 5KLVD 3CMAP 2WITA 1VQ9P 1SQPE 1ZXGA 4RJTA 1GDTA 3NFQA 3L72J 1MFZA 1MKMA 2N1TC 3RGUA 3PJSK 3H6PA 3Q5PA 5APWA 1ZN5A 1D5YA 1EDLA 4H13D 1AA0A 1IZNB 1KILA 3CWBE 3II6A 2P67A 1XTGB 2KB7P 1S3JA 4XA4A 5E79H 1SQBD 4Z1MH 1WRGA 1ZV8A 1LTBC 3S4RA 5CHXA 3FWNA 3VP9A 2CPBA 1QX8A 3V2RA 1AVYA 1SQQJ 2WSCJ 3GG2A 4H0LB 1RF0C 1VF5B 2KZIA 1OW8A 1SQBG 5CJ0A 2GUVA 3RL0g 1KQSO 1YHQP 3BASA 2UWJE 2QJYC 2VRSA 3NTNA 3TYYA 2GA1A 3CCQP 2E43A 3SWYA 3AEGC 4NPDA 1Q06A 2V7QH 2BCCD 3L74D 1SQQG 3M06A 5APTA 3RK2D 4GT1A 3AEBC 1L0LD 1L0LE 3K5BA 2ZYDA 1Y47A 3L36A 3CX5I 1FDMA 3L75G 2YO2A 4WY4B 3BCCE 1LTTC 3A5TA 4UB6H 4RKUJ 3IF4A 5BVZA 5M1BA 3P8MC 3V4WA 1NWQA 1Y6UA 3E1IA 4H44D 3IN6A 4JPZB 2YMYA 2KLVA 1PV3A 1Q7YQ 5KLVE 2POHA 4DCZA 1M1JB
chains in the Genus database with same CATH topology
4YXDC 3G9RA 2VZ4A 2ZT9D 5E01A 1OW6A 1S5LX 1JYHA 3EZ6A 1VF5C 4U7JA 2QJPC 3Q3DA 3AEDC 1VL2A 4WLSA 1HJ0A 1S1CX 1JB0J 2JP3A 4R4EA 2E75C 5I41B 1KTMA 5KAVA 4Z1MH 5KAWA 3D6ZA 4AYZA 1RH6A 1KILE 2QJKC 1PIXA 2WQYC 2YIUC 3R8KA 2E75B 2OQQA 1Q07A 1YQ4C 1NYHA 5KAXA 5KAUA 1GMJA 3GMAA 1KQGB 2FXPA 1UIXA 2FYNC 2WSCJ 4Y28J 2D2CD 2IDBA 4H13B 4H0LB 1VF5B 4H44B 2QIWA 2V7QJ 4TT3H 1DIPA 1OW8A 2J5UA 2E76C 3LURA 1EXJA 4KT0J 3D71A 2QSIA 3RL0g 1ZOYC 2O01J 3EZ2A 2E76B 1PL5A 2YMKA 3Q2YA 3EZFA 1FDIA 2ZT9B 1LX8A 4PV1B 2K9YA 5KKZC 1IK7A 3EZ9A 3Q5SA 4AYZB 3GF7A 5KATA 1Q90D 2P10A 2QJYC 3EWKA 4WLWA 1EXIA 5L8RJ 1RQUA 3ABVC 3T97B 4PV1C 5I44A 3B49A 4H0LC 1ZMEC 3S9OA 2ZHHA 4YTPC 4H0LD 3C8VA 1Q05A 1Y9BA 4I7ZB 1DD3A 1R8DA 4OGQB 1KORA 2E74B 3AEAC 4J2NA 3AE8C 3AE6C 3AEEC 3AEGC 2D2CB 4LHFA 3EZ7A 3GK6A 3AE4C 4H13C 4R22B 1Q06A 2WPVB 3GF3A 2G3AA 1TU3F 5GQQA 1RQVA 1VF5D 2DG6A 2GOVA 3R8JA 1BOWA 3H25A 5D90A 3O6QA 3AE1C 2BEQD 3AE7C 3AEBC 1DD4A 1FDOA 5KLIC 3R4YA 2E74D 2FBWC 4I7ZC 4OGQC 1U57A 4PV1D 2JO1A 3SFDC 1KMIZ 1D5YA 1OMIA 2H89C 4OGQD 2KVVA 3GP4A 4XFJA 2D2CC 5D8CA 3D6YA 4GDOA 2JMLA 1Q0AA 3GLMA 1YQ3C 2H88C 4R4MA 3AE3C 1OW7A 2WSFJ 2HVAA 1Q08A 2WSEJ 3Q1MA 5KCBA 1JBGA 2ZT9C 3GPVA 1ZRTE 3QAOA 3UCSA 1K04A 3LW5J 4R24B 3Q5RA 1NGMB 2E75D 3AEFC 3HH0A 2KCUA 3D70A 4RKUJ 1MKMA 4IL6X 2BOWA 3E0HA 1WMKA 4B0YA 5M1BA 1AJYA 4R4LA 3AECC 1K05A 3IAOA 2E74C 1R8EA 1Y6UA 3Q5PA 4H44D 3IN6A 3SFEC 2ZHGA 2NZ2A 3AE2C 3B71A 4H44C 1PM6A 2MKVA 2OG0A 1PV3A 2G8YA 1Q09A 2IEFA 2E76D 3AE9C 3FGAD 3RK3E 4A1MA 1ZP0C 2BEZF 4H13D 1KQFB 4DCZA 1HF9A 3AE5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPV A;  3G9R A;  2VZ4 A;  3QAO A;  5E01 A;  3UCS A;  1JYH A;  5GQQ A;  3Q2Y A;  2GOV A;  2DG6 A;  3Q3D A;  3R8J A;  4R24 B;  3Q5R A;  1BOW A;  4WLS A;  3HH0 A;  2KCU A;  3D70 A;  5KAV A;  4R4E A;  3Q5S A;  5D90 A;  5I41 B;  5KAW A;  2BOW A;  3E0H A;  4AYZ B;  4B0Y A;  5KAT A;  4R4L A;  3D6Z A;  4AYZ A;  4WLW A;  1EXI A;  3T97 B;  3IAO A;  5I44 A;  3B49 A;  1R8E A;  3Q5P A;  3R8K A;  2OQQ A;  5KAX A;  1Q07 A;  2ZHG A;  2ZHH A;  5KAU A;  3GP4 A;  5D8C A;  1Q05 A;  3D6Y A;  1R8D A;  2JML A;  4A1M A;  1Q09 A;  1D5Y A;  1Q0A A;  1Q06 A;  4R4M A;  4J2N A;  1DIP A;  2J5U A;  2HVA A;  3GK6 A;  1Q08 A;  3LUR A;  3Q1M A;  1EXJ A;  4R22 B;  1JBG A;  5KCB A;  3D71 A; 
#chains in the Genus database with same CATH topology
 4D6T D;  1VQN P;  1YJN P;  1IFN A;  5GTI E;  1JB0 J;  5B66 H;  4U3F D;  1CZQ A;  5KLV J;  3H1J G;  1VQ8 P;  2KNC B;  5CJ4 A;  2A45 G;  1Z56 A;  4H44 B;  3H1H E;  3N7N A;  2QG4 A;  2C0W A;  3LW5 H;  1SP4 A;  1YJ9 P;  1NU1 E;  1FOS F;  2KK7 A;  1L0N J;  4ZKP A;  3VMY A;  1N7S A;  4HJG H;  1AQ5 A;  1NU1 D;  2KS1 A;  1JMB A;  1AFO A;  4H0L D;  1R8D A;  2Q7C A;  3AE8 C;  2HOD B;  5CCH C;  1QGK B;  5AVQ B;  3G4S P;  1BCC J;  4TLF A;  1YIT P;  1LTS C;  1OVR A;  1RQV A;  2LXB A;  3O6Q A;  2PAJ A;  4Y99 B;  2Z5I A;  3H1J D;  1SQV G;  1G1I A;  2LR2 A;  1S5L E;  1KYO H;  4PJ0 E;  1BSH A;  3BRV B;  3ZDM A;  1AV1 A;  2WSF J;  1OIP A;  4UB6 E;  1PP9 E;  3Q5R A;  1EZV I;  3RBX A;  3H1I D;  3HRN A;  2OTJ P;  3M0A A;  2FXO A;  5AVY B;  1DH3 A;  1A02 F;  1S4X A;  3TK1 A;  1XTC C;  5E01 A;  3CCR P;  1VF5 C;  3Q3D A;  3D6Z A;  1KIL D;  2YIU C;  1GMJ A;  1IO4 A;  1GK6 A;  5CBO A;  4TT3 H;  1NO4 A;  5H2F E;  3TNU A;  1KQL A;  5TJH A;  2YNY A;  1J1D C;  2K9Y A;  1M7L A;  2WTY A;  1AQT A;  2O01 H;  3ITK A;  4U3F E;  1OWA A;  1LWU B;  5E79 E;  3H1L J;  1T8Z A;  4WY4 A;  5CCH A;  2AXT H;  3H1K E;  2OTK E;  4N78 E;  1BOW A;  1NTK K;  3CC7 P;  4OVN F;  3AE7 C;  4IL6 H;  2FBW C;  1FS0 E;  1FZC A;  1OMI A;  2KVV A;  2K88 A;  2FFD C;  4BWN A;  3CLQ A;  1SQV E;  1JBG A;  4JYC A;  1JTH A;  1OZH A;  4C7N A;  3A2A A;  3HH0 A;  2XV5 A;  4UB8 E;  1SQQ E;  1LT9 C;  1DEE G;  1FZC C;  4HKZ H;  3N4X A;  3UIA A;  1NTZ G;  1NTM J;  1H0T A;  3RK3 E;  1BE3 E;  1ZP0 C;  2BCC E;  1N2D C;  1SFC C;  1L4A C;  1KC8 Q;  4PD4 D;  2GM4 A;  3HE5 A;  1EDK A;  3HE5 B;  5AVV B;  3MTU E;  1PZQ A;  2WQY C;  3R8K A;  5KTB A;  2QJY B;  1UIX A;  2YIU B;  2B87 A;  1NTZ K;  2WT7 A;  4MN4 C;  3MZW B;  2I1J A;  1FBM A;  1PL5 A;  3B8E B;  1BGY E;  1BGY D;  2Q6Q A;  2K9J B;  2DW3 A;  3B49 A;  1NTZ D;  3CX5 H;  2E74 B;  4KHX A;  2ZVN B;  5AVW B;  3CWB D;  1MZ9 A;  3S1K A;  3CWB G;  3H25 A;  2A45 H;  4PD4 E;  3OAK A;  4ASW A;  1U7M A;  5KLI C;  2H7H A;  5AVR B;  4PV1 D;  3H1K G;  5KKZ B;  1KMI Z;  1RF0 A;  2W6A A;  3RBZ A;  2OYI A;  1S2E A;  1KYO E;  2FYU G;  2O1K A;  3HUS A;  3V2P A;  2Q1K A;  1N73 B;  2FYZ A;  1RF1 B;  1IFM A;  1JY2 N;  1WMK A;  1KIL C;  1MV8 A;  1JCD A;  2OYH B;  2IEF A;  3KZI H;  2J59 M;  4N6J A;  3LID A;  3WUT A;  4QMA A;  1N7S C;  3KQG A;  3EZ6 A;  2WZ7 A;  2KSJ A;  1PP9 G;  2Q3E A;  3O6Q B;  3MIW A;  5AW6 B;  2A45 I;  4GOF A;  5DJT B;  3CCV P;  5CCG A;  1RHZ B;  4H13 B;  1S9K D;  2E76 C;  2L91 A;  1P84 D;  4LC1 A;  2ZVO B;  2PRR A;  2CPS A;  1NKZ B;  2FXM A;  2P10 A;  4RES B;  3A3Y B;  3MUD C;  3I56 P;  1NKN A;  2B9B A;  4YTP C;  2W90 A;  3C8V A;  3R2P A;  4WY4 C;  3AEE C;  5K5G B;  5AVX B;  1GU5 A;  1BSN A;  1N86 A;  3R4Y A;  4OGQ C;  2NPS B;  1G2C A;  1M1J A;  3M0D A;  2HOD A;  1CI6 B;  1Q0A A;  2H88 C;  3H1I G;  2IFM A;  3WU2 H;  2QM7 A;  2M3B A;  4GOD A;  2E75 D;  1JEK A;  3H1I E;  4N3Y B;  1KD1 Q;  1JO5 A;  2IX7 C;  3BRT B;  4I2L C;  5BU5 A;  1SQX D;  4KJM A;  2HG5 D;  3TGU G;  3EFF K;  1OW6 A;  3EFG A;  2C9N Y;  1HJ0 A;  2FFD B;  1KIL E;  4EIJ A;  2K1A A;  2D2C D;  1SQP J;  1KB9 E;  1MUU A;  2FKW B;  2I8D A;  1JY3 P;  3OA7 A;  2O3J A;  1URQ C;  4OWF A;  3U1A A;  2OGU A;  1H89 A;  1N7S D;  1SQV D;  1QVF O;  2ZT9 B;  1SFC B;  5H2F H;  4DCK A;  1IK7 A;  2QA4 P;  2N1T D;  3EWK A;  5TIS E;  1LWU C;  1ZRT D;  3CL3 D;  4PV1 C;  1FZE A;  2ZHH A;  1PPJ D;  1VQP P;  1T3U A;  2XU6 A;  3HE4 A;  1KN7 A;  1CSB A;  3V2Q A;  1L2P A;  1PP9 D;  1LT9 A;  1BDC A;  3CI9 A;  1VDF A;  1J2J B;  3L70 J;  1X0T A;  5AW7 B;  1OVV A;  2Y0D A;  4IL6 E;  4GKG A;  3VMX A;  2ZXE B;  1NVO A;  3CCE P;  5CCG C;  1VPC A;  3L73 G;  2NPS A;  3P7K A;  3M9B A;  3CCL P;  1FU1 A;  3RL0 C;  2G8Y A;  2FY8 A;  1URQ D;  2IZ1 A;  1YTZ I;  2VZ4 A;  1OXZ A;  1A02 J;  3L71 G;  2E75 C;  2AXC A;  3L74 E;  5KAX A;  1KYO D;  2N9Y B;  3HTK B;  1URQ B;  4D6T G;  1T2K D;  4N78 D;  2Z5H A;  2QIW A;  4UB8 H;  1URQ A;  2ZXX A;  5APY A;  1FDI A;  2RKL A;  4AYC A;  1FJP A;  3EZ9 A;  4L75 A;  1NH4 A;  1EXI A;  4JQ0 D;  3S9O A;  3I5C A;  3CXH E;  1G1J A;  2K37 A;  1GL2 A;  1NTZ E;  4R22 B;  1QL1 A;  3NMD A;  3KHU A;  2G3A A;  1VQ5 P;  3TGU D;  3VP8 A;  3L70 D;  3M9H A;  1FDO A;  1E5W A;  4AUW A;  2KUB A;  1HJB A;  3TGU J;  5D8C A;  3D6Y A;  1N73 A;  3V2N A;  1YQ3 C;  1OW7 A;  1P84 I;  1SQB K;  2IYP A;  3RL0 B;  2QVA A;  5BU8 B;  2A06 D;  2A06 E;  1HVV A;  3HD7 D;  1L0L G;  1IFD A;  2WPS A;  4IL6 X;  1SQP G;  2OYH C;  3IAO A;  3VOP A;  1SS1 A;  3CX5 E;  4I6M C;  1NTM G;  2ZHG A;  1SQV J;  3B71 A;  3V5B A;  1QVG O;  1L4A A;  3FGA D;  2XKM A;  5APV A;  3GHG B;  3PHL A;  2NRG A;  1HF9 A;  1SQP D;  1MFT A;  1DX7 A;  4O9B A;  1LP1 B;  1HBW A;  1VL2 A;  4ASV A;  1M56 D;  1EQ7 A;  1HUC A;  5I41 B;  5KAW A;  1HGV A;  3CCS P;  1FZA A;  3VYI A;  1KV4 A;  1PIX A;  4ZNC A;  3GMA A;  1NTM K;  2FYN C;  2JWD A;  2YO3 A;  1NU1 K;  2V7Q J;  3V4Q A;  2PFX A;  3BCC G;  3LIE A;  3CXH H;  5AW9 B;  1L0N D;  1PGQ A;  1VQ6 P;  2WT7 B;  2B87 B;  3EZF A;  1LX8 A;  2XDJ A;  1Q82 Q;  1PPJ E;  3GF7 A;  1J1D B;  2JR8 A;  4U3F J;  4BRY B;  1R5L A;  4HB1 A;  4L73 A;  1TU3 F;  1VF5 D;  1KB9 D;  2W27 A;  1PP9 J;  3TSI A;  3TGU E;  2WSE H;  1ZW0 A;  1GW4 A;  3C9I A;  1HTL C;  2M5A B;  5AVT B;  3CXH D;  5KAF E;  1NU1 G;  1DEB A;  1T3J A;  3HD7 A;  3Q1M A;  3LW5 J;  1FC2 C;  2KXP B;  3KXD A;  3T97 A;  5B5E H;  2E5Y A;  1R8E A;  3B5N C;  3VTP C;  1EZV G;  3A0B E;  1JY3 N;  1T2K C;  1GW3 A;  1S72 P;  4A1M A;  2E76 D;  1L0L J;  5APX A;  2C0X A;  2ZJS E;  1KB9 H;  1JYH A;  3W67 A;  2BCC J;  1BCC E;  3QWO C;  3SSU A;  1RH6 A;  4DZO A;  1SQX G;  1Y8A A;  4IFF A;  2Z4E A;  2N1T A;  1IFJ A;  1KQG B;  4Y28 J;  3WU2 E;  3NXS A;  1GTW A;  2YKP A;  1SQX J;  1DIP A;  2J5U A;  1KYO I;  3A0H E;  1R5S A;  4PD4 I;  1NTK J;  2E5T A;  2YXR B;  1EDI A;  1SQQ D;  5EFW B;  2B88 A;  1GL2 B;  5KAI H;  2XND H;  1NTK D;  2R44 A;  4H13 C;  1SQB J;  1RE3 A;  3RK2 C;  1L4A D;  2O1J A;  2WSC H;  1K9M Q;  5D90 A;  3AE1 C;  3B5N D;  3FXE A;  2BAS A;  4WBA A;  2HPC A;  4XFJ A;  3GP4 A;  3CWB J;  2MJZ A;  1P84 H;  3L74 G;  2N9B A;  4K35 A;  1IK9 A;  1Q08 A;  2R5B A;  2WSE J;  1H8A A;  2IBZ E;  1PGP A;  3AEF C;  2QJK B;  3KPE A;  5GTH H;  3TF5 A;  3IFM A;  4W7Y A;  4H44 C;  1GZL A;  2XZR A;  5GTH E;  3H32 B;  3WMM 0;  5APS A;  1KQF B;  3AED C;  4WLS A;  2K9J A;  2QJP B;  4WVZ A;  1QLE D;  4C7R A;  2M0B A;  1EXJ A;  2RMZ A;  1ZOY C;  3EZ2 A;  3MHV A;  1LT9 B;  3EQ2 A;  1JMM A;  3HE4 B;  5KLV K;  2HR3 A;  5I44 A;  1IC2 A;  4EI2 A;  3G6E P;  4A7P A;  1Y9B A;  3CCM P;  1DD3 A;  1EC5 A;  5C39 A;  1YTZ T;  1T6A A;  3EZ7 A;  3L75 J;  1NTM E;  1USD A;  3USS A;  5CCH D;  5GQQ A;  2GOV A;  5CMZ A;  1ZR4 A;  3MD0 A;  5AW4 B;  3SWF A;  3CCJ P;  3QH9 A;  1PGJ A;  1VQL P;  1JTH B;  1Q2N A;  1GD2 E;  3RK3 C;  3E1R A;  3JCU H;  4IFD K;  5KJ7 A;  1D7M A;  1BE3 D;  4JYB A;  2FFD A;  2OYO A;  1ZR2 A;  4R24 B;  1PGO A;  1FZC B;  5AW8 B;  2WMM A;  3F5H A;  2BOW A;  4R4L A;  1LTG C;  2FYU E;  2E74 C;  1OX3 A;  1P84 E;  1K8A Q;  3AE2 C;  3PRJ A;  4HYT B;  1PM6 A;  2MKV A;  2OG0 A;  3PH0 A;  3AE9 C;  3V6I A;  2IBZ D;  2BEZ F;  4W80 A;  2CK3 H;  3AE5 C;  1LWU A;  2E42 A;  1EZV E;  5KJ7 C;  2XNX A;  2OTL P;  5AW2 B;  2I1K A;  2KLU A;  4C7N B;  1S5L H;  1YQ4 C;  1NYH A;  1LGH B;  1YYC A;  3I55 P;  2IBZ I;  2Y9Z A;  1M90 Q;  1N7L A;  3JSV C;  2O01 J;  2GUS A;  2IZ0 A;  2KIK A;  3A0H H;  3BVH A;  4PV1 B;  1NTK G;  3H1I J;  3L72 G;  3Q5S A;  4C46 A;  2WSS H;  3RK2 B;  1JUN A;  1RQU A;  2W6B A;  3RK3 D;  3M91 A;  2KI7 B;  1WT6 A;  3AE4 C;  4L76 A;  3U59 A;  2J58 A;  3R8J A;  2HPC B;  3WUU A;  5B5E E;  5CBN A;  1PFI A;  4BXL A;  1Q86 Q;  2AXT E;  1W2B O;  3A0B H;  2FYU K;  3WUV A;  3GLM A;  3H1L G;  3L71 E;  1YJW P;  5APQ A;  1N73 C;  3AE3 C;  2HVA A;  5KCB A;  3OJA B;  3QAO A;  4YXW H;  3H1H G;  4WB4 A;  2Y0E A;  2HLO A;  3CME P;  3U1C A;  3E7K A;  4D6T E;  2OAR A;  4B0Y A;  1SLQ A;  4I1L A;  5KAF H;  1PPJ G;  1AVO A;  1L0N G;  2P1J A;  1LTI C;  1USE A;  1Q09 A;  1SQP K;  1SFC D;  2OYH A;  1GU4 A;  1NJI Q;  3H1J E;  4YXD C;  3G9R A;  1S5L X;  4NPF X;  1SVF A;  2IYO A;  1KTM A;  4R4E A;  2KS1 B;  1RF1 A;  1SQV K;  2OQQ A;  4HH2 A;  2AEF A;  4YPC A;  1SQB E;  1E79 H;  4GIF A;  3VMZ A;  1YIJ P;  2V4H A;  1FOS E;  3M9Q A;  4IOI H;  3W68 A;  1JY3 O;  3GHG C;  1VQM P;  2KNC A;  3FX0 A;  4EYY Q;  2P7J A;  1QL2 A;  1VQ4 P;  5KAT A;  5L8R J;  1RF1 C;  5KJ7 D;  5B66 E;  3T97 B;  1YBK A;  4LGD E;  1ZME C;  1IFI A;  5AVU B;  2QRX A;  2A06 G;  3AEA C;  1J1E C;  3AE6 C;  3PLN A;  4LHF A;  3GK6 A;  1FZB A;  1JNM A;  3GF3 A;  1RY3 A;  2W8Z A;  2RH0 A;  3H1K J;  2BEQ D;  2E74 D;  4I7Z C;  1U57 A;  1NTK E;  1SQX E;  4XE5 B;  2R3C A;  2ZT9 C;  1EDJ A;  2QEX P;  3UCS A;  1K04 A;  2RN0 A;  3L4F A;  3PP5 A;  2IPP A;  4GOE A;  5AVZ B;  3L73 D;  1K05 A;  1HGZ A;  2Y9Y A;  1FZF A;  1JOC A;  4WY4 D;  1SQQ K;  3FXD A;  1H0T B;  2YKO A;  5KLV G;  4ZKU A;  4U7J A;  1CW5 A;  1M1K Q;  4EDF A;  1GK4 A;  1RH5 B;  4D6T J;  3OW2 O;  1L0L K;  1RE4 A;  2HYN A;  1NOH A;  1Q81 Q;  3L70 E;  1X9V A;  2B89 A;  2H8P D;  3G71 P;  2FYN B;  3LUR A;  4BRY A;  3GHG A;  1L0N E;  3H1H J;  1NHL A;  3H1H D;  2IFN A;  1Q90 D;  2Q9I A;  4WLW A;  4H0L C;  2ZYA A;  4OGQ B;  1LNQ A;  4J2N A;  2M8R A;  2ZAE B;  5GTI H;  3CD6 P;  3L71 D;  3GW6 A;  1EZV D;  1KFN A;  1IJD B;  1U7J A;  2R5D A;  1KB9 I;  3L74 J;  1LT1 A;  3TNU B;  4OGQ D;  2D2C C;  4IFM A;  4GDO A;  3H32 A;  4R4M A;  3L73 J;  5AW5 B;  1KZU B;  1OVU A;  2ZFC A;  5KLI B;  3B5N B;  5TIS H;  1NGM B;  3E0H A;  1NAF A;  2NZ2 A;  4LLH A;  1KFM A;  2PP6 A;  3H1K D;  2SPZ A;  2ZT9 D;  3CC4 P;  2ITA A;  2NPS C;  4DT0 A;  1S1C X;  3P8C E;  3CCU P;  2QJK C;  3MUD A;  1Q07 A;  2KOG A;  2FXP A;  1RE4 C;  2JDI H;  3TDK A;  3MGN A;  3P32 A;  4CPG A;  2OYI C;  3D71 A;  2YMK A;  2JWA A;  1H88 A;  5KKZ C;  1LTJ A;  1JY2 P;  1LTA C;  4AYZ B;  2Y0C A;  3L72 D;  3VN0 A;  1NTZ J;  2IBZ G;  1FE6 A;  4I7Z B;  1FAV A;  1KOR A;  3O8Z A;  1BGY J;  5AW0 B;  3PTZ A;  1GL2 C;  1HH0 A;  1QEX A;  1UII A;  2HFE D;  3A7O A;  3HTK A;  1N7S B;  1DD4 A;  3FWL A;  2QE7 H;  2R32 A;  3BAT A;  2KZJ A;  2JML A;  2H43 A;  4WWI A;  4M3L A;  3L37 A;  3GPV A;  3C1L A;  3HUS C;  1NAY A;  2P58 A;  2R3S A;  3JCU E;  2KCU A;  1X8Y A;  3AEC C;  1NTM D;  2JEE A;  1IFP A;  3SFE C;  4ZMD A;  1JY2 O;  1W5C E;  3HD7 B;  1M57 D;  1SQX K;  2N1T B;  2QJP C;  5DJU B;  2JP3 A;  3BCC J;  4K3A A;  1LTJ C;  2IDB A;  4EOT A;  3KZI E;  4DOJ A;  1X79 B;  2W6J H;  4KT0 J;  5APU A;  2QSI A;  2FYU D;  3H1L E;  2O01 N;  3P8C D;  4L74 A;  1VQO P;  2WPQ A;  5CCG D;  2M3E A;  1VQ7 P;  3H1L D;  3ABV C;  4B86 A;  1OFC X;  1SFC A;  3L70 G;  1RE3 C;  5AW3 B;  2KYV A;  1Q05 A;  3L75 E;  3B4S A;  3RL0 D;  5KAI E;  2M5A A;  1HWT C;  2AEM A;  2WPV B;  2ZYG A;  4RO0 A;  5AVS B;  2YXQ B;  2DG6 A;  3F89 A;  4JF7 A;  1JM0 A;  4U3F G;  4PD4 H;  3VMA A;  3RK3 B;  2WWW A;  3SFD C;  1LP1 A;  3JC2 2;  2H89 C;  1BGY G;  1J1E B;  4NPE A;  2YKQ A;  1M1J C;  3M0D C;  2PGD A;  3HD7 C;  2QM8 A;  1ZRT E;  2WVR A;  1GL2 D;  1BE3 J;  1W2E A;  2NPS D;  2LKM A;  1FJK A;  4DJG A;  3D70 A;  1AJY A;  1KIL B;  2WSF H;  2FYU J;  2JJL A;  1JCC A;  1BDD A;  2L5G B;  2KSE A;  2LXC B;  3IR9 A;  3CX5 D;  3CXH I;  2W83 C;  1CI6 A;  2C9L Y;  2WPR A;  1G2C B;  5KAV A;  3BCC D;  4PJ0 H;  2Q5U A;  3L75 D;  1FZG A;  4AYZ A;  1LTJ B;  3KDP B;  4OH8 B;  2E75 B;  1BCC G;  5KAU A;  1YI2 P;  3H1J J;  2BCC G;  3CPW O;  1L4A B;  2Q3I A;  1M8O B;  1BE3 G;  2JKV A;  3L72 E;  1ZLL A;  2E76 B;  3Q2Y A;  1VQK P;  2AEJ A;  1S9K E;  3CC2 P;  1BCC D;  3L35 A;  1N8R Q;  3L73 E;  3SWK A;  2KP8 A;  3MP7 B;  4Y99 C;  5AW1 B;  1NU1 J;  2K3R A;  3HUS B;  2D2C B;  4AQR D;  3G3Z A;  4W7Z A;  4JBZ A;  1K73 Q;  1L0N K;  2OYI B;  1X22 A;  1LJ2 A;  3KYQ A;  2P2U A;  3B5N A;  2JO1 A;  3L71 J;  5KLV D;  3CMA P;  2WIT A;  1VQ9 P;  1SQP E;  1ZXG A;  4RJT A;  1GDT A;  3NFQ A;  3L72 J;  1MFZ A;  1MKM A;  2N1T C;  3RGU A;  3PJS K;  3H6P A;  3Q5P A;  5APW A;  1ZN5 A;  1D5Y A;  1EDL A;  4H13 D;  1AA0 A;  1IZN B;  1KIL A;  3CWB E;  3II6 A;  2P67 A;  1XTG B;  2KB7 P;  1S3J A;  4XA4 A;  5E79 H;  1SQB D;  4Z1M H;  1WRG A;  1ZV8 A;  1LTB C;  3S4R A;  5CHX A;  3FWN A;  3VP9 A;  2CPB A;  1QX8 A;  3V2R A;  1AVY A;  1SQQ J;  2WSC J;  3GG2 A;  4H0L B;  1RF0 C;  1VF5 B;  2KZI A;  1OW8 A;  1SQB G;  5CJ0 A;  2GUV A;  3RL0 g;  1KQS O;  1YHQ P;  3BAS A;  2UWJ E;  2QJY C;  2VRS A;  3NTN A;  3TYY A;  2GA1 A;  3CCQ P;  2E43 A;  3SWY A;  3AEG C;  4NPD A;  1Q06 A;  2V7Q H;  2BCC D;  3L74 D;  1SQQ G;  3M06 A;  5APT A;  3RK2 D;  4GT1 A;  3AEB C;  1L0L D;  1L0L E;  3K5B A;  2ZYD A;  1Y47 A;  3L36 A;  3CX5 I;  1FDM A;  3L75 G;  2YO2 A;  4WY4 B;  3BCC E;  1LTT C;  3A5T A;  4UB6 H;  4RKU J;  3IF4 A;  5BVZ A;  5M1B A;  3P8M C;  3V4W A;  1NWQ A;  1Y6U A;  3E1I A;  4H44 D;  3IN6 A;  4JPZ B;  2YMY A;  2KLV A;  1PV3 A;  1Q7Y Q;  5KLV E;  2POH A;  4DCZ A;  1M1J B; 
#chains in the Genus database with same CATH homology
 4YXD C;  3G9R A;  2VZ4 A;  2ZT9 D;  5E01 A;  1OW6 A;  1S5L X;  1JYH A;  3EZ6 A;  1VF5 C;  4U7J A;  2QJP C;  3Q3D A;  3AED C;  1VL2 A;  4WLS A;  1HJ0 A;  1S1C X;  1JB0 J;  2JP3 A;  4R4E A;  2E75 C;  5I41 B;  1KTM A;  5KAV A;  4Z1M H;  5KAW A;  3D6Z A;  4AYZ A;  1RH6 A;  1KIL E;  2QJK C;  1PIX A;  2WQY C;  2YIU C;  3R8K A;  2E75 B;  2OQQ A;  1Q07 A;  1YQ4 C;  1NYH A;  5KAX A;  5KAU A;  1GMJ A;  3GMA A;  1KQG B;  2FXP A;  1UIX A;  2FYN C;  2WSC J;  4Y28 J;  2D2C D;  2IDB A;  4H13 B;  4H0L B;  1VF5 B;  4H44 B;  2QIW A;  2V7Q J;  4TT3 H;  1DIP A;  1OW8 A;  2J5U A;  2E76 C;  3LUR A;  1EXJ A;  4KT0 J;  3D71 A;  2QSI A;  3RL0 g;  1ZOY C;  2O01 J;  3EZ2 A;  2E76 B;  1PL5 A;  2YMK A;  3Q2Y A;  3EZF A;  1FDI A;  2ZT9 B;  1LX8 A;  4PV1 B;  2K9Y A;  5KKZ C;  1IK7 A;  3EZ9 A;  3Q5S A;  4AYZ B;  3GF7 A;  5KAT A;  1Q90 D;  2P10 A;  2QJY C;  3EWK A;  4WLW A;  1EXI A;  5L8R J;  1RQU A;  3ABV C;  3T97 B;  4PV1 C;  5I44 A;  3B49 A;  4H0L C;  1ZME C;  3S9O A;  2ZHH A;  4YTP C;  4H0L D;  3C8V A;  1Q05 A;  1Y9B A;  4I7Z B;  1DD3 A;  1R8D A;  4OGQ B;  1KOR A;  2E74 B;  3AEA C;  4J2N A;  3AE8 C;  3AE6 C;  3AEE C;  3AEG C;  2D2C B;  4LHF A;  3EZ7 A;  3GK6 A;  3AE4 C;  4H13 C;  4R22 B;  1Q06 A;  2WPV B;  3GF3 A;  2G3A A;  1TU3 F;  5GQQ A;  1RQV A;  1VF5 D;  2DG6 A;  2GOV A;  3R8J A;  1BOW A;  3H25 A;  5D90 A;  3O6Q A;  3AE1 C;  2BEQ D;  3AE7 C;  3AEB C;  1DD4 A;  1FDO A;  5KLI C;  3R4Y A;  2E74 D;  2FBW C;  4I7Z C;  4OGQ C;  1U57 A;  4PV1 D;  2JO1 A;  3SFD C;  1KMI Z;  1D5Y A;  1OMI A;  2H89 C;  4OGQ D;  2KVV A;  3GP4 A;  4XFJ A;  2D2C C;  5D8C A;  3D6Y A;  4GDO A;  2JML A;  1Q0A A;  3GLM A;  1YQ3 C;  2H88 C;  4R4M A;  3AE3 C;  1OW7 A;  2WSF J;  2HVA A;  1Q08 A;  2WSE J;  3Q1M A;  5KCB A;  1JBG A;  2ZT9 C;  3GPV A;  1ZRT E;  3QAO A;  3UCS A;  1K04 A;  3LW5 J;  4R24 B;  3Q5R A;  1NGM B;  2E75 D;  3AEF C;  3HH0 A;  2KCU A;  3D70 A;  4RKU J;  1MKM A;  4IL6 X;  2BOW A;  3E0H A;  1WMK A;  4B0Y A;  5M1B A;  1AJY A;  4R4L A;  3AEC C;  1K05 A;  3IAO A;  2E74 C;  1R8E A;  1Y6U A;  3Q5P A;  4H44 D;  3IN6 A;  3SFE C;  2ZHG A;  2NZ2 A;  3AE2 C;  3B71 A;  4H44 C;  1PM6 A;  2MKV A;  2OG0 A;  1PV3 A;  2G8Y A;  1Q09 A;  2IEF A;  2E76 D;  3AE9 C;  3FGA D;  3RK3 E;  4A1M A;  1ZP0 C;  2BEZ F;  4H13 D;  1KQF B;  4DCZ A;  1HF9 A;  3AE5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...