1EXJA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
total genus 68
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exjA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exjA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exjA01
2VZ4A 1Q09A 1Q05A 2ZHHA 3B49A 5KATA 3D70A 2KCUA 1D5YA 5KAUA 3Q3DA 3Q2YA 5KCBA 3Q5PA 1BOWA 3D71A 3D6ZA 4A1MA 2GOVA 3R8JA 5KAXA 3D6YA 2ZHGA 3QAOA 4R22B 5E01A 3GK6A 3Q5RA 2DG6A 1JBGA 3GPVA 3IAOA 1Q06A 5D90A 1Q0AA 2J5UA 3Q1MA 1R8EA 1DIPA 5KAVA 5GQQA 5I41B 3GP4A 5KAWA 4AYZB 2HVAA 3G9RA 4B0YA 1JYHA 3LURA 4WLWA 4R4EA 3T97B 3Q5SA 2BOWA 1Q07A 1Q08A 4R4MA 1R8DA 3R8KA 2JMLA 4R24B 5D8CA 3UCSA 3E0HA 4AYZA 2OQQA 3HH0A 1EXIA 4J2NA 4WLSA 1EXJA 4R4LA 5I44A
chains in the Genus database with same CATH superfamily
3B49A 1USDA 2OYIA 1NTZE 3RL0D 4H13B 3CD6P 5KAXA 1FDIA 3NTNA 1FJPA 4D6TG 4AYZB 3G9RA 1MV8A 1D7MA 3VMYA 1FAVA 1BGYJ 3M9HA 1BSHA 3RK2B 2WSFJ 1USEA 2Q5UA 3A0BE 2WITA 3L72J 2MJZA 1NWQA 2XZRA 1YJNP 1ZLLA 1H88A 1Q7YQ 1VQNP 5APWA 1BGYG 2R5DA 3B5NB 2WSEH 1YJ9P 4R4EA 3WU2H 1GU4A 1OVRA 1E5WA 3LIDA 1NTMD 1Q05A 4DZOA 1FE6A 3EQ2A 3AEGC 3H32A 1KQFB 3LW5H 4R22B 1T3UA 1OZHA 2FYUD 3CWBE 2KIKA 1HH0A 4OH8B 5TISH 3NFQA 1Q86Q 1SQVD 2O1JA 1JO5A 2OYIC 3C1LA 1SFCC 4KHXA 3PH0A 2P2UA 1KORA 2AXCA 1NTKD 2K1AA 1RH6A 3GP4A 2Y9ZA 3P7KA 1FZFA 1OVVA 1SLQA 5AW9B 4NPEA 2ZT9D 1VQ5P 1NTKK 4IOIH 5H2FH 1VQ8P 1VL2A 4JPZB 1OMIA 2KLVA 4LHFA 1YITP 3KQGA 2N1TA 3BRTB 3R4YA 1HF9A 1JY3P 2CK3H 5TJHA 3HRNA 4C7RA 2QJPB 2HYNA 3QWOC 2FYUJ 3TSIA 3B71A 2H88C 1G1JA 2KZJA 2N1TB 3CC2P 3WU2E 1KFNA 1BCCD 2M8RA 3L73E 1BE3E 5E79E 2QJKC 1GW3A 2WTYA 1KILC 1RH5B 4N6JA 2IZ1A 4R4LA 1LTSC 2Q3EA 3VMZA 3B8EB 1VQ7P 2WPQA 2WPRA 2FXOA 3Q5RA 2BCCG 1RE4C 3TGUG 2C0WA 1YJWP 1M1JC 3AECC 2A06D 1CW5A 1KB9I 3CXHI 1CI6A 1MFZA 2Q3IA 3CWBJ 1EZVG 3CC7P 2XU6A 1L0LK 2B87B 2QG4A 4JQ0D 1SQBG 2ZAEB 2C9LY 3M0AA 3AEBC 3CWBG 2O01N 3KYQA 5EFWB 3ABVC 1H0TB 3H32B 4WY4A 3Q5PA 4KT0J 4EDFA 4XA4A 3O6QB 1BGYE 1KFMA 1BE3D 4J2NA 1LP1A 2WSSH 1PGOA 2YKPA 3OAKA 1Y8AA 1NTMJ 1SQVE 1NU1G 2ZVOB 1L2PA 2FXMA 1FZCC 2GOVA 1NTZD 2Y0EA 5D90A 1WT6A 2HFED 1M1JA 2QM8A 2Z5IA 1T6AA 3V6IA 4OWFA 2FFDC 1S72P 5KJ7D 1QEXA 1LGHB 1J1DC 1VF5C 3Q2YA 1ZRTD 3CL3D 1SQVK 4EOTA 3GK6A 2PRRA 3H1KG 2KNCB 1IFMA 2Y0DA 1DD3A 1P84D 2O01H 3V2RA 3UCSA 3H1JG 2OQQA 2J59M 1GDTA 1LWUB 3L70G 2Z4EA 3D71A 1T2KD 5E79H 1SQXJ 2KI7B 3IAOA 3HE5A 1BE3J 1R5LA 4IL6H 2W6AA 3S1KA 2ZT9B 4I7ZC 1FDMA 2C9NY 3HTKB 2M5AB 4AYCA 1KB9D 1KB9H 2KCUA 2W8ZA 1HWTC 1ZV8A 3A7OA 5AW2B 5KLVK 3WMM0 3SWFA 5BU5A 3L73G 1SQQK 1JB0J 3TNUB 1CI6B 4ZKPA 1MKMA 3H1LJ 3HE4A 2YXRB 5H2FE 1BGYD 4OVNF 3C9IA 2HG5D 4GIFA 2CPBA 2MKVA 4PD4I 3GF3A 4N78D 2K37A 1Q0AA 1DIPA 3B4SA 1NVOA 1H0TA 1Q08A 3FWNA 1S3JA 3N4XA 4OGQD 4PD4D 2M3BA 3ITKA 1G2CA 1LT1A 5APVA 4ZKUA 1A02J 1URQD 1KB9E 2N9YB 2QEXP 1S5LX 1KQLA 4RJTA 3VP9A 3Q5SA 4BXLA 1KYOD 4AYZA 2XV5A 1Q81Q 1JY3N 3JCUE 1N7SA 2Q9IA 1FZGA 5KATA 1RE3A 3G3ZA 1SP4A 2KOGA 1AV1A 5CJ0A 3AEAC 2GUSA 1VQLP 1N73B 2KS1B 1DX7A 1L4AD 1MFTA 2E75B 2L5GB 3L75G 4L73A 2NPSB 5KAFE 2HVAA 2RKLA 2E42A 3TK1A 1ZXGA 3E0HA 1NTZJ 2QSIA 3H25A 3M0DC 2LXCB 1JTHA 1KYOE 4DOJA 4A7PA 2B88A 3VMAA 5E01A 1FS0E 3MHVA 2FXPA 4D6TE 2V4HA 4WVZA 1PPJD 5CCHA 1N86A 1NTZG 2KUBA 2BCCD 2QE7H 3G71P 2B89A 2A06G 3D70A 2JWDA 5AW4B 1E79H 3TNUA 1ZR2A 1OW8A 3AE9C 1BDCA 2AXTE 5KLVG 1QL1A 1SFCA 4N78E 3CCRP 3H1HG 1SFCD 5APYA 3II6A 5KAFH 1G1IA 1N7LA 5AW7B 3L4FA 3EZ6A 2FYUE 3CWBD 4EYYQ 1M56D 5AVSB 2H43A 3R8JA 2P1JA 2FY8A 4GOFA 4I6MC 2E76D 1H89A 4LGDE 1HUCA 3VP8A 2Y0CA 4YPCA 1EQ7A 3W68A 2B87A 2N1TC 5TISE 4U3FJ 3AE2C 3VOPA 3CI9A 1LTTC 1N8RQ 2DG6A 1LTJA 4Y99C 1KILB 2IBZE 2E43A 3B5NA 4GOEA 3L73D 1KILD 3NXSA 3CLQA 2ZVNB 2WSCJ 1Q82Q 4TT3H 3W67A 3Q3DA 1KC8Q 1BOWA 3A0HE 2IEFA 3LW5J 3MD0A 1JY2O 1U57A 5I41B 2GUVA 1KYOI 5BVZA 1URQA 1W2BO 3CCSP 2K88A 4HYTB 5AW3B 4EIJA 3CCJP 3L74G 1KV4A 3L70D 1SQBE 5B5EE 3L37A 2KP8A 5B66H 3RL0g 2IDBA 1S2EA 1NTMG 1FZBA 3KHUA 2ZXXA 3I5CA 1DEEG 3O6QA 1S1CX 1PZQA 4IFMA 1GTWA 5AVRB 3F89A 2Z5HA 2RH0A 2M0BA 1VQ6P 1IO4A 2QIWA 3AE7C 3CX5D 3TF5A 4C7NB 1NTKE 1EDJA 1RQUA 4HKZH 4WLSA 3S9OA 4IL6X 1NTKG 5KJ7C 1NU1E 3I55P 4D6TD 1HJ0A 3H1KJ 4H0LD 2VRSA 3GPVA 1NTME 3AEDC 5CCGD 4IFFA 2Q1KA 1GMJA 3H1LD 1URQC 1PGJA 2POHA 3OW2O 2JMLA 3L70J 1FZCA 4TLFA 2PGDA 4GODA 1JCCA 4PD4E 1ZR4A 5AVVB 1LTBC 1GZLA 1SQBK 5KKZC 3V5BA 3L71J 4XFJA 1AVOA 2KXPB 2XNXA 2QM7A 3Q1MA 1QL2A 2P7JA 2PP6A 3M9QA 1S9KD 4Y28J 1EDIA 1ZMEC 1YYCA 3M0DA 1BCCG 2IYPA 3P8MC 5KAIH 4H13D 1J1EB 3H1IJ 4I7ZB 3JCUH 3KDPB 2FYNC 5KTBA 1LTAC 3EWKA 3PLNA 1BCCJ 2IPPA 1VQ4P 2OTLP 1D5YA 1NAYA 5AW0B 3CCLP 2I1KA 1L4AC 3H6PA 1QX8A 1JUNA 2ZXEB 2QJKB 3L71D 4WY4D 5APXA 3BRVB 2NPSD 2QJYB 1PIXA 1L0NJ 4AUWA 4MN4C 2A45H 3FWLA 1LT9C 5APSA 3AEFC 3SWYA 2WSCH 2BCCE 1GW4A 3GG2A 1KZUB 2HR3A 3VMXA 3L75E 4Z1MH 1YHQP 3H1ID 5GTIE 5AVTB 3GLMA 3E1RA 5K5GB 1NKNA 4W7YA 1RF1B 5CCGA 1OWAA 4B0YA 1WMKA 4C46A 5AVQB 2KNCA 3SSUA 5GTIH 3CX5E 2BEQD 3A0HH 4WB4A 1PP9G 3FXEA 3H1HD 3TGUD 1OVUA 5AW6B 2P58A 1VQKP 5AVXB 1N2DC 1SQBJ 3VN0A 1N73C 2WPSA 1FOSF 1EZVD 1PP9J 3HH0A 2DW3A 1SQBD 3R2PA 4KJMA 2OARA 2E76B 5BU8B 4I2LC 2B9BA 3A2AA 1FJKA 3H1JD 3RL0B 2XKMA 1S5LE 3VYIA 1JCDA 5KLVE 1LNQA 1EXJA 3HE4B 3P8CD 5I44A 2XDJA 2IBZG 1VF5B 3WUTA 5KLVJ 1IFNA 1X79B 2Q6QA 3D6YA 1NU1J 1S5LH 3L72E 4H44D 3MP7B 3V2QA 2JDIH 1SQPD 4H0LC 3JC22 4U3FE 5AVYB 3WUVA 1P84H 2QVAA 1SQPJ 2FYZA 5CCHC 3MUDA 1KILA 1R8EA 1N73A 1OX3A 1PM6A 5DJUB 4PV1D 3QH9A 1ZRTE 3RBZA 3AEEC 1YBKA 1ZN5A 2LR2A 4U3FG 1OW6A 3H1JJ 1RE4A 2ZHHA 3BATA 2YNYA 4GT1A 2OYOA 4PV1C 5C39A 3CCEP 1EC5A 2RMZA 3RGUA 3L36A 3RK3B 2E74C 2I1JA 3EZFA 3H1IE 2H8PD 3RK3D 1FBMA 4DCZA 1VQ9P 4H44C 1VQOP 1KMIZ 1SQQD 2WPVB 4JYBA 3HUSA 2OYHA 1SQVJ 4DJGA 3G6EP 2E75D 3ZDMA 3GMAA 1M1KQ 3EZ7A 3R8KA 1BSNA 1SQQE 3FXDA 3H1LG 4RESB 3FX0A 2KLUA 3PJSK 3MUDC 1LTJC 1RQVA 1JTHB 3MGNA 3G4SP 3L70E 1L0LE 3AE4C 2RN0A 3H1KE 3FGAD 2FFDA 3E7KA 1KILE 2WT7A 1UIXA 1LT9A 2C0XA 4UB6H 4R4MA 1NTKJ 1FZAA 3PHLA 4PJ0E 1AQ5A 1NAFA 1A02F 3CCQP 4GDOA 1Y9BA 2M5AA 2ZHGA 2E75C 2ITAA 1HJBA 1LT9B 5GQQA 1IFJA 2SPZA 3KZIE 3IR9A 2FBWC 2OGUA 1JYHA 4K35A 2P10A 1EXIA 3BCCJ 1JM0A 2JWAA 3S4RA 2JO1A 4CPGA 1ZP0C 5KLVD 5L8RJ 1SS1A 4LLHA 2HPCA 3HD7B 4LC1A 3H1LE 2E5TA 2KZIA 1URQB 3CPWO 2W83C 2K9JA 3L75J 1X22A 1QLED 2IX7C 2L91A 5KJ7A 3BCCG 1H8AA 3IF4A 2KSJA 3KPEA 1N7SD 1GU5A 4O9BA 2IFNA 2IFMA 5CHXA 1G2CB 1LTIC 3JSVC 1M8OB 1Q2NA 1IK9A 2YO2A 4WY4B 3MZWB 4K3AA 2H89C 2FKWB 1PPJG 2NZ2A 1J1EC 1JOCA 1GL2C 1M57D 1VPCA 4C7NA 1Q06A 4UB8H 3RL0C 1PPJE 1PV3A 5AW5B 1NTMK 5APUA 3L72G 1M7LA 1L0NG 3H1HJ 1DEBA 4ZMDA 3H1JE 1HBWA 3GHGC 2IZ0A 2G8YA 1RHZB 3KZIH 1HVVA 1WRGA 1JMBA 1DD4A 3PRJA 1M90Q 5CCHD 1L4AB 1X0TA 1X8YA 1FOSE 4H0LB 5KLIC 1N7SC 5B5EH 3L74D 1KTMA 2ZJSE 1L4AA 3HTKA 3M9BA 1NKZB 3TYYA 3V4QA 1K05A 1R5SA 3U1CA 1T3JA 3H1HE 1SQQG 1S4XA 2GM4A 2YKOA 2ZYGA 2HODB 4JF7A 1SVFA 2YIUB 1NHLA 4BRYA 1RF0A 4PV1B 3TGUJ 1PFIA 2OTKE 4L74A 1JBGA 3OA7A 1GL2D 1KN7A 2WVRA 1KQGB 1SQPK 4YTPC 2W90A 1SFCB 4YXWH 3HD7A 3EFFK 2KB7P 1IC2A 2K9JB 1KD1Q 1PP9E 2J5UA 3EFGA 4IFDK 1GK4A 1JY2P 3SFDC 1Z56A 2D2CC 2FYUG 1L0LG 1YQ4C 2W6BA 1LTGC 5M1BA 1VQPP 2I8DA 1T2KC 3IFMA 1LP1B 2QRXA 4OGQB 5DJTB 4GKGA 4ASWA 2AXTH 2WWWA 1KYOH 1QVGO 1Y6UA 2JEEA 4N3YB 1YQ3C 1DH3A 1RF0C 1Q09A 4H13C 2P67A 3AE3C 1IFPA 4AQRD 5KKZB 1NH4A 5APTA 3U59A 1HGZA 1K8AQ 2NRGA 1EDLA 3LURA 4U7JA 1P84E 2K3RA 2NPSA 3EZ2A 2ZYAA 5AW1B 4RKUJ 2E5YA 2HLOA 2JR8A 4UB8E 3CMEP 3L71E 3U1AA 1OIPA 5GTHE 2O1KA 5KCBA 3B5NC 2R44A 5KAVA 3L71G 1LWUA 1RF1A 3AE5C 1YTZT 1IJDB 1NO4A 2FYNB 5D8CA 1XTCC 3V2PA 4ASVA 3SWKA 4JBZA 4B86A 1BE3G 1GK6A 2K9YA 1NJIQ 3D6ZA 2UWJE 4UB6E 1NU1D 4L76A 2E74B 1R8DA 1PGPA 4QMAA 3BASA 3H1IG 3O8ZA 4BRYB 2OYIB 2W6JH 1AA0A 1P84I 3RK2C 1S9KE 3USSA 3CCMP 5KAUA 3MTUE 2QJYC 1X9VA 1SQXD 2WT7B 4WBAA 2LXBA 1AVYA 1MUUA 3RK3E 1J2JB 1OXZA 2R3CA 1PP9D 1FDOA 2R3SA 3MIWA 2O01J 2YMYA 2E74D 2WMMA 2OTJP 2AEMA 2KYVA 3C8VA 3GF7A 4HJGH 1FZCB 2R32A 4A1MA 1RF1C 2FFDB 1OFCX 3RK2D 1RE3C 1QVFO 1JNMA 4L75A 3GHGB 5APQA 2HPCB 1PL5A 1NU1K 4H44B 2CPSA 2JP3A 2YO3A 2A45I 1SQXE 1JEKA 1YIJP 3F5HA 2IBZD 3L74E 1W2EA 4W80A 3KXDA 3N7NA 3HUSB 2OYHB 3L35A 3CX5H 3L72D 2J58A 1LTJB 3A0BH 1L0ND 2E76C 1U7JA 4PD4H 4JYCA 3K5BA 2IYOA 5KAWA 3P8CE 2KS1A 2ZT9C 1Q07A 1Q90D 3T97A 3H1KD 1Y47A 1GD2E 1K9MQ 1EDKA 3AE6C 2WSEJ 1L0LD 3BCCE 3HD7C 1AQTA 3UIAA 3AE8C 1ZOYC 3A3YB 3A5TA 1L0NK 1YI2P 2YMKA 3AE1C 1LX8A 5KAIE 2WQYC 4DT0A 2WSFH 3WUUA 5GTHH 2D2CD 2M3EA 4PJ0H 1ZW0A 5CBOA 2O3JA 1PGQA 1SQXK 2LKMA 2N9BA 4WLWA 4WWIA 4NPDA 3GW6A 5CJ4A 5CMZA 4YXDC 3M91A 1GL2B 2R5BA 4EI2A 2XNDH 1SQPG 5AVUB 1FZEA 3NMDA 3CCUP 1TU3F 3PP5A 2V7QJ 1YTZI 2HODA 3L75D 2BCCJ 4R24B 3RK3C 1JMMA 3CX5I 3IN6A 2BEZF 2KVVA 1J1DB 1GL2A 5CCGC 2V7QH 2A06E 1L0NE 4BWNA 2G3AA 1SQQJ 1NOHA 3E1IA 1HGVA 1T8ZA 2YKQA 5AVWB 3HD7D 2AEFA 4U3FD 4HH2A 2YXQB 3GHGA 3HE5B 1LWUC 4DCKA 4XE5B 2BOWA 1JY3O 4NPFX 2Q7CA 3I56P 5B66E 2AEJA 3LIEA 1VF5D 1BCCE 3M06A 1K73Q 1IFDA 1SQVG 3CC4P 2KSEA 4HB1A 3EZ9A 2JKVA 2QJPC 3RBXA 3TDKA 2WZ7A 2KK7A 1XTGB 2W27A 3P32A 3CMAP 3T97B 1L0LJ 3CXHH 2IBZI 3CXHD 5KLIB 1HTLC 5AW8B 2OG0A 1N7SB 2BASA 2A45G 3B5ND 1RY3A 5CBNA 1EZVE 1CSBA 4IL6E 1M1JB 1UIIA 3TGUE 2VZ4A 1CZQA 1QGKB 2Y9YA 2YIUC 2JJLA 2ZYDA 1AFOA 4W7ZA 3QAOA 1NYHA 2N1TD 1IZNB 2PFXA 1OW7A 3V2NA 1EZVI 1SQXG 1IK7A 4ZNCA 3V4WA 1KQSO 1W5CE 3SFEC 1AJYA 1VDFA 1VQMP 3CCVP 3OJAB 2QA4P 1NGMB 3VTPC 3PTZA 2PAJA 3BVHA 2ZFCA 4Y99B 1U7MA 1NTZK 1IFIA 1K04A 3L73J 2D2CB 3HUSC 2OYHC 4WY4C 3L74J 4M3LA 2GA1A 2NPSC 3CXHE 1SQPE 3BCCD 4I1LA 1MZ9A 4RO0A 2FYUK 1FC2C 4D6TJ 2H7HA 4OGQC 1LJ2A 5AVZB 1FU1A 1JY2N 1BDDA
chains in the Genus database with same CATH topology
3B49A 4YXDC 1VL2A 2KCUA 1PL5A 1RQVA 1HJ0A 1VF5B 3Q5PA 4PV1B 1PIXA 4H13B 3AE2C 2E75B 1OMIA 4H44B 5KAXA 1FDIA 3D6YA 5KCBA 4H0LD 2DG6A 1JBGA 3GPVA 4H44D 4KT0J 5KAVA 2JP3A 3AEDC 4LHFA 4AYZB 2HVAA 1GMJA 3AEFC 1JB0J 1TU3F 3G9RA 3R4YA 4H0LC 2V7QJ 1HF9A 1MKMA 3AE5C 1KQGB 2JMLA 4R24B 5D8CA 3E0HA 4YTPC 4J2NA 2WSFJ 3IN6A 4Z1MH 2BEZF 2KVVA 2QSIA 3H25A 2WSCJ 2VZ4A 2H89C 3AE4C 4TT3H 2YIUC 3Q3DA 3B71A 2K9YA 2H88C 2G3AA 2MKVA 2NZ2A 3GF3A 3GLMA 5KKZC 1BOWA 3D6ZA 2E76C 3FGAD 2GOVA 3QAOA 5E01A 2IEFA 1NYHA 2FXPA 4XFJA 1Q06A 5D90A 1Q0AA 2J5UA 3Q1MA 1R8EA 1U57A 3LW5J 1DIPA 5I41B 1KILE 1OW7A 5KAWA 1PV3A 1PM6A 2E74B 4B0YA 1UIXA 1WMKA 3SFDC 1IK7A 4R4EA 2ZT9C 4PV1D 1Q07A 1Q08A 1Q90D 2D2CC 2QJKC 4R4MA 1ZRTE 1R8DA 3AEEC 1YQ4C 2BEQD 3SFEC 1OW6A 1AJYA 4OGQD 4R4LA 2BOWA 4Y28J 3AE6C 1Q05A 1ZMEC 2ZHHA 3D70A 1VF5C 2WSEJ 5KAUA 3Q2YA 2G8YA 4GDOA 1NGMB 3AEGC 1KQFB 1Y9BA 2QJYC 4PV1C 3AE8C 1OW8A 2ZHGA 4R22B 1DD4A 2E75C 5M1BA 3Q5RA 1ZOYC 3GK6A 1VF5D 3AE9C 4H13D 2YMKA 5GQQA 4H0LB 3AE1C 3RK3E 1S5LX 3RL0g 1LX8A 2FBWC 4I7ZB 2IDBA 5KLIC 1JYHA 1DD3A 4OGQB 2FYNC 3Q5SA 2WQYC 2P10A 3AECC 2E74C 1FDOA 4AYZA 3UCSA 3EZFA 1K04A 2OQQA 3HH0A 1EXIA 3EWKA 1Y6UA 2D2CB 3EZ9A 1YQ3C 2O01J 3EZ6A 2D2CD 3O6QA 4DCZA 2E74D 2QJPC 1Q09A 2JO1A 1S1CX 4H13C 1KTMA 1D5YA 4H44C 3AE3C 3C8VA 3GF7A 1ZP0C 2E76B 1KMIZ 2WPVB 1KORA 3D71A 5L8RJ 3R8JA 1K05A 4A1MA 1RH6A 3T97B 5KATA 3IAOA 2E76D 3GP4A 3AEBC 2E75D 3LURA 4WLWA 2QIWA 4U7JA 3AE7C 3AEAC 3GMAA 1RQUA 2ZT9B 3EZ7A 4I7ZC 3R8KA 4OGQC 3EZ2A 3ABVC 2ZT9D 2OG0A 4WLSA 1EXJA 3S9OA 4IL6X 4RKUJ 5I44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZ4 A;  1Q09 A;  1Q05 A;  2ZHH A;  3B49 A;  5KAT A;  3D70 A;  2KCU A;  1D5Y A;  5KAU A;  3Q3D A;  3Q2Y A;  5KCB A;  3Q5P A;  1BOW A;  3D71 A;  3D6Z A;  4A1M A;  2GOV A;  3R8J A;  5KAX A;  3D6Y A;  2ZHG A;  3QAO A;  4R22 B;  5E01 A;  3GK6 A;  3Q5R A;  2DG6 A;  1JBG A;  3GPV A;  3IAO A;  1Q06 A;  5D90 A;  1Q0A A;  2J5U A;  3Q1M A;  1R8E A;  1DIP A;  5KAV A;  5GQQ A;  5I41 B;  3GP4 A;  5KAW A;  4AYZ B;  2HVA A;  3G9R A;  4B0Y A;  1JYH A;  3LUR A;  4WLW A;  4R4E A;  3T97 B;  3Q5S A;  2BOW A;  1Q07 A;  1Q08 A;  4R4M A;  1R8D A;  3R8K A;  2JML A;  4R24 B;  5D8C A;  3UCS A;  3E0H A;  4AYZ A;  2OQQ A;  3HH0 A;  1EXI A;  4J2N A;  4WLS A;  1EXJ A;  4R4L A;  5I44 A; 
#chains in the Genus database with same CATH topology
 3B49 A;  1USD A;  2OYI A;  1NTZ E;  3RL0 D;  4H13 B;  3CD6 P;  5KAX A;  1FDI A;  3NTN A;  1FJP A;  4D6T G;  4AYZ B;  3G9R A;  1MV8 A;  1D7M A;  3VMY A;  1FAV A;  1BGY J;  3M9H A;  1BSH A;  3RK2 B;  2WSF J;  1USE A;  2Q5U A;  3A0B E;  2WIT A;  3L72 J;  2MJZ A;  1NWQ A;  2XZR A;  1YJN P;  1ZLL A;  1H88 A;  1Q7Y Q;  1VQN P;  5APW A;  1BGY G;  2R5D A;  3B5N B;  2WSE H;  1YJ9 P;  4R4E A;  3WU2 H;  1GU4 A;  1OVR A;  1E5W A;  3LID A;  1NTM D;  1Q05 A;  4DZO A;  1FE6 A;  3EQ2 A;  3AEG C;  3H32 A;  1KQF B;  3LW5 H;  4R22 B;  1T3U A;  1OZH A;  2FYU D;  3CWB E;  2KIK A;  1HH0 A;  4OH8 B;  5TIS H;  3NFQ A;  1Q86 Q;  1SQV D;  2O1J A;  1JO5 A;  2OYI C;  3C1L A;  1SFC C;  4KHX A;  3PH0 A;  2P2U A;  1KOR A;  2AXC A;  1NTK D;  2K1A A;  1RH6 A;  3GP4 A;  2Y9Z A;  3P7K A;  1FZF A;  1OVV A;  1SLQ A;  5AW9 B;  4NPE A;  2ZT9 D;  1VQ5 P;  1NTK K;  4IOI H;  5H2F H;  1VQ8 P;  1VL2 A;  4JPZ B;  1OMI A;  2KLV A;  4LHF A;  1YIT P;  3KQG A;  2N1T A;  3BRT B;  3R4Y A;  1HF9 A;  1JY3 P;  2CK3 H;  5TJH A;  3HRN A;  4C7R A;  2QJP B;  2HYN A;  3QWO C;  2FYU J;  3TSI A;  3B71 A;  2H88 C;  1G1J A;  2KZJ A;  2N1T B;  3CC2 P;  3WU2 E;  1KFN A;  1BCC D;  2M8R A;  3L73 E;  1BE3 E;  5E79 E;  2QJK C;  1GW3 A;  2WTY A;  1KIL C;  1RH5 B;  4N6J A;  2IZ1 A;  4R4L A;  1LTS C;  2Q3E A;  3VMZ A;  3B8E B;  1VQ7 P;  2WPQ A;  2WPR A;  2FXO A;  3Q5R A;  2BCC G;  1RE4 C;  3TGU G;  2C0W A;  1YJW P;  1M1J C;  3AEC C;  2A06 D;  1CW5 A;  1KB9 I;  3CXH I;  1CI6 A;  1MFZ A;  2Q3I A;  3CWB J;  1EZV G;  3CC7 P;  2XU6 A;  1L0L K;  2B87 B;  2QG4 A;  4JQ0 D;  1SQB G;  2ZAE B;  2C9L Y;  3M0A A;  3AEB C;  3CWB G;  2O01 N;  3KYQ A;  5EFW B;  3ABV C;  1H0T B;  3H32 B;  4WY4 A;  3Q5P A;  4KT0 J;  4EDF A;  4XA4 A;  3O6Q B;  1BGY E;  1KFM A;  1BE3 D;  4J2N A;  1LP1 A;  2WSS H;  1PGO A;  2YKP A;  3OAK A;  1Y8A A;  1NTM J;  1SQV E;  1NU1 G;  2ZVO B;  1L2P A;  2FXM A;  1FZC C;  2GOV A;  1NTZ D;  2Y0E A;  5D90 A;  1WT6 A;  2HFE D;  1M1J A;  2QM8 A;  2Z5I A;  1T6A A;  3V6I A;  4OWF A;  2FFD C;  1S72 P;  5KJ7 D;  1QEX A;  1LGH B;  1J1D C;  1VF5 C;  3Q2Y A;  1ZRT D;  3CL3 D;  1SQV K;  4EOT A;  3GK6 A;  2PRR A;  3H1K G;  2KNC B;  1IFM A;  2Y0D A;  1DD3 A;  1P84 D;  2O01 H;  3V2R A;  3UCS A;  3H1J G;  2OQQ A;  2J59 M;  1GDT A;  1LWU B;  3L70 G;  2Z4E A;  3D71 A;  1T2K D;  5E79 H;  1SQX J;  2KI7 B;  3IAO A;  3HE5 A;  1BE3 J;  1R5L A;  4IL6 H;  2W6A A;  3S1K A;  2ZT9 B;  4I7Z C;  1FDM A;  2C9N Y;  3HTK B;  2M5A B;  4AYC A;  1KB9 D;  1KB9 H;  2KCU A;  2W8Z A;  1HWT C;  1ZV8 A;  3A7O A;  5AW2 B;  5KLV K;  3WMM 0;  3SWF A;  5BU5 A;  3L73 G;  1SQQ K;  1JB0 J;  3TNU B;  1CI6 B;  4ZKP A;  1MKM A;  3H1L J;  3HE4 A;  2YXR B;  5H2F E;  1BGY D;  4OVN F;  3C9I A;  2HG5 D;  4GIF A;  2CPB A;  2MKV A;  4PD4 I;  3GF3 A;  4N78 D;  2K37 A;  1Q0A A;  1DIP A;  3B4S A;  1NVO A;  1H0T A;  1Q08 A;  3FWN A;  1S3J A;  3N4X A;  4OGQ D;  4PD4 D;  2M3B A;  3ITK A;  1G2C A;  1LT1 A;  5APV A;  4ZKU A;  1A02 J;  1URQ D;  1KB9 E;  2N9Y B;  2QEX P;  1S5L X;  1KQL A;  4RJT A;  3VP9 A;  3Q5S A;  4BXL A;  1KYO D;  4AYZ A;  2XV5 A;  1Q81 Q;  1JY3 N;  3JCU E;  1N7S A;  2Q9I A;  1FZG A;  5KAT A;  1RE3 A;  3G3Z A;  1SP4 A;  2KOG A;  1AV1 A;  5CJ0 A;  3AEA C;  2GUS A;  1VQL P;  1N73 B;  2KS1 B;  1DX7 A;  1L4A D;  1MFT A;  2E75 B;  2L5G B;  3L75 G;  4L73 A;  2NPS B;  5KAF E;  2HVA A;  2RKL A;  2E42 A;  3TK1 A;  1ZXG A;  3E0H A;  1NTZ J;  2QSI A;  3H25 A;  3M0D C;  2LXC B;  1JTH A;  1KYO E;  4DOJ A;  4A7P A;  2B88 A;  3VMA A;  5E01 A;  1FS0 E;  3MHV A;  2FXP A;  4D6T E;  2V4H A;  4WVZ A;  1PPJ D;  5CCH A;  1N86 A;  1NTZ G;  2KUB A;  2BCC D;  2QE7 H;  3G71 P;  2B89 A;  2A06 G;  3D70 A;  2JWD A;  5AW4 B;  1E79 H;  3TNU A;  1ZR2 A;  1OW8 A;  3AE9 C;  1BDC A;  2AXT E;  5KLV G;  1QL1 A;  1SFC A;  4N78 E;  3CCR P;  3H1H G;  1SFC D;  5APY A;  3II6 A;  5KAF H;  1G1I A;  1N7L A;  5AW7 B;  3L4F A;  3EZ6 A;  2FYU E;  3CWB D;  4EYY Q;  1M56 D;  5AVS B;  2H43 A;  3R8J A;  2P1J A;  2FY8 A;  4GOF A;  4I6M C;  2E76 D;  1H89 A;  4LGD E;  1HUC A;  3VP8 A;  2Y0C A;  4YPC A;  1EQ7 A;  3W68 A;  2B87 A;  2N1T C;  5TIS E;  4U3F J;  3AE2 C;  3VOP A;  3CI9 A;  1LTT C;  1N8R Q;  2DG6 A;  1LTJ A;  4Y99 C;  1KIL B;  2IBZ E;  2E43 A;  3B5N A;  4GOE A;  3L73 D;  1KIL D;  3NXS A;  3CLQ A;  2ZVN B;  2WSC J;  1Q82 Q;  4TT3 H;  3W67 A;  3Q3D A;  1KC8 Q;  1BOW A;  3A0H E;  2IEF A;  3LW5 J;  3MD0 A;  1JY2 O;  1U57 A;  5I41 B;  2GUV A;  1KYO I;  5BVZ A;  1URQ A;  1W2B O;  3CCS P;  2K88 A;  4HYT B;  5AW3 B;  4EIJ A;  3CCJ P;  3L74 G;  1KV4 A;  3L70 D;  1SQB E;  5B5E E;  3L37 A;  2KP8 A;  5B66 H;  3RL0 g;  2IDB A;  1S2E A;  1NTM G;  1FZB A;  3KHU A;  2ZXX A;  3I5C A;  1DEE G;  3O6Q A;  1S1C X;  1PZQ A;  4IFM A;  1GTW A;  5AVR B;  3F89 A;  2Z5H A;  2RH0 A;  2M0B A;  1VQ6 P;  1IO4 A;  2QIW A;  3AE7 C;  3CX5 D;  3TF5 A;  4C7N B;  1NTK E;  1EDJ A;  1RQU A;  4HKZ H;  4WLS A;  3S9O A;  4IL6 X;  1NTK G;  5KJ7 C;  1NU1 E;  3I55 P;  4D6T D;  1HJ0 A;  3H1K J;  4H0L D;  2VRS A;  3GPV A;  1NTM E;  3AED C;  5CCG D;  4IFF A;  2Q1K A;  1GMJ A;  3H1L D;  1URQ C;  1PGJ A;  2POH A;  3OW2 O;  2JML A;  3L70 J;  1FZC A;  4TLF A;  2PGD A;  4GOD A;  1JCC A;  4PD4 E;  1ZR4 A;  5AVV B;  1LTB C;  1GZL A;  1SQB K;  5KKZ C;  3V5B A;  3L71 J;  4XFJ A;  1AVO A;  2KXP B;  2XNX A;  2QM7 A;  3Q1M A;  1QL2 A;  2P7J A;  2PP6 A;  3M9Q A;  1S9K D;  4Y28 J;  1EDI A;  1ZME C;  1YYC A;  3M0D A;  1BCC G;  2IYP A;  3P8M C;  5KAI H;  4H13 D;  1J1E B;  3H1I J;  4I7Z B;  3JCU H;  3KDP B;  2FYN C;  5KTB A;  1LTA C;  3EWK A;  3PLN A;  1BCC J;  2IPP A;  1VQ4 P;  2OTL P;  1D5Y A;  1NAY A;  5AW0 B;  3CCL P;  2I1K A;  1L4A C;  3H6P A;  1QX8 A;  1JUN A;  2ZXE B;  2QJK B;  3L71 D;  4WY4 D;  5APX A;  3BRV B;  2NPS D;  2QJY B;  1PIX A;  1L0N J;  4AUW A;  4MN4 C;  2A45 H;  3FWL A;  1LT9 C;  5APS A;  3AEF C;  3SWY A;  2WSC H;  2BCC E;  1GW4 A;  3GG2 A;  1KZU B;  2HR3 A;  3VMX A;  3L75 E;  4Z1M H;  1YHQ P;  3H1I D;  5GTI E;  5AVT B;  3GLM A;  3E1R A;  5K5G B;  1NKN A;  4W7Y A;  1RF1 B;  5CCG A;  1OWA A;  4B0Y A;  1WMK A;  4C46 A;  5AVQ B;  2KNC A;  3SSU A;  5GTI H;  3CX5 E;  2BEQ D;  3A0H H;  4WB4 A;  1PP9 G;  3FXE A;  3H1H D;  3TGU D;  1OVU A;  5AW6 B;  2P58 A;  1VQK P;  5AVX B;  1N2D C;  1SQB J;  3VN0 A;  1N73 C;  2WPS A;  1FOS F;  1EZV D;  1PP9 J;  3HH0 A;  2DW3 A;  1SQB D;  3R2P A;  4KJM A;  2OAR A;  2E76 B;  5BU8 B;  4I2L C;  2B9B A;  3A2A A;  1FJK A;  3H1J D;  3RL0 B;  2XKM A;  1S5L E;  3VYI A;  1JCD A;  5KLV E;  1LNQ A;  1EXJ A;  3HE4 B;  3P8C D;  5I44 A;  2XDJ A;  2IBZ G;  1VF5 B;  3WUT A;  5KLV J;  1IFN A;  1X79 B;  2Q6Q A;  3D6Y A;  1NU1 J;  1S5L H;  3L72 E;  4H44 D;  3MP7 B;  3V2Q A;  2JDI H;  1SQP D;  4H0L C;  3JC2 2;  4U3F E;  5AVY B;  3WUV A;  1P84 H;  2QVA A;  1SQP J;  2FYZ A;  5CCH C;  3MUD A;  1KIL A;  1R8E A;  1N73 A;  1OX3 A;  1PM6 A;  5DJU B;  4PV1 D;  3QH9 A;  1ZRT E;  3RBZ A;  3AEE C;  1YBK A;  1ZN5 A;  2LR2 A;  4U3F G;  1OW6 A;  3H1J J;  1RE4 A;  2ZHH A;  3BAT A;  2YNY A;  4GT1 A;  2OYO A;  4PV1 C;  5C39 A;  3CCE P;  1EC5 A;  2RMZ A;  3RGU A;  3L36 A;  3RK3 B;  2E74 C;  2I1J A;  3EZF A;  3H1I E;  2H8P D;  3RK3 D;  1FBM A;  4DCZ A;  1VQ9 P;  4H44 C;  1VQO P;  1KMI Z;  1SQQ D;  2WPV B;  4JYB A;  3HUS A;  2OYH A;  1SQV J;  4DJG A;  3G6E P;  2E75 D;  3ZDM A;  3GMA A;  1M1K Q;  3EZ7 A;  3R8K A;  1BSN A;  1SQQ E;  3FXD A;  3H1L G;  4RES B;  3FX0 A;  2KLU A;  3PJS K;  3MUD C;  1LTJ C;  1RQV A;  1JTH B;  3MGN A;  3G4S P;  3L70 E;  1L0L E;  3AE4 C;  2RN0 A;  3H1K E;  3FGA D;  2FFD A;  3E7K A;  1KIL E;  2WT7 A;  1UIX A;  1LT9 A;  2C0X A;  4UB6 H;  4R4M A;  1NTK J;  1FZA A;  3PHL A;  4PJ0 E;  1AQ5 A;  1NAF A;  1A02 F;  3CCQ P;  4GDO A;  1Y9B A;  2M5A A;  2ZHG A;  2E75 C;  2ITA A;  1HJB A;  1LT9 B;  5GQQ A;  1IFJ A;  2SPZ A;  3KZI E;  3IR9 A;  2FBW C;  2OGU A;  1JYH A;  4K35 A;  2P10 A;  1EXI A;  3BCC J;  1JM0 A;  2JWA A;  3S4R A;  2JO1 A;  4CPG A;  1ZP0 C;  5KLV D;  5L8R J;  1SS1 A;  4LLH A;  2HPC A;  3HD7 B;  4LC1 A;  3H1L E;  2E5T A;  2KZI A;  1URQ B;  3CPW O;  2W83 C;  2K9J A;  3L75 J;  1X22 A;  1QLE D;  2IX7 C;  2L91 A;  5KJ7 A;  3BCC G;  1H8A A;  3IF4 A;  2KSJ A;  3KPE A;  1N7S D;  1GU5 A;  4O9B A;  2IFN A;  2IFM A;  5CHX A;  1G2C B;  1LTI C;  3JSV C;  1M8O B;  1Q2N A;  1IK9 A;  2YO2 A;  4WY4 B;  3MZW B;  4K3A A;  2H89 C;  2FKW B;  1PPJ G;  2NZ2 A;  1J1E C;  1JOC A;  1GL2 C;  1M57 D;  1VPC A;  4C7N A;  1Q06 A;  4UB8 H;  3RL0 C;  1PPJ E;  1PV3 A;  5AW5 B;  1NTM K;  5APU A;  3L72 G;  1M7L A;  1L0N G;  3H1H J;  1DEB A;  4ZMD A;  3H1J E;  1HBW A;  3GHG C;  2IZ0 A;  2G8Y A;  1RHZ B;  3KZI H;  1HVV A;  1WRG A;  1JMB A;  1DD4 A;  3PRJ A;  1M90 Q;  5CCH D;  1L4A B;  1X0T A;  1X8Y A;  1FOS E;  4H0L B;  5KLI C;  1N7S C;  5B5E H;  3L74 D;  1KTM A;  2ZJS E;  1L4A A;  3HTK A;  3M9B A;  1NKZ B;  3TYY A;  3V4Q A;  1K05 A;  1R5S A;  3U1C A;  1T3J A;  3H1H E;  1SQQ G;  1S4X A;  2GM4 A;  2YKO A;  2ZYG A;  2HOD B;  4JF7 A;  1SVF A;  2YIU B;  1NHL A;  4BRY A;  1RF0 A;  4PV1 B;  3TGU J;  1PFI A;  2OTK E;  4L74 A;  1JBG A;  3OA7 A;  1GL2 D;  1KN7 A;  2WVR A;  1KQG B;  1SQP K;  4YTP C;  2W90 A;  1SFC B;  4YXW H;  3HD7 A;  3EFF K;  2KB7 P;  1IC2 A;  2K9J B;  1KD1 Q;  1PP9 E;  2J5U A;  3EFG A;  4IFD K;  1GK4 A;  1JY2 P;  3SFD C;  1Z56 A;  2D2C C;  2FYU G;  1L0L G;  1YQ4 C;  2W6B A;  1LTG C;  5M1B A;  1VQP P;  2I8D A;  1T2K C;  3IFM A;  1LP1 B;  2QRX A;  4OGQ B;  5DJT B;  4GKG A;  4ASW A;  2AXT H;  2WWW A;  1KYO H;  1QVG O;  1Y6U A;  2JEE A;  4N3Y B;  1YQ3 C;  1DH3 A;  1RF0 C;  1Q09 A;  4H13 C;  2P67 A;  3AE3 C;  1IFP A;  4AQR D;  5KKZ B;  1NH4 A;  5APT A;  3U59 A;  1HGZ A;  1K8A Q;  2NRG A;  1EDL A;  3LUR A;  4U7J A;  1P84 E;  2K3R A;  2NPS A;  3EZ2 A;  2ZYA A;  5AW1 B;  4RKU J;  2E5Y A;  2HLO A;  2JR8 A;  4UB8 E;  3CME P;  3L71 E;  3U1A A;  1OIP A;  5GTH E;  2O1K A;  5KCB A;  3B5N C;  2R44 A;  5KAV A;  3L71 G;  1LWU A;  1RF1 A;  3AE5 C;  1YTZ T;  1IJD B;  1NO4 A;  2FYN B;  5D8C A;  1XTC C;  3V2P A;  4ASV A;  3SWK A;  4JBZ A;  4B86 A;  1BE3 G;  1GK6 A;  2K9Y A;  1NJI Q;  3D6Z A;  2UWJ E;  4UB6 E;  1NU1 D;  4L76 A;  2E74 B;  1R8D A;  1PGP A;  4QMA A;  3BAS A;  3H1I G;  3O8Z A;  4BRY B;  2OYI B;  2W6J H;  1AA0 A;  1P84 I;  3RK2 C;  1S9K E;  3USS A;  3CCM P;  5KAU A;  3MTU E;  2QJY C;  1X9V A;  1SQX D;  2WT7 B;  4WBA A;  2LXB A;  1AVY A;  1MUU A;  3RK3 E;  1J2J B;  1OXZ A;  2R3C A;  1PP9 D;  1FDO A;  2R3S A;  3MIW A;  2O01 J;  2YMY A;  2E74 D;  2WMM A;  2OTJ P;  2AEM A;  2KYV A;  3C8V A;  3GF7 A;  4HJG H;  1FZC B;  2R32 A;  4A1M A;  1RF1 C;  2FFD B;  1OFC X;  3RK2 D;  1RE3 C;  1QVF O;  1JNM A;  4L75 A;  3GHG B;  5APQ A;  2HPC B;  1PL5 A;  1NU1 K;  4H44 B;  2CPS A;  2JP3 A;  2YO3 A;  2A45 I;  1SQX E;  1JEK A;  1YIJ P;  3F5H A;  2IBZ D;  3L74 E;  1W2E A;  4W80 A;  3KXD A;  3N7N A;  3HUS B;  2OYH B;  3L35 A;  3CX5 H;  3L72 D;  2J58 A;  1LTJ B;  3A0B H;  1L0N D;  2E76 C;  1U7J A;  4PD4 H;  4JYC A;  3K5B A;  2IYO A;  5KAW A;  3P8C E;  2KS1 A;  2ZT9 C;  1Q07 A;  1Q90 D;  3T97 A;  3H1K D;  1Y47 A;  1GD2 E;  1K9M Q;  1EDK A;  3AE6 C;  2WSE J;  1L0L D;  3BCC E;  3HD7 C;  1AQT A;  3UIA A;  3AE8 C;  1ZOY C;  3A3Y B;  3A5T A;  1L0N K;  1YI2 P;  2YMK A;  3AE1 C;  1LX8 A;  5KAI E;  2WQY C;  4DT0 A;  2WSF H;  3WUU A;  5GTH H;  2D2C D;  2M3E A;  4PJ0 H;  1ZW0 A;  5CBO A;  2O3J A;  1PGQ A;  1SQX K;  2LKM A;  2N9B A;  4WLW A;  4WWI A;  4NPD A;  3GW6 A;  5CJ4 A;  5CMZ A;  4YXD C;  3M91 A;  1GL2 B;  2R5B A;  4EI2 A;  2XND H;  1SQP G;  5AVU B;  1FZE A;  3NMD A;  3CCU P;  1TU3 F;  3PP5 A;  2V7Q J;  1YTZ I;  2HOD A;  3L75 D;  2BCC J;  4R24 B;  3RK3 C;  1JMM A;  3CX5 I;  3IN6 A;  2BEZ F;  2KVV A;  1J1D B;  1GL2 A;  5CCG C;  2V7Q H;  2A06 E;  1L0N E;  4BWN A;  2G3A A;  1SQQ J;  1NOH A;  3E1I A;  1HGV A;  1T8Z A;  2YKQ A;  5AVW B;  3HD7 D;  2AEF A;  4U3F D;  4HH2 A;  2YXQ B;  3GHG A;  3HE5 B;  1LWU C;  4DCK A;  4XE5 B;  2BOW A;  1JY3 O;  4NPF X;  2Q7C A;  3I56 P;  5B66 E;  2AEJ A;  3LIE A;  1VF5 D;  1BCC E;  3M06 A;  1K73 Q;  1IFD A;  1SQV G;  3CC4 P;  2KSE A;  4HB1 A;  3EZ9 A;  2JKV A;  2QJP C;  3RBX A;  3TDK A;  2WZ7 A;  2KK7 A;  1XTG B;  2W27 A;  3P32 A;  3CMA P;  3T97 B;  1L0L J;  3CXH H;  2IBZ I;  3CXH D;  5KLI B;  1HTL C;  5AW8 B;  2OG0 A;  1N7S B;  2BAS A;  2A45 G;  3B5N D;  1RY3 A;  5CBN A;  1EZV E;  1CSB A;  4IL6 E;  1M1J B;  1UII A;  3TGU E;  2VZ4 A;  1CZQ A;  1QGK B;  2Y9Y A;  2YIU C;  2JJL A;  2ZYD A;  1AFO A;  4W7Z A;  3QAO A;  1NYH A;  2N1T D;  1IZN B;  2PFX A;  1OW7 A;  3V2N A;  1EZV I;  1SQX G;  1IK7 A;  4ZNC A;  3V4W A;  1KQS O;  1W5C E;  3SFE C;  1AJY A;  1VDF A;  1VQM P;  3CCV P;  3OJA B;  2QA4 P;  1NGM B;  3VTP C;  3PTZ A;  2PAJ A;  3BVH A;  2ZFC A;  4Y99 B;  1U7M A;  1NTZ K;  1IFI A;  1K04 A;  3L73 J;  2D2C B;  3HUS C;  2OYH C;  4WY4 C;  3L74 J;  4M3L A;  2GA1 A;  2NPS C;  3CXH E;  1SQP E;  3BCC D;  4I1L A;  1MZ9 A;  4RO0 A;  2FYU K;  1FC2 C;  4D6T J;  2H7H A;  4OGQ C;  1LJ2 A;  5AVZ B;  1FU1 A;  1JY2 N;  1BDD A; 
#chains in the Genus database with same CATH homology
 3B49 A;  4YXD C;  1VL2 A;  2KCU A;  1PL5 A;  1RQV A;  1HJ0 A;  1VF5 B;  3Q5P A;  4PV1 B;  1PIX A;  4H13 B;  3AE2 C;  2E75 B;  1OMI A;  4H44 B;  5KAX A;  1FDI A;  3D6Y A;  5KCB A;  4H0L D;  2DG6 A;  1JBG A;  3GPV A;  4H44 D;  4KT0 J;  5KAV A;  2JP3 A;  3AED C;  4LHF A;  4AYZ B;  2HVA A;  1GMJ A;  3AEF C;  1JB0 J;  1TU3 F;  3G9R A;  3R4Y A;  4H0L C;  2V7Q J;  1HF9 A;  1MKM A;  3AE5 C;  1KQG B;  2JML A;  4R24 B;  5D8C A;  3E0H A;  4YTP C;  4J2N A;  2WSF J;  3IN6 A;  4Z1M H;  2BEZ F;  2KVV A;  2QSI A;  3H25 A;  2WSC J;  2VZ4 A;  2H89 C;  3AE4 C;  4TT3 H;  2YIU C;  3Q3D A;  3B71 A;  2K9Y A;  2H88 C;  2G3A A;  2MKV A;  2NZ2 A;  3GF3 A;  3GLM A;  5KKZ C;  1BOW A;  3D6Z A;  2E76 C;  3FGA D;  2GOV A;  3QAO A;  5E01 A;  2IEF A;  1NYH A;  2FXP A;  4XFJ A;  1Q06 A;  5D90 A;  1Q0A A;  2J5U A;  3Q1M A;  1R8E A;  1U57 A;  3LW5 J;  1DIP A;  5I41 B;  1KIL E;  1OW7 A;  5KAW A;  1PV3 A;  1PM6 A;  2E74 B;  4B0Y A;  1UIX A;  1WMK A;  3SFD C;  1IK7 A;  4R4E A;  2ZT9 C;  4PV1 D;  1Q07 A;  1Q08 A;  1Q90 D;  2D2C C;  2QJK C;  4R4M A;  1ZRT E;  1R8D A;  3AEE C;  1YQ4 C;  2BEQ D;  3SFE C;  1OW6 A;  1AJY A;  4OGQ D;  4R4L A;  2BOW A;  4Y28 J;  3AE6 C;  1Q05 A;  1ZME C;  2ZHH A;  3D70 A;  1VF5 C;  2WSE J;  5KAU A;  3Q2Y A;  2G8Y A;  4GDO A;  1NGM B;  3AEG C;  1KQF B;  1Y9B A;  2QJY C;  4PV1 C;  3AE8 C;  1OW8 A;  2ZHG A;  4R22 B;  1DD4 A;  2E75 C;  5M1B A;  3Q5R A;  1ZOY C;  3GK6 A;  1VF5 D;  3AE9 C;  4H13 D;  2YMK A;  5GQQ A;  4H0L B;  3AE1 C;  3RK3 E;  1S5L X;  3RL0 g;  1LX8 A;  2FBW C;  4I7Z B;  2IDB A;  5KLI C;  1JYH A;  1DD3 A;  4OGQ B;  2FYN C;  3Q5S A;  2WQY C;  2P10 A;  3AEC C;  2E74 C;  1FDO A;  4AYZ A;  3UCS A;  3EZF A;  1K04 A;  2OQQ A;  3HH0 A;  1EXI A;  3EWK A;  1Y6U A;  2D2C B;  3EZ9 A;  1YQ3 C;  2O01 J;  3EZ6 A;  2D2C D;  3O6Q A;  4DCZ A;  2E74 D;  2QJP C;  1Q09 A;  2JO1 A;  1S1C X;  4H13 C;  1KTM A;  1D5Y A;  4H44 C;  3AE3 C;  3C8V A;  3GF7 A;  1ZP0 C;  2E76 B;  1KMI Z;  2WPV B;  1KOR A;  3D71 A;  5L8R J;  3R8J A;  1K05 A;  4A1M A;  1RH6 A;  3T97 B;  5KAT A;  3IAO A;  2E76 D;  3GP4 A;  3AEB C;  2E75 D;  3LUR A;  4WLW A;  2QIW A;  4U7J A;  3AE7 C;  3AEA C;  3GMA A;  1RQU A;  2ZT9 B;  3EZ7 A;  4I7Z C;  3R8K A;  4OGQ C;  3EZ2 A;  3ABV C;  2ZT9 D;  2OG0 A;  4WLS A;  1EXJ A;  3S9O A;  4IL6 X;  4RKU J;  5I44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...