1EXJA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 68
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exjA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exjA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exjA01
3UCSA 3LURA 4J2NA 1EXIA 4B0YA 4R4EA 1EXJA 3GK6A 3QAOA 2J5UA 2GOVA 3Q5PA 5KAVA 4R4MA 3D70A 5GQQA 3G9RA 1DIPA 2VZ4A 3GPVA 1Q0AA 3D6YA 4R4LA 3D6ZA 3B49A 4AYZA 4AYZB 2JMLA 1Q09A 5KAXA 3HH0A 5KAUA 5E01A 5I41B 5D90A 3D71A 5KCBA 3Q2YA 1R8DA 2KCUA 2ZHHA 5D8CA 1Q05A 3Q1MA 2ZHGA 1Q06A 5KATA 3E0HA 3R8KA 2HVAA 1D5YA 1R8EA 1Q07A 3R8JA 4WLWA 3Q5RA 2OQQA 3T97B 3IAOA 4WLSA 1BOWA 3GP4A 1JBGA 5I44A 4R24B 3Q3DA 2BOWA 3Q5SA 2DG6A 5KAWA 4A1MA 1Q08A 1JYHA 4R22B
chains in the Genus database with same CATH superfamily
3ITKA 2JKVA 5KAIE 1P84H 1VQMP 2P1JA 5TJHA 4PJ0E 5GTHE 4RO0A 3KPEA 1CI6B 2N9BA 1HF9A 1QGKB 5AW8B 1KMIZ 1N86A 3CD6P 1GDTA 1SQPD 2FXPA 1NTMK 2LKMA 4N78E 3S1KA 1BE3G 3GHGB 5KLIC 1SQVJ 1PP9E 1L0LK 3FGAD 3EQ2A 1NO4A 2OYIB 2K1AA 1L0NG 2FYNB 1FOSE 3U59A 3V2RA 4I6MC 2PGDA 1LP1A 4B86A 3CMEP 1W2BO 1KB9E 2WSEH 5AW5B 2H43A 5GQQA 2M8RA 5M1BA 2H7HA 2K9JA 1M56D 1JCDA 1PPJE 1KILA 1SFCB 1JTHA 5CCGD 1Y6UA 3EZFA 4KT0J 2ZYAA 1VQ5P 4A1MA 2YIUB 3AE3C 4JF7A 3LIDA 1EZVI 1AVYA 3G9RA 3HTKB 1N73A 1PGQA 1NU1G 2IZ1A 1N73C 2HPCA 2YKQA 1WRGA 1SQBJ 2OTJP 1JY3N 1H0TA 4JBZA 1Q08A 3UCSA 2KS1A 1PIXA 1LTJA 3L70D 4EYYQ 2ZJSE 2A45I 3NFQA 1OVUA 1JM0A 2FYUJ 2R3CA 2QM8A 3AE5C 4JPZB 1KQGB 3VMAA 1K05A 3CXHE 1YBKA 1SQVE 2Q3IA 4IFFA 1Q05A 3RL0B 2IDBA 1RF0C 3H25A 1CSBA 2BCCD 3SWYA 3AE9C 1HJ0A 2QRXA 4H13C 3B5NA 2KZIA 3H1IJ 1YJ9P 2HR3A 5KKZB 3VMZA 2JEEA 3B5NC 3P8MC 5B66H 2KVVA 5AVUB 3MIWA 1N7LA 3RK3D 2QJYB 2FFDB 3E7KA 1GU4A 4GT1A 2RMZA 3B49A 4H44D 2POHA 3D71A 2XU6A 3CC7P 3TGUD 1OX3A 1LTSC 3HD7D 1NGMB 3R2PA 3BCCG 2RKLA 2WQYC 2IEFA 3L70J 4DZOA 4I7ZC 1NKNA 1FZCA 4AYZB 1RQVA 4Y99C 2E75C 3VYIA 4C7RA 3MHVA 1T3UA 2AEFA 3CCRP 1JY2O 5AVYB 2YMKA 3L71J 1SQPE 1KN7A 5BU5A 3HUSA 1VPCA 2MKVA 3LW5J 3IF4A 1HTLC 1NAFA 4YTPC 1EZVD 4Y28J 3GW6A 3GPVA 2E75D 3HUSC 3AE1C 3SSUA 2AXTE 4H0LB 1Q81Q 4WY4A 1OWAA 1YIJP 2BCCJ 2KNCA 1URQB 4BWNA 4JYBA 1X8YA 1NWQA 4IOIH 2IBZG 1W2EA 1JY3P 3L75G 1GK4A 1PFIA 2YMYA 1H88A 1AQ5A 1D7MA 2FYZA 2B89A 1ZN5A 4I2LC 1N2DC 4IL6H 3WMM0 1BGYJ 1NTMD 2OTKE 1Q09A 3TGUJ 3CCJP 5TISH 4EOTA 4BRYB 5APUA 1RE3C 2KZJA 1U7JA 1L0LD 4D6TD 5I44A 2LR2A 3O6QA 1H8AA 2GOVA 2HFED 2KOGA 3L70E 1IFIA 1MKMA 4YPCA 2ZVNB 2WPQA 3EZ2A 4L74A 2RH0A 3OA7A 1USDA 1N7SA 1YTZI 2H89C 2KSJA 1HJBA 1GU5A 3L71E 3CWBG 1FJPA 4J2NA 1N7SC 5AVQB 1S5LX 2W83C 5E01A 2YNYA 4PD4I 4AYCA 2BCCE 2HVAA 1LWUB 2WSFH 4RJTA 5KJ7D 4W80A 1YI2P 3GK6A 2N1TA 3PTZA 3PRJA 1EDJA 2QA4P 1IC2A 1S4XA 3H1LD 2N1TC 5AVRB 2UWJE 4PJ0H 5GTHH 1L4AB 2PRRA 3RK3E 3M0AA 3IAOA 3AEGC 1NU1K 1GW4A 1KYOI 2Q5UA 2YXQB 2E76B 5KAXA 1EXIA 3B8EB 1G2CA 2Z5IA 4A7PA 1IK9A 3H1JG 1BSNA 1L0LJ 3TGUE 5D90A 2ZHGA 3OW2O 2C0XA 3FXEA 1DH3A 3L37A 4WLWA 4PV1C 4YXWH 3A0BE 3A2AA 2NZ2A 3IFMA 5AVXB 2W27A 2B87A 2LXCB 1KB9H 4ASWA 1GK6A 1EQ7A 2Y0CA 1NJIQ 3GMAA 3HE5B 4DCKA 4U3FD 1ZW0A 1J1DC 1LT9B 1EZVE 2OARA 2V4HA 2XDJA 4WVZA 1OW7A 1YQ4C 1X22A 2OTLP 2W8ZA 2MJZA 3CI9A 2O01H 2OQQA 3L74G 2OYHB 2JO1A 3L35A 3RK2B 2Y0EA 3G6EP 1GL2B 2I1JA 3H1LJ 1NTZK 1SP4A 2WTYA 2KSEA 4LHFA 5TISE 2JMLA 3CC2P 3FWNA 4BXLA 3H1HD 2OGUA 2FY8A 3QWOC 1X79B 2J59M 3S4RA 3JSVC 3RL0g 1YYCA 1Y47A 1NTME 1S9KD 5EFWB 3AECC 1DD4A 4WWIA 1LTTC 1L0LE 4D6TE 1ZRTD 3I5CA 4PD4D 3H1KG 3CXHH 5C39A 4GKGA 2YXRB 2R44A 1SQXD 3C9IA 5KLIB 4B0YA 1FZAA 4R4EA 1RH5B 5H2FE 4GOFA 1VQ7P 1ZLLA 3BATA 2XZRA 1YITP 2K88A 4U3FJ 1FZEA 1Q86Q 1VQ9P 1WT6A 2QJKB 1KYOD 1LP1B 4TT3H 1SQBG 4UB6E 3SFEC 5KTBA 2ZXXA 2K9JB 1KILB 2B9BA 1HGZA 1KQLA 1JTHB 1D5YA 2QSIA 3HRNA 2NPSD 1M1JC 2KLVA 5AW1B 2FYUG 3M9QA 3H1LE 1N73B 3AE2C 4HKZH 2WT7B 2XNDH 1VF5B 3H1HJ 5CCGA 2QIWA 4XFJA 1XTGB 5L8RJ 4OGQB 2HPCB 5CJ0A 5CCGC 1H0TB 1SS1A 4NPEA 4CPGA 1BCCG 1BE3D 1QL2A 2KS1B 2D2CB 1ZV8A 1LTJB 1VL2A 2QE7H 1LNQA 4O9BA 1L0ND 3AEDC 1IK7A 1VQ6P 5E79E 3H1IG 2AXTH 2AEJA 1SQXJ 3M91A 3T97A 2IX7C 2RN0A 1ZR2A 4KJMA 2O1JA 1LJ2A 2WMMA 1FDOA 4U3FE 1QEXA 1W5CE 4H13B 2Y0DA 2K3RA 2IPPA 4R22B 1T8ZA 2A06G 1OMIA 1EXJA 2H88C 1NU1D 3Q5PA 1ZXGA 3B5NB 4JQ0D 1IZNB 2KB7P 1JY2N 3SFDC 5K5GB 1GW3A 1Q7YQ 2E43A 2JR8A 5APYA 1KQFB 2QJPB 1JUNA 1VQ4P 1SQPJ 2OYIC 3U1AA 2IBZI 1NOHA 1YTZT 3L71G 3A0HE 5KLVG 1RF0A 3H1HE 3CCMP 2GUSA 1PGOA 2VRSA 2KIKA 3SWKA 3N4XA 2N9YB 2W6JH 2Q6QA 4DT0A 2BCCG 4Y99B 3RK3C 1YJNP 1GD2E 1HUCA 1DIPA 2D2CD 1FZCB 1L0NJ 2YIUC 3L72G 1S3JA 1ZRTE 3LW5H 4PD4E 1JO5A 4H44C 3HD7A 1Q06A 5AW9B 3BVHA 2W6BA 1NTZG 1SFCD 1SQXE 3HD7C 1NTKD 5KAWA 1FZBA 2AEMA 3HUSB 3C1LA 5AVSB 1FS0E 1VDFA 2WSSH 3H32A 4WY4B 1PGJA 1USEA 3CCQP 1BGYG 2KNCB 1Q07A 1JMMA 2G8YA 2KXPB 1NU1J 3C8VA 4XA4A 1AV1A 1OW8A 1SQQG 3UIAA 3BRTB 5KAUA 2QM7A 2R32A 3R8KA 1X9VA 3BCCD 3L36A 3V4WA 3AE7C 1MFTA 2HODA 3CCUP 4R24B 4GIFA 2ZT9B 3A0BH 1JY3O 3CX5I 1HH0A 4W7YA 1JB0J 5AW7B 2QVAA 3N7NA 3RL0D 1BE3E 5AW2B 3OAKA 3O6QB 1NH4A 2M5AA 2QJYC 1IFNA 2W90A 1L0NE 3VOPA 3L73G 1IFDA 2CK3H 1R8DA 3L4FA 1NTKJ 1AQTA 1N7SB 1JY2P 2IBZD 4WB4A 2WSCJ 3L75D 3II6A 1AFOA 1RE3A 2DW3A 1VQNP 3VMYA 2FXOA 2A45H 1WMKA 1BDDA 1SQBK 3HE4A 2G3AA 1K8AQ 1NU1E 1DEEG 2ZVOB 3EZ9A 2N1TB 3M9HA 1S5LE 1Q0AA 2NRGA 5B5EE 1S1CX 2HYNA 3AEEC 3KQGA 3IN6A 1CZQA 2GA1A 2FYUK 2Y9YA 4K3AA 1GZLA 1JBGA 3TF5A 5KJ7C 1URQC 3TNUA 1QL1A 1G2CB 3ZDMA 3MP7B 3WUVA 4Z1MH 1BDCA 1LT1A 2R5DA 5H2FH 4HJGH 2WPSA 1ZP0C 1H89A 4H0LD 4GODA 2W6AA 5CCHD 3CWBD 1M8OB 3K5BA 2KP8A 3TK1A 2IZ0A 1URQD 2E5TA 2L91A 2WVRA 2PFXA 2B87B 3KZIE 1A02F 2HLOA 4L75A 4UB6H 1X0TA 3CCVP 3AEFC 4MN4C 1J1DB 2O1KA 5APSA 4L73A 1FC2C 3I55P 2P67A 3CCSP 1NTKE 1PP9G 1EDIA 3Q5SA 2OG0A 3L75J 2O01N 1KTMA 3QAOA 1P84I 1NTMJ 3R4YA 3CX5D 1LTIC 2WZ7A 3D6ZA 3TSIA 2C9NY 4M3LA 5CJ4A 4D6TJ 1PPJG 4WBAA 4C7NA 4LLHA 3RBXA 4ZKUA 1EC5A 1VQKP 5KAFE 1Y9BA 2C0WA 3H1JD 2FKWB 2BEQD 3F89A 1FAVA 1KZUB 3VP8A 1K04A 2GM4A 4IFMA 2QG4A 4KHXA 1IO4A 1M57D 5APQA 5E79H 1MZ9A 5KLVK 1YQ3C 3FX0A 3CCLP 1KC8Q 1HVVA 4NPFX 3G4SP 3MD0A 3EFFK 4N6JA 1ZR4A 2K9YA 4ZMDA 1DX7A 1EDLA 1R8EA 2DG6A 5AW0B 1VQ8P 1PGPA 2E74B 4AUWA 1SVFA 1E79H 2K37A 1S72P 2JP3A 5I41B 2JJLA 3Q2YA 3L74D 5BU8B 1RHZB 5AVZB 2XKMA 3TDKA 1L4AD 1SQVG 2IBZE 3JCUH 3L75E 1Q82Q 3KYQA 2FBWC 2E76D 4DCZA 1Y8AA 1N8RQ 2JWAA 1VQLP 3A0HH 3VN0A 1M1KQ 4DOJA 1GMJA 1SQQK 1RE4C 2FXMA 3H1JJ 3WUTA 3S9OA 3KXDA 1SQXG 1PV3A 3JC22 4R4MA 3EFGA 2Q3EA 1U7MA 2AXCA 3V5BA 3A7OA 3H1KD 1KFNA 5KATA 2ITAA 2NPSA 3P8CD 4PD4H 1FDMA 3VMXA 1FU1A 3F5HA 5AW6B 2NPSC 1JYHA 1PL5A 3SWFA 1QX8A 3D70A 3RK2C 1P84D 3H6PA 3P32A 1OW6A 3WU2E 1NHLA 1M1JA 3CWBE 2JDIH 1AVOA 3U1CA 4EI2A 4RKUJ 1FOSF 3T97B 2KYVA 4L76A 1SQBD 1LTGC 1KYOH 3RK2D 1FZFA 1GL2D 2E74D 1SQPG 4R4LA 3L74J 2V7QH 1VQOP 2P58A 2ZHHA 3A3YB 1KFMA 3PLNA 1OFCX 4YXDC 2P7JA 2FYUD 1L2PA 1J1EC 2WITA 3CX5E 4ZKPA 2WPVB 2R5BA 2Z5HA 1R5SA 2KLUA 4N3YB 5AVTB 4EIJA 5CBNA 4LC1A 1BCCD 2ZAEB 1BOWA 3KDPB 1RF1A 5AW3B 3H1JE 4HB1A 1HBWA 3H1KJ 2QJKC 1RF1C 1Q90D 3H1ID 3EWKA 1PM6A 2KCUA 1CI6A 5D8CA 2JWDA 3RK3B 4AQRD 1KILC 1KD1Q 4ASVA 2KUBA 3NTNA 5GTIE 4H44B 2V7QJ 1XTCC 2WT7A 1FJKA 3D6YA 1IFPA 3GHGA 5APTA 3HD7B 4QMAA 3E1RA 3L70G 5AVVB 2OYIA 1KILD 1VF5C 2Z4EA 3E0HA 3GHGC 3JCUE 2SPZA 1DEBA 1JMBA 2A06D 4W7ZA 4OGQC 3V2NA 5APXA 2FYNC 1BSHA 3H32B 3L74E 2D2CC 2I8DA 3M0DA 1LTJC 1S5LH 1VF5D 5B5EH 1SFCA 4OGQD 3M0DC 5DJUB 4WLSA 1BE3J 1J2JB 2WSEJ 3AE8C 4NPDA 4I7ZB 1SFCC 3L71D 2M3EA 3O8ZA 1LTBC 2IYOA 1S9KE 5KLVD 1FDIA 2E75B 3B71A 3HTKA 5CHXA 3AE4C 4OWFA 4ZNCA 5CMZA 1BCCJ 1JEKA 3M9BA 2I1KA 2HODB 1YJWP 3V2QA 1NTKG 3USSA 3CCEP 3L72D 1MV8A 3G3ZA 2VZ4A 3H1KE 4TLFA 4UB8H 3P8CE 1NAYA 1T2KC 3KZIH 3PH0A 5KCBA 1NTZD 5APVA 2WPRA 2O3JA 3TGUG 2IFMA 1GTWA 1IJDB 1KYOE 2C9LY 4H13D 3CL3D 4LGDE 1P84E 2QJPC 1YHQP 2BASA 3M06A 2M5AB 1T2KD 1U57A 3B5ND 3EZ7A 1BGYD 2WSCH 3G71P 1T6AA 1SQBE 1LX8A 3VTPC 4DJGA 3RL0C 1SQQD 3W68A 1HGVA 1NVOA 1Q2NA 5KAFH 2LXBA 1QLED 1EZVG 1SQVK 2CPSA 1T3JA 1FZCC 3FWLA 3VP9A 1Z56A 1K9MQ 3HE4B 4K35A 2FYUE 5KKZC 1KORA 2FFDA 1OVVA 1LTAC 5KLVJ 2J58A 1KB9I 2FFDC 1TU3F 1JCCA 3HH0A 1NYHA 1RH6A 1BCCE 1SQXK 2A45G 2XNXA 4GDOA 4WY4C 5AW4B 2GUVA 1HWTC 3L72J 2ZYDA 1S2EA 3TNUB 5KAVA 3L73D 3H1IE 1NTZJ 4AYZA 4U7JA 1EDKA 1NTMG 4WY4D 3I56P 2HG5D 4OVNF 4HYTB 1L0LG 4D6TG 2Q9IA 3MZWB 2OYOA 1DD3A 4C46A 1A02J 2ZYGA 2ZT9C 4EDFA 2PAJA 1IFMA 1KILE 3BCCJ 5CCHA 1UIXA 2E5YA 3BRVB 2A06E 3AEBC 1AA0A 5KJ7A 1URQA 3PHLA 4H0LC 2IFNA 1SQPK 1SQQJ 5CCHC 3Q3DA 4HH2A 2XV5A 2ZT9D 3NMDA 4XE5B 4PV1B 3MGNA 4IFDK 3CXHI 5BVZA 2M3BA 1ZOYC 2BOWA 1JNMA 1FBMA 4C7NB 5KLVE 3GLMA 3WUUA 1AJYA 4UB8E 1L0NK 2QEXP 2KI7B 1E5WA 3IR9A 5B66E 1QVFO 1IFJA 2YO3A 1G1JA 2ZXEB 4BRYA 3H1LG 3WU2H 2IYPA 1N7SD 1MUUA 3L72E 3L73J 3ABVC 1FZGA 1M7LA 3QH9A 5KAIH 1NTZE 2Q1KA 4N78D 1FE6A 2YO2A 3BASA 1PP9D 2P2UA 3GP4A 3V2PA 1UIIA 3AE6C 2Y9ZA 5AVWB 1RQUA 2KK7A 3MUDA 1NKZB 1R5LA 1KB9D 1BGYE 3LIEA 3CX5H 3NXSA 2N1TD 2YKOA 5APWA 3GF7A 4JYCA 3MUDC 3BCCE 1PPJD 1LGHB 3CPWO 1LWUA 3KHUA 2L5GB 3CMAP 5CBOA 3P7KA 1SQQE 2YKPA 4U3FG 4OH8B 2P10A 1LWUC 1RY3A 3EZ6A 3CC4P 2ZFCA 2WSFJ 3E1IA 3CWBJ 4PV1D 1K73Q 1L4AA 2WWWA 1SLQA 1L4AC 1QVGO 3LURA 2PP6A 3PJSK 2J5UA 4GOEA 3TYYA 2E76C 5GTIH 3CLQA 3Q1MA 1OIPA 3V4QA 2NPSB 1NTKK 3FXDA 3H1HG 1CW5A 2H8PD 1OVRA 3B4SA 1ZMEC 4IL6E 3L73E 2M0BA 3GF3A 1PP9J 3PP5A 3W67A 1M1JB 2E42A 1VQPP 3CXHD 3HE5A 1RE4A 3RGUA 1SQVD 1OZHA 1MFZA 2B88A 4IL6X 1M90Q 1LT9A 1KV4A 3V6IA 1G1IA 3MTUE 1JOCA 1LT9C 3A5TA 2R3SA 3AEAC 1KQSO 2Q7CA 2BEZF 1J1EB 3R8JA 3Q5RA 2OYHA 3GG2A 1GL2A 2OYHC 4RESB 2CPBA 1GL2C 2E74C 4I1LA 2O01J 1PZQA 3RBZA 5DJTB 1OXZA 1RF1B 3OJAB
chains in the Genus database with same CATH topology
3UCSA 3GLMA 3LURA 2WQYC 4B0YA 4R4EA 2FBWC 1KTMA 3QAOA 1PIXA 2IEFA 2E76D 2J5UA 2NZ2A 1AJYA 2GOVA 1FDIA 2E75B 2WPVB 2WSCJ 3B71A 3R4YA 4I7ZC 1TU3F 1MKMA 3AE4C 4DCZA 2E76C 3D6ZA 4AYZB 1RQVA 3HH0A 1NYHA 2E75C 3Q1MA 1RH6A 1FDOA 1WMKA 3EZ2A 1HF9A 3GMAA 5KAWA 4GDOA 1Q07A 2H89C 4H13B 2G8YA 2G3AA 2YMKA 1BOWA 1GMJA 3ABVC 3EZ9A 4R22B 1ZMEC 1KMIZ 3AE5C 4J2NA 1OMIA 3S9OA 1KQGB 2MKVA 3C8VA 1EXJA 2FXPA 2H88C 3LW5J 1PV3A 3GF3A 4TT3H 3Q5PA 5KAVA 4R4MA 1S5LX 1Y9BA 3SFEC 4YTPC 2QJKC 4Y28J 2VZ4A 1OW8A 3GPVA 1Q0AA 1OW7A 2BEQD 1YQ4C 3SFDC 1Q90D 2E75D 4U7JA 4AYZA 1S1CX 1K05A 3AE1C 4H0LB 5KLIC 3AEEC 5E01A 3EWKA 5KAUA 1PM6A 5KCBA 1K04A 2KCUA 3FGAD 5D8CA 1Q05A 5KATA 3IN6A 3R8KA 2HVAA 1KQFB 2IDBA 1D5YA 2QSIA 3H25A 2OQQA 3AE7C 2JO1A 3GP4A 1JBGA 4R24B 4IL6X 3AE6C 4H13D 3AE9C 1JYHA 1PL5A 1HJ0A 2QJPC 2ZT9B 1YQ3C 1RQUA 3GK6A 4H13C 3D70A 4H44B 5GQQA 1DD3A 2V7QJ 3O6QA 1JB0J 4Z1MH 4LHFA 3D6YA 3AE2C 5M1BA 1U57A 1VF5B 2ZT9C 2JMLA 3EZ7A 2QIWA 1KILE 1OW6A 1ZP0C 3GF7A 3AEAC 4XFJA 1UIXA 5L8RJ 4H0LD 4OGQB 2K9YA 1VF5C 1Y6UA 3EZFA 3AEBC 2BEZF 4RKUJ 3E0HA 2KVVA 1R8EA 3RK3E 4KT0J 3R8JA 3Q5RA 1LX8A 4H0LC 3IAOA 3T97B 3AEGC 4OGQC 3Q3DA 2DG6A 4A1MA 2E76B 5KAXA 1EXIA 3AE3C 2E74B 2P10A 3RL0g 2FYNC 2D2CB 2QJYC 2E74D 2ZT9D 3G9RA 1DIPA 2D2CD 3EZ6A 3AECC 1DD4A 2YIUC 4R4LA 3B49A 1VL2A 4H44D 1ZRTE 1Q09A 2E74C 2JP3A 2O01J 2D2CC 5I41B 2WSFJ 5D90A 3D71A 4PV1B 3Q2YA 1R8DA 2ZHHA 1VF5D 3AEFC 3AEDC 2ZHGA 1Q06A 4H44C 1IK7A 4PV1D 4WLWA 4YXDC 4OGQD 4PV1C 5KKZC 1NGMB 1ZOYC 1KORA 4WLSA 2WSEJ 5I44A 2BOWA 3AE8C 3Q5SA 4I7ZB 2OG0A 1Q08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UCS A;  3LUR A;  4J2N A;  1EXI A;  4B0Y A;  4R4E A;  1EXJ A;  3GK6 A;  3QAO A;  2J5U A;  2GOV A;  3Q5P A;  5KAV A;  4R4M A;  3D70 A;  5GQQ A;  3G9R A;  1DIP A;  2VZ4 A;  3GPV A;  1Q0A A;  3D6Y A;  4R4L A;  3D6Z A;  3B49 A;  4AYZ A;  4AYZ B;  2JML A;  1Q09 A;  5KAX A;  3HH0 A;  5KAU A;  5E01 A;  5I41 B;  5D90 A;  3D71 A;  5KCB A;  3Q2Y A;  1R8D A;  2KCU A;  2ZHH A;  5D8C A;  1Q05 A;  3Q1M A;  2ZHG A;  1Q06 A;  5KAT A;  3E0H A;  3R8K A;  2HVA A;  1D5Y A;  1R8E A;  1Q07 A;  3R8J A;  4WLW A;  3Q5R A;  2OQQ A;  3T97 B;  3IAO A;  4WLS A;  1BOW A;  3GP4 A;  1JBG A;  5I44 A;  4R24 B;  3Q3D A;  2BOW A;  3Q5S A;  2DG6 A;  5KAW A;  4A1M A;  1Q08 A;  1JYH A;  4R22 B; 
#chains in the Genus database with same CATH topology
 3ITK A;  2JKV A;  5KAI E;  1P84 H;  1VQM P;  2P1J A;  5TJH A;  4PJ0 E;  5GTH E;  4RO0 A;  3KPE A;  1CI6 B;  2N9B A;  1HF9 A;  1QGK B;  5AW8 B;  1KMI Z;  1N86 A;  3CD6 P;  1GDT A;  1SQP D;  2FXP A;  1NTM K;  2LKM A;  4N78 E;  3S1K A;  1BE3 G;  3GHG B;  5KLI C;  1SQV J;  1PP9 E;  1L0L K;  3FGA D;  3EQ2 A;  1NO4 A;  2OYI B;  2K1A A;  1L0N G;  2FYN B;  1FOS E;  3U59 A;  3V2R A;  4I6M C;  2PGD A;  1LP1 A;  4B86 A;  3CME P;  1W2B O;  1KB9 E;  2WSE H;  5AW5 B;  2H43 A;  5GQQ A;  2M8R A;  5M1B A;  2H7H A;  2K9J A;  1M56 D;  1JCD A;  1PPJ E;  1KIL A;  1SFC B;  1JTH A;  5CCG D;  1Y6U A;  3EZF A;  4KT0 J;  2ZYA A;  1VQ5 P;  4A1M A;  2YIU B;  3AE3 C;  4JF7 A;  3LID A;  1EZV I;  1AVY A;  3G9R A;  3HTK B;  1N73 A;  1PGQ A;  1NU1 G;  2IZ1 A;  1N73 C;  2HPC A;  2YKQ A;  1WRG A;  1SQB J;  2OTJ P;  1JY3 N;  1H0T A;  4JBZ A;  1Q08 A;  3UCS A;  2KS1 A;  1PIX A;  1LTJ A;  3L70 D;  4EYY Q;  2ZJS E;  2A45 I;  3NFQ A;  1OVU A;  1JM0 A;  2FYU J;  2R3C A;  2QM8 A;  3AE5 C;  4JPZ B;  1KQG B;  3VMA A;  1K05 A;  3CXH E;  1YBK A;  1SQV E;  2Q3I A;  4IFF A;  1Q05 A;  3RL0 B;  2IDB A;  1RF0 C;  3H25 A;  1CSB A;  2BCC D;  3SWY A;  3AE9 C;  1HJ0 A;  2QRX A;  4H13 C;  3B5N A;  2KZI A;  3H1I J;  1YJ9 P;  2HR3 A;  5KKZ B;  3VMZ A;  2JEE A;  3B5N C;  3P8M C;  5B66 H;  2KVV A;  5AVU B;  3MIW A;  1N7L A;  3RK3 D;  2QJY B;  2FFD B;  3E7K A;  1GU4 A;  4GT1 A;  2RMZ A;  3B49 A;  4H44 D;  2POH A;  3D71 A;  2XU6 A;  3CC7 P;  3TGU D;  1OX3 A;  1LTS C;  3HD7 D;  1NGM B;  3R2P A;  3BCC G;  2RKL A;  2WQY C;  2IEF A;  3L70 J;  4DZO A;  4I7Z C;  1NKN A;  1FZC A;  4AYZ B;  1RQV A;  4Y99 C;  2E75 C;  3VYI A;  4C7R A;  3MHV A;  1T3U A;  2AEF A;  3CCR P;  1JY2 O;  5AVY B;  2YMK A;  3L71 J;  1SQP E;  1KN7 A;  5BU5 A;  3HUS A;  1VPC A;  2MKV A;  3LW5 J;  3IF4 A;  1HTL C;  1NAF A;  4YTP C;  1EZV D;  4Y28 J;  3GW6 A;  3GPV A;  2E75 D;  3HUS C;  3AE1 C;  3SSU A;  2AXT E;  4H0L B;  1Q81 Q;  4WY4 A;  1OWA A;  1YIJ P;  2BCC J;  2KNC A;  1URQ B;  4BWN A;  4JYB A;  1X8Y A;  1NWQ A;  4IOI H;  2IBZ G;  1W2E A;  1JY3 P;  3L75 G;  1GK4 A;  1PFI A;  2YMY A;  1H88 A;  1AQ5 A;  1D7M A;  2FYZ A;  2B89 A;  1ZN5 A;  4I2L C;  1N2D C;  4IL6 H;  3WMM 0;  1BGY J;  1NTM D;  2OTK E;  1Q09 A;  3TGU J;  3CCJ P;  5TIS H;  4EOT A;  4BRY B;  5APU A;  1RE3 C;  2KZJ A;  1U7J A;  1L0L D;  4D6T D;  5I44 A;  2LR2 A;  3O6Q A;  1H8A A;  2GOV A;  2HFE D;  2KOG A;  3L70 E;  1IFI A;  1MKM A;  4YPC A;  2ZVN B;  2WPQ A;  3EZ2 A;  4L74 A;  2RH0 A;  3OA7 A;  1USD A;  1N7S A;  1YTZ I;  2H89 C;  2KSJ A;  1HJB A;  1GU5 A;  3L71 E;  3CWB G;  1FJP A;  4J2N A;  1N7S C;  5AVQ B;  1S5L X;  2W83 C;  5E01 A;  2YNY A;  4PD4 I;  4AYC A;  2BCC E;  2HVA A;  1LWU B;  2WSF H;  4RJT A;  5KJ7 D;  4W80 A;  1YI2 P;  3GK6 A;  2N1T A;  3PTZ A;  3PRJ A;  1EDJ A;  2QA4 P;  1IC2 A;  1S4X A;  3H1L D;  2N1T C;  5AVR B;  2UWJ E;  4PJ0 H;  5GTH H;  1L4A B;  2PRR A;  3RK3 E;  3M0A A;  3IAO A;  3AEG C;  1NU1 K;  1GW4 A;  1KYO I;  2Q5U A;  2YXQ B;  2E76 B;  5KAX A;  1EXI A;  3B8E B;  1G2C A;  2Z5I A;  4A7P A;  1IK9 A;  3H1J G;  1BSN A;  1L0L J;  3TGU E;  5D90 A;  2ZHG A;  3OW2 O;  2C0X A;  3FXE A;  1DH3 A;  3L37 A;  4WLW A;  4PV1 C;  4YXW H;  3A0B E;  3A2A A;  2NZ2 A;  3IFM A;  5AVX B;  2W27 A;  2B87 A;  2LXC B;  1KB9 H;  4ASW A;  1GK6 A;  1EQ7 A;  2Y0C A;  1NJI Q;  3GMA A;  3HE5 B;  4DCK A;  4U3F D;  1ZW0 A;  1J1D C;  1LT9 B;  1EZV E;  2OAR A;  2V4H A;  2XDJ A;  4WVZ A;  1OW7 A;  1YQ4 C;  1X22 A;  2OTL P;  2W8Z A;  2MJZ A;  3CI9 A;  2O01 H;  2OQQ A;  3L74 G;  2OYH B;  2JO1 A;  3L35 A;  3RK2 B;  2Y0E A;  3G6E P;  1GL2 B;  2I1J A;  3H1L J;  1NTZ K;  1SP4 A;  2WTY A;  2KSE A;  4LHF A;  5TIS E;  2JML A;  3CC2 P;  3FWN A;  4BXL A;  3H1H D;  2OGU A;  2FY8 A;  3QWO C;  1X79 B;  2J59 M;  3S4R A;  3JSV C;  3RL0 g;  1YYC A;  1Y47 A;  1NTM E;  1S9K D;  5EFW B;  3AEC C;  1DD4 A;  4WWI A;  1LTT C;  1L0L E;  4D6T E;  1ZRT D;  3I5C A;  4PD4 D;  3H1K G;  3CXH H;  5C39 A;  4GKG A;  2YXR B;  2R44 A;  1SQX D;  3C9I A;  5KLI B;  4B0Y A;  1FZA A;  4R4E A;  1RH5 B;  5H2F E;  4GOF A;  1VQ7 P;  1ZLL A;  3BAT A;  2XZR A;  1YIT P;  2K88 A;  4U3F J;  1FZE A;  1Q86 Q;  1VQ9 P;  1WT6 A;  2QJK B;  1KYO D;  1LP1 B;  4TT3 H;  1SQB G;  4UB6 E;  3SFE C;  5KTB A;  2ZXX A;  2K9J B;  1KIL B;  2B9B A;  1HGZ A;  1KQL A;  1JTH B;  1D5Y A;  2QSI A;  3HRN A;  2NPS D;  1M1J C;  2KLV A;  5AW1 B;  2FYU G;  3M9Q A;  3H1L E;  1N73 B;  3AE2 C;  4HKZ H;  2WT7 B;  2XND H;  1VF5 B;  3H1H J;  5CCG A;  2QIW A;  4XFJ A;  1XTG B;  5L8R J;  4OGQ B;  2HPC B;  5CJ0 A;  5CCG C;  1H0T B;  1SS1 A;  4NPE A;  4CPG A;  1BCC G;  1BE3 D;  1QL2 A;  2KS1 B;  2D2C B;  1ZV8 A;  1LTJ B;  1VL2 A;  2QE7 H;  1LNQ A;  4O9B A;  1L0N D;  3AED C;  1IK7 A;  1VQ6 P;  5E79 E;  3H1I G;  2AXT H;  2AEJ A;  1SQX J;  3M91 A;  3T97 A;  2IX7 C;  2RN0 A;  1ZR2 A;  4KJM A;  2O1J A;  1LJ2 A;  2WMM A;  1FDO A;  4U3F E;  1QEX A;  1W5C E;  4H13 B;  2Y0D A;  2K3R A;  2IPP A;  4R22 B;  1T8Z A;  2A06 G;  1OMI A;  1EXJ A;  2H88 C;  1NU1 D;  3Q5P A;  1ZXG A;  3B5N B;  4JQ0 D;  1IZN B;  2KB7 P;  1JY2 N;  3SFD C;  5K5G B;  1GW3 A;  1Q7Y Q;  2E43 A;  2JR8 A;  5APY A;  1KQF B;  2QJP B;  1JUN A;  1VQ4 P;  1SQP J;  2OYI C;  3U1A A;  2IBZ I;  1NOH A;  1YTZ T;  3L71 G;  3A0H E;  5KLV G;  1RF0 A;  3H1H E;  3CCM P;  2GUS A;  1PGO A;  2VRS A;  2KIK A;  3SWK A;  3N4X A;  2N9Y B;  2W6J H;  2Q6Q A;  4DT0 A;  2BCC G;  4Y99 B;  3RK3 C;  1YJN P;  1GD2 E;  1HUC A;  1DIP A;  2D2C D;  1FZC B;  1L0N J;  2YIU C;  3L72 G;  1S3J A;  1ZRT E;  3LW5 H;  4PD4 E;  1JO5 A;  4H44 C;  3HD7 A;  1Q06 A;  5AW9 B;  3BVH A;  2W6B A;  1NTZ G;  1SFC D;  1SQX E;  3HD7 C;  1NTK D;  5KAW A;  1FZB A;  2AEM A;  3HUS B;  3C1L A;  5AVS B;  1FS0 E;  1VDF A;  2WSS H;  3H32 A;  4WY4 B;  1PGJ A;  1USE A;  3CCQ P;  1BGY G;  2KNC B;  1Q07 A;  1JMM A;  2G8Y A;  2KXP B;  1NU1 J;  3C8V A;  4XA4 A;  1AV1 A;  1OW8 A;  1SQQ G;  3UIA A;  3BRT B;  5KAU A;  2QM7 A;  2R32 A;  3R8K A;  1X9V A;  3BCC D;  3L36 A;  3V4W A;  3AE7 C;  1MFT A;  2HOD A;  3CCU P;  4R24 B;  4GIF A;  2ZT9 B;  3A0B H;  1JY3 O;  3CX5 I;  1HH0 A;  4W7Y A;  1JB0 J;  5AW7 B;  2QVA A;  3N7N A;  3RL0 D;  1BE3 E;  5AW2 B;  3OAK A;  3O6Q B;  1NH4 A;  2M5A A;  2QJY C;  1IFN A;  2W90 A;  1L0N E;  3VOP A;  3L73 G;  1IFD A;  2CK3 H;  1R8D A;  3L4F A;  1NTK J;  1AQT A;  1N7S B;  1JY2 P;  2IBZ D;  4WB4 A;  2WSC J;  3L75 D;  3II6 A;  1AFO A;  1RE3 A;  2DW3 A;  1VQN P;  3VMY A;  2FXO A;  2A45 H;  1WMK A;  1BDD A;  1SQB K;  3HE4 A;  2G3A A;  1K8A Q;  1NU1 E;  1DEE G;  2ZVO B;  3EZ9 A;  2N1T B;  3M9H A;  1S5L E;  1Q0A A;  2NRG A;  5B5E E;  1S1C X;  2HYN A;  3AEE C;  3KQG A;  3IN6 A;  1CZQ A;  2GA1 A;  2FYU K;  2Y9Y A;  4K3A A;  1GZL A;  1JBG A;  3TF5 A;  5KJ7 C;  1URQ C;  3TNU A;  1QL1 A;  1G2C B;  3ZDM A;  3MP7 B;  3WUV A;  4Z1M H;  1BDC A;  1LT1 A;  2R5D A;  5H2F H;  4HJG H;  2WPS A;  1ZP0 C;  1H89 A;  4H0L D;  4GOD A;  2W6A A;  5CCH D;  3CWB D;  1M8O B;  3K5B A;  2KP8 A;  3TK1 A;  2IZ0 A;  1URQ D;  2E5T A;  2L91 A;  2WVR A;  2PFX A;  2B87 B;  3KZI E;  1A02 F;  2HLO A;  4L75 A;  4UB6 H;  1X0T A;  3CCV P;  3AEF C;  4MN4 C;  1J1D B;  2O1K A;  5APS A;  4L73 A;  1FC2 C;  3I55 P;  2P67 A;  3CCS P;  1NTK E;  1PP9 G;  1EDI A;  3Q5S A;  2OG0 A;  3L75 J;  2O01 N;  1KTM A;  3QAO A;  1P84 I;  1NTM J;  3R4Y A;  3CX5 D;  1LTI C;  2WZ7 A;  3D6Z A;  3TSI A;  2C9N Y;  4M3L A;  5CJ4 A;  4D6T J;  1PPJ G;  4WBA A;  4C7N A;  4LLH A;  3RBX A;  4ZKU A;  1EC5 A;  1VQK P;  5KAF E;  1Y9B A;  2C0W A;  3H1J D;  2FKW B;  2BEQ D;  3F89 A;  1FAV A;  1KZU B;  3VP8 A;  1K04 A;  2GM4 A;  4IFM A;  2QG4 A;  4KHX A;  1IO4 A;  1M57 D;  5APQ A;  5E79 H;  1MZ9 A;  5KLV K;  1YQ3 C;  3FX0 A;  3CCL P;  1KC8 Q;  1HVV A;  4NPF X;  3G4S P;  3MD0 A;  3EFF K;  4N6J A;  1ZR4 A;  2K9Y A;  4ZMD A;  1DX7 A;  1EDL A;  1R8E A;  2DG6 A;  5AW0 B;  1VQ8 P;  1PGP A;  2E74 B;  4AUW A;  1SVF A;  1E79 H;  2K37 A;  1S72 P;  2JP3 A;  5I41 B;  2JJL A;  3Q2Y A;  3L74 D;  5BU8 B;  1RHZ B;  5AVZ B;  2XKM A;  3TDK A;  1L4A D;  1SQV G;  2IBZ E;  3JCU H;  3L75 E;  1Q82 Q;  3KYQ A;  2FBW C;  2E76 D;  4DCZ A;  1Y8A A;  1N8R Q;  2JWA A;  1VQL P;  3A0H H;  3VN0 A;  1M1K Q;  4DOJ A;  1GMJ A;  1SQQ K;  1RE4 C;  2FXM A;  3H1J J;  3WUT A;  3S9O A;  3KXD A;  1SQX G;  1PV3 A;  3JC2 2;  4R4M A;  3EFG A;  2Q3E A;  1U7M A;  2AXC A;  3V5B A;  3A7O A;  3H1K D;  1KFN A;  5KAT A;  2ITA A;  2NPS A;  3P8C D;  4PD4 H;  1FDM A;  3VMX A;  1FU1 A;  3F5H A;  5AW6 B;  2NPS C;  1JYH A;  1PL5 A;  3SWF A;  1QX8 A;  3D70 A;  3RK2 C;  1P84 D;  3H6P A;  3P32 A;  1OW6 A;  3WU2 E;  1NHL A;  1M1J A;  3CWB E;  2JDI H;  1AVO A;  3U1C A;  4EI2 A;  4RKU J;  1FOS F;  3T97 B;  2KYV A;  4L76 A;  1SQB D;  1LTG C;  1KYO H;  3RK2 D;  1FZF A;  1GL2 D;  2E74 D;  1SQP G;  4R4L A;  3L74 J;  2V7Q H;  1VQO P;  2P58 A;  2ZHH A;  3A3Y B;  1KFM A;  3PLN A;  1OFC X;  4YXD C;  2P7J A;  2FYU D;  1L2P A;  1J1E C;  2WIT A;  3CX5 E;  4ZKP A;  2WPV B;  2R5B A;  2Z5H A;  1R5S A;  2KLU A;  4N3Y B;  5AVT B;  4EIJ A;  5CBN A;  4LC1 A;  1BCC D;  2ZAE B;  1BOW A;  3KDP B;  1RF1 A;  5AW3 B;  3H1J E;  4HB1 A;  1HBW A;  3H1K J;  2QJK C;  1RF1 C;  1Q90 D;  3H1I D;  3EWK A;  1PM6 A;  2KCU A;  1CI6 A;  5D8C A;  2JWD A;  3RK3 B;  4AQR D;  1KIL C;  1KD1 Q;  4ASV A;  2KUB A;  3NTN A;  5GTI E;  4H44 B;  2V7Q J;  1XTC C;  2WT7 A;  1FJK A;  3D6Y A;  1IFP A;  3GHG A;  5APT A;  3HD7 B;  4QMA A;  3E1R A;  3L70 G;  5AVV B;  2OYI A;  1KIL D;  1VF5 C;  2Z4E A;  3E0H A;  3GHG C;  3JCU E;  2SPZ A;  1DEB A;  1JMB A;  2A06 D;  4W7Z A;  4OGQ C;  3V2N A;  5APX A;  2FYN C;  1BSH A;  3H32 B;  3L74 E;  2D2C C;  2I8D A;  3M0D A;  1LTJ C;  1S5L H;  1VF5 D;  5B5E H;  1SFC A;  4OGQ D;  3M0D C;  5DJU B;  4WLS A;  1BE3 J;  1J2J B;  2WSE J;  3AE8 C;  4NPD A;  4I7Z B;  1SFC C;  3L71 D;  2M3E A;  3O8Z A;  1LTB C;  2IYO A;  1S9K E;  5KLV D;  1FDI A;  2E75 B;  3B71 A;  3HTK A;  5CHX A;  3AE4 C;  4OWF A;  4ZNC A;  5CMZ A;  1BCC J;  1JEK A;  3M9B A;  2I1K A;  2HOD B;  1YJW P;  3V2Q A;  1NTK G;  3USS A;  3CCE P;  3L72 D;  1MV8 A;  3G3Z A;  2VZ4 A;  3H1K E;  4TLF A;  4UB8 H;  3P8C E;  1NAY A;  1T2K C;  3KZI H;  3PH0 A;  5KCB A;  1NTZ D;  5APV A;  2WPR A;  2O3J A;  3TGU G;  2IFM A;  1GTW A;  1IJD B;  1KYO E;  2C9L Y;  4H13 D;  3CL3 D;  4LGD E;  1P84 E;  2QJP C;  1YHQ P;  2BAS A;  3M06 A;  2M5A B;  1T2K D;  1U57 A;  3B5N D;  3EZ7 A;  1BGY D;  2WSC H;  3G71 P;  1T6A A;  1SQB E;  1LX8 A;  3VTP C;  4DJG A;  3RL0 C;  1SQQ D;  3W68 A;  1HGV A;  1NVO A;  1Q2N A;  5KAF H;  2LXB A;  1QLE D;  1EZV G;  1SQV K;  2CPS A;  1T3J A;  1FZC C;  3FWL A;  3VP9 A;  1Z56 A;  1K9M Q;  3HE4 B;  4K35 A;  2FYU E;  5KKZ C;  1KOR A;  2FFD A;  1OVV A;  1LTA C;  5KLV J;  2J58 A;  1KB9 I;  2FFD C;  1TU3 F;  1JCC A;  3HH0 A;  1NYH A;  1RH6 A;  1BCC E;  1SQX K;  2A45 G;  2XNX A;  4GDO A;  4WY4 C;  5AW4 B;  2GUV A;  1HWT C;  3L72 J;  2ZYD A;  1S2E A;  3TNU B;  5KAV A;  3L73 D;  3H1I E;  1NTZ J;  4AYZ A;  4U7J A;  1EDK A;  1NTM G;  4WY4 D;  3I56 P;  2HG5 D;  4OVN F;  4HYT B;  1L0L G;  4D6T G;  2Q9I A;  3MZW B;  2OYO A;  1DD3 A;  4C46 A;  1A02 J;  2ZYG A;  2ZT9 C;  4EDF A;  2PAJ A;  1IFM A;  1KIL E;  3BCC J;  5CCH A;  1UIX A;  2E5Y A;  3BRV B;  2A06 E;  3AEB C;  1AA0 A;  5KJ7 A;  1URQ A;  3PHL A;  4H0L C;  2IFN A;  1SQP K;  1SQQ J;  5CCH C;  3Q3D A;  4HH2 A;  2XV5 A;  2ZT9 D;  3NMD A;  4XE5 B;  4PV1 B;  3MGN A;  4IFD K;  3CXH I;  5BVZ A;  2M3B A;  1ZOY C;  2BOW A;  1JNM A;  1FBM A;  4C7N B;  5KLV E;  3GLM A;  3WUU A;  1AJY A;  4UB8 E;  1L0N K;  2QEX P;  2KI7 B;  1E5W A;  3IR9 A;  5B66 E;  1QVF O;  1IFJ A;  2YO3 A;  1G1J A;  2ZXE B;  4BRY A;  3H1L G;  3WU2 H;  2IYP A;  1N7S D;  1MUU A;  3L72 E;  3L73 J;  3ABV C;  1FZG A;  1M7L A;  3QH9 A;  5KAI H;  1NTZ E;  2Q1K A;  4N78 D;  1FE6 A;  2YO2 A;  3BAS A;  1PP9 D;  2P2U A;  3GP4 A;  3V2P A;  1UII A;  3AE6 C;  2Y9Z A;  5AVW B;  1RQU A;  2KK7 A;  3MUD A;  1NKZ B;  1R5L A;  1KB9 D;  1BGY E;  3LIE A;  3CX5 H;  3NXS A;  2N1T D;  2YKO A;  5APW A;  3GF7 A;  4JYC A;  3MUD C;  3BCC E;  1PPJ D;  1LGH B;  3CPW O;  1LWU A;  3KHU A;  2L5G B;  3CMA P;  5CBO A;  3P7K A;  1SQQ E;  2YKP A;  4U3F G;  4OH8 B;  2P10 A;  1LWU C;  1RY3 A;  3EZ6 A;  3CC4 P;  2ZFC A;  2WSF J;  3E1I A;  3CWB J;  4PV1 D;  1K73 Q;  1L4A A;  2WWW A;  1SLQ A;  1L4A C;  1QVG O;  3LUR A;  2PP6 A;  3PJS K;  2J5U A;  4GOE A;  3TYY A;  2E76 C;  5GTI H;  3CLQ A;  3Q1M A;  1OIP A;  3V4Q A;  2NPS B;  1NTK K;  3FXD A;  3H1H G;  1CW5 A;  2H8P D;  1OVR A;  3B4S A;  1ZME C;  4IL6 E;  3L73 E;  2M0B A;  3GF3 A;  1PP9 J;  3PP5 A;  3W67 A;  1M1J B;  2E42 A;  1VQP P;  3CXH D;  3HE5 A;  1RE4 A;  3RGU A;  1SQV D;  1OZH A;  1MFZ A;  2B88 A;  4IL6 X;  1M90 Q;  1LT9 A;  1KV4 A;  3V6I A;  1G1I A;  3MTU E;  1JOC A;  1LT9 C;  3A5T A;  2R3S A;  3AEA C;  1KQS O;  2Q7C A;  2BEZ F;  1J1E B;  3R8J A;  3Q5R A;  2OYH A;  3GG2 A;  1GL2 A;  2OYH C;  4RES B;  2CPB A;  1GL2 C;  2E74 C;  4I1L A;  2O01 J;  1PZQ A;  3RBZ A;  5DJT B;  1OXZ A;  1RF1 B;  3OJA B; 
#chains in the Genus database with same CATH homology
 3UCS A;  3GLM A;  3LUR A;  2WQY C;  4B0Y A;  4R4E A;  2FBW C;  1KTM A;  3QAO A;  1PIX A;  2IEF A;  2E76 D;  2J5U A;  2NZ2 A;  1AJY A;  2GOV A;  1FDI A;  2E75 B;  2WPV B;  2WSC J;  3B71 A;  3R4Y A;  4I7Z C;  1TU3 F;  1MKM A;  3AE4 C;  4DCZ A;  2E76 C;  3D6Z A;  4AYZ B;  1RQV A;  3HH0 A;  1NYH A;  2E75 C;  3Q1M A;  1RH6 A;  1FDO A;  1WMK A;  3EZ2 A;  1HF9 A;  3GMA A;  5KAW A;  4GDO A;  1Q07 A;  2H89 C;  4H13 B;  2G8Y A;  2G3A A;  2YMK A;  1BOW A;  1GMJ A;  3ABV C;  3EZ9 A;  4R22 B;  1ZME C;  1KMI Z;  3AE5 C;  4J2N A;  1OMI A;  3S9O A;  1KQG B;  2MKV A;  3C8V A;  1EXJ A;  2FXP A;  2H88 C;  3LW5 J;  1PV3 A;  3GF3 A;  4TT3 H;  3Q5P A;  5KAV A;  4R4M A;  1S5L X;  1Y9B A;  3SFE C;  4YTP C;  2QJK C;  4Y28 J;  2VZ4 A;  1OW8 A;  3GPV A;  1Q0A A;  1OW7 A;  2BEQ D;  1YQ4 C;  3SFD C;  1Q90 D;  2E75 D;  4U7J A;  4AYZ A;  1S1C X;  1K05 A;  3AE1 C;  4H0L B;  5KLI C;  3AEE C;  5E01 A;  3EWK A;  5KAU A;  1PM6 A;  5KCB A;  1K04 A;  2KCU A;  3FGA D;  5D8C A;  1Q05 A;  5KAT A;  3IN6 A;  3R8K A;  2HVA A;  1KQF B;  2IDB A;  1D5Y A;  2QSI A;  3H25 A;  2OQQ A;  3AE7 C;  2JO1 A;  3GP4 A;  1JBG A;  4R24 B;  4IL6 X;  3AE6 C;  4H13 D;  3AE9 C;  1JYH A;  1PL5 A;  1HJ0 A;  2QJP C;  2ZT9 B;  1YQ3 C;  1RQU A;  3GK6 A;  4H13 C;  3D70 A;  4H44 B;  5GQQ A;  1DD3 A;  2V7Q J;  3O6Q A;  1JB0 J;  4Z1M H;  4LHF A;  3D6Y A;  3AE2 C;  5M1B A;  1U57 A;  1VF5 B;  2ZT9 C;  2JML A;  3EZ7 A;  2QIW A;  1KIL E;  1OW6 A;  1ZP0 C;  3GF7 A;  3AEA C;  4XFJ A;  1UIX A;  5L8R J;  4H0L D;  4OGQ B;  2K9Y A;  1VF5 C;  1Y6U A;  3EZF A;  3AEB C;  2BEZ F;  4RKU J;  3E0H A;  2KVV A;  1R8E A;  3RK3 E;  4KT0 J;  3R8J A;  3Q5R A;  1LX8 A;  4H0L C;  3IAO A;  3T97 B;  3AEG C;  4OGQ C;  3Q3D A;  2DG6 A;  4A1M A;  2E76 B;  5KAX A;  1EXI A;  3AE3 C;  2E74 B;  2P10 A;  3RL0 g;  2FYN C;  2D2C B;  2QJY C;  2E74 D;  2ZT9 D;  3G9R A;  1DIP A;  2D2C D;  3EZ6 A;  3AEC C;  1DD4 A;  2YIU C;  4R4L A;  3B49 A;  1VL2 A;  4H44 D;  1ZRT E;  1Q09 A;  2E74 C;  2JP3 A;  2O01 J;  2D2C C;  5I41 B;  2WSF J;  5D90 A;  3D71 A;  4PV1 B;  3Q2Y A;  1R8D A;  2ZHH A;  1VF5 D;  3AEF C;  3AED C;  2ZHG A;  1Q06 A;  4H44 C;  1IK7 A;  4PV1 D;  4WLW A;  4YXD C;  4OGQ D;  4PV1 C;  5KKZ C;  1NGM B;  1ZOY C;  1KOR A;  4WLS A;  2WSE J;  5I44 A;  2BOW A;  3AE8 C;  3Q5S A;  4I7Z B;  2OG0 A;  1Q08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...