1EXJA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
275
structure length
275
Chain Sequence
b'ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
molecule tags Transcription/dna
source organism Bacillus subtilis
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
total genus 68
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exjA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exjA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exjA01
1Q07A 4WLWA 3R8KA 4R4MA 1DIPA 1JYHA 3UCSA 3Q5SA 2OQQA 3E0HA 3D71A 2JMLA 3Q3DA 5E01A 3D70A 3HH0A 2GOVA 1D5YA 5KAXA 4AYZA 2DG6A 4WLSA 3T97B 1Q08A 4R24B 2J5UA 3B49A 3D6ZA 5GQQA 5KAVA 3R8JA 2ZHGA 2ZHHA 1R8DA 2HVAA 1Q06A 5D90A 5KAUA 1Q09A 3IAOA 5KAWA 1Q05A 2BOWA 1BOWA 4R22B 2VZ4A 2KCUA 5D8CA 3GPVA 4B0YA 4R4EA 3GP4A 3Q5PA 4J2NA 5I41B 3Q2YA 3D6YA 3Q5RA 3Q1MA 1R8EA 1EXIA 3G9RA 1Q0AA 3LURA 5KATA 4A1MA 3QAOA 3GK6A 5KCBA 4R4LA 4AYZB 5I44A 1JBGA 1EXJA
chains in the Genus database with same CATH superfamily
4KHXA 1N73A 3MUDC 3H1IG 1ZR2A 1BE3G 3T97B 5AVTB 1J1DB 3TGUD 2A06E 1N7SB 5AW3B 1RHZB 1FZCB 2OYIB 3CCMP 1IJDB 3H1KG 2OYOA 2Y0DA 3Q1MA 4ZMDA 5GTHH 1KB9H 3L72J 2B87A 4A7PA 3L73J 1FZEA 3AEGC 1KFMA 3HE5A 4L75A 3CMEP 1KQSO 1CI6B 2AEJA 1L0NE 1GZLA 2AXTE 3P8CD 1L0ND 2YMKA 3AE2C 2H43A 4EI2A 4EYYQ 4U3FE 2PGDA 3USSA 2QEXP 1H8AA 2P58A 2IYPA 3GLMA 2OYHB 1SQBG 3K5BA 2C9NY 4C7RA 5APVA 1T2KD 2V7QH 1SQPG 1KQLA 1Z56A 3CCSP 2ZT9D 3TGUE 2IBZI 4WVZA 3H1LD 1OW7A 3AEAC 1SQBE 1BE3E 1JUNA 5CCGD 1BDCA 3NFQA 4LGDE 1N7LA 1T3JA 1OZHA 1FS0E 2Q1KA 2AXCA 2M5AA 1EZVE 2KIKA 4PD4H 3V2NA 1SQPJ 1JY2O 4H0LC 2QJKC 1NTZD 3HRNA 1Q05A 5KAIE 3L71G 4OGQB 1PPJE 2YIUB 2R32A 2C0XA 3U1AA 2FXPA 5TISE 4C7NB 2JP3A 3D71A 5KLVG 2VRSA 1M90Q 1S3JA 4LHFA 2R5BA 2QJPB 3GF7A 3CL3D 2E5TA 1OW6A 2KZIA 3L70E 2WPSA 2H8PD 4B0YA 1H89A 2BCCG 1GMJA 2ZFCA 2IDBA 1BDDA 1JYHA 1K04A 2QJKB 3II6A 3PP5A 5AVVB 1SP4A 1RH6A 1AVYA 2RN0A 2WWWA 1FDOA 4JYBA 2J5UA 3D6ZA 3O6QB 3ITKA 1VPCA 5I41B 2NRGA 1NAFA 3OA7A 1Q07A 3H1IJ 1FU1A 1NU1K 1J1EB 1PGJA 3G6EP 1YBKA 1U7JA 2K37A 1Q82Q 4N78E 1HWTC 3AEEC 3FXEA 3U59A 3L4FA 5KAFH 4HH2A 5BVZA 1L4AD 1KB9D 4PV1D 1ZLLA 1S72P 2A45I 2CPBA 2ZXEB 1PZQA 5AVZB 2PP6A 1X79B 2R3SA 4PD4I 1KD1Q 3CXHE 1JTHB 2OGUA 3L72D 3H1LJ 2XNXA 3Q5RA 1EXIA 2ZYAA 3BRVB 5KLIB 1VQ4P 4ZKPA 1JY2N 2JR8A 1YYCA 1NKZB 3HH0A 3VMAA 3KYQA 2I1JA 2DG6A 4WLSA 1SFCD 2FKWB 3M06A 3O8ZA 4BRYA 3L71J 3ABVC 3CXHD 3GF3A 1LT9C 1ZR4A 1VQ6P 2KCUA 4HKZH 4O9BA 1L0NJ 1DIPA 3FXDA 1KB9E 2BEZF 1S9KD 1N86A 3IF4A 5APTA 1IFDA 1RQUA 5B66E 1YTZI 3L37A 2WITA 3CXHH 3L35A 5D8CA 3L74J 2W6JH 1L0LD 1BSNA 4PD4D 1RE4C 4JBZA 3V5BA 1SQQD 1FDIA 2H89C 5GTIH 1AVOA 3VMYA 1KYOI 1LTJB 3AE9C 2JJLA 2AXTH 3R2PA 1NTKJ 3L75E 3PLNA 2YXRB 3GK6A 4YPCA 1LTBC 3SWKA 3H32A 1SQBK 3LIEA 5DJUB 2E74B 3SWFA 3B4SA 1FOSF 4DCZA 3TSIA 1MZ9A 3EFFK 1G1JA 1YJ9P 5AVWB 2O01N 1ZN5A 4WY4A 3R8KA 1L0LJ 3I5CA 4WB4A 4YXWH 1CZQA 2PRRA 4XA4A 2CPSA 1EC5A 4XE5B 3CCVP 3V2RA 1OMIA 1LNQA 3P8CE 1PIXA 3AE7C 3IFMA 2SPZA 2FYUE 2WMMA 2HPCA 3WU2H 2KK7A 3AE1C 2FYUD 1LT9B 1JY2P 1H0TA 3L70J 5APSA 2XV5A 1GW3A 1GW4A 1YJWP 1KFNA 3BVHA 3V2QA 3L71D 1KILC 5AVYB 1JOCA 1W2EA 2QRXA 4ASWA 4IOIH 2G8YA 1UIXA 3UIAA 1RE3C 4WLWA 2R3CA 2A06D 2KNCA 4U3FG 3G4SP 4UB6E 1URQB 5KAXA 4B86A 1RE3A 1J1EC 4XFJA 1SS1A 2HPCB 3F89A 2BOWA 2G3AA 2GM4A 3T97A 1T3UA 3G9RA 5KJ7C 3CD6P 4NPDA 2QJYB 1PPJG 1EXJA 3H1KD 3BCCJ 1SQQG 1LT9A 2PAJA 3MIWA 3NXSA 3TDKA 1Y6UA 4RO0A 3S9OA 3RL0C 5AVQB 4DCKA 1FDMA 1L0NK 1MUUA 5AW8B 2IBZE 1GU5A 2GOVA 4IL6E 3BRTB 2YO2A 3CC7P 2Z5HA 1FJPA 4WWIA 4TLFA 4EIJA 5KKZB 3RK3B 3JSVC 1VQMP 3CXHI 2P67A 4YXDC 3PRJA 1M7LA 2ZT9C 4PJ0H 3HUSC 3I55P 1KQFB 3R4YA 2K9YA 1NTMD 1RE4A 5CCHD 3EZ6A 2KUBA 2BASA 4GDOA 1RF1B 5CBNA 3G3ZA 2M3EA 3PJSK 1SQPD 2WT7A 3CCQP 2KNCB 5AW1B 1M57D 1NU1G 3QAOA 1QVFO 5I44A 1KQGB 4W7ZA 2E75D 4Y28J 3P7KA 3LIDA 1K9MQ 2LR2A 3VOPA 1JEKA 2NZ2A 1S9KE 5CCGC 1W2BO 1SQXK 2Q7CA 4UB8E 4QMAA 1IFNA 1SQVD 2E76C 4I6MC 2I1KA 2WSEH 1BCCJ 3L75G 2IPPA 3CMAP 5B5EH 1Q86Q 3V4QA 4U3FJ 5APQA 5GTHE 2OARA 1GK4A 4HYTB 2FXOA 3M9QA 2BEQD 2IFNA 2KP8A 2HVAA 1ZV8A 2JWDA 1PP9E 1YI2P 1DEEG 1VQ5P 2N1TC 1JY3O 2HFED 4OVNF 1AQTA 2M3BA 1SFCA 3TYYA 3I56P 1FE6A 1IFIA 1NU1D 1EZVI 1OW8A 2WTYA 1KV4A 1AV1A 4K35A 4DZOA 2RH0A 5KLVE 3GPVA 1LT1A 4N3YB 3EFGA 4NPEA 1R8EA 1Y9BA 3L73D 1EDJA 4BRYB 3Q5SA 1L0LG 1N7SC 1J1DC 1T8ZA 3JC22 2KOGA 2W83C 5D90A 3KDPB 1GTWA 3RK2B 5APUA 2O01J 3WUTA 4GODA 2W27A 1YQ3C 2ZT9B 3RBZA 2WSEJ 2WSFJ 2KLVA 2WVRA 1NKNA 1HBWA 3OJAB 3E1RA 3BATA 1VQNP 3O6QA 4CPGA 1K73Q 2WPVB 3H1IE 3H1HD 1KC8Q 4AYZA 1IFMA 3B8EB 3CCUP 1PP9J 3B5NB 2WPQA 3MUDA 3L74G 4KT0J 1A02F 5AVXB 3LURA 3GHGC 2KLUA 5E79H 1M1JB 1DD3A 1PL5A 2OYIC 1L0NG 5AVUB 1DX7A 2E74D 1IFPA 4NPFX 1P84I 5AW2B 2V4HA 3FX0A 2YNYA 4R22B 2LXCB 2KB7P 2OTLP 1EQ7A 5AW6B 3NTNA 3QWOC 1IFJA 2KSEA 1NTKK 2Y0EA 3AEBC 3HUSB 3R8JA 2A06G 1NTKG 3RK3D 1U7MA 2FYNB 4AQRD 1IC2A 1Q81Q 1JO5A 1VL2A 3W68A 3VP8A 2XDJA 3D6YA 3AE8C 1LJ2A 3HE5B 1CW5A 3L71E 1VF5B 1PPJD 1MFTA 2KZJA 2YKPA 2P10A 4D6TD 2POHA 5CJ4A 2KYVA 1NJIQ 2YKOA 1M1JC 2Q3IA 5CHXA 4H13B 1S1CX 3B71A 2OYIA 3L74E 1AQ5A 4IFMA 2Q5UA 2JDIH 4D6TE 1LWUC 1BCCE 1KTMA 4C7NA 2XNDH 3SFEC 3CLQA 1NOHA 1S5LH 4H13D 4AYZB 4OH8B 5KTBA 5TJHA 3EQ2A 3UCSA 3VN0A 4AUWA 1X22A 3NMDA 2N9YB 3MTUE 3ZDMA 1NU1E 2B88A 1NYHA 3MP7B 4ASVA 5CCHA 2K3RA 1HJBA 4L74A 1WT6A 4LC1A 5EFWB 2ZVNB 3CX5E 4W80A 1EZVG 2QM8A 3CCJP 1RF0C 1JMBA 3RGUA 1VF5D 3H1JJ 1LP1A 1KILA 1QL1A 1FOSE 3PHLA 2QSIA 3M0AA 5APYA 1OVVA 3RL0D 2HLOA 2AEMA 1LTAC 2FYZA 4ZKUA 2HODA 3M0DC 4Y99C 1KZUB 3H1HE 1R8DA 1QVGO 2WT7B 1FC2C 5CMZA 3CWBE 1JMMA 3TF5A 3E1IA 2K1AA 2NPSA 1JNMA 4PV1C 1NTME 4GKGA 1LWUB 1SQQE 2JEEA 3FWNA 2A45G 5AVSB 1RF0A 2KI7B 3L36A 4PD4E 2W90A 1FZBA 1MV8A 1BGYD 1P84D 2GUVA 2C0WA 5AW5B 4H0LB 1TU3F 3L72E 3SFDC 1KN7A 2I8DA 4BXLA 1SQPK 2B87B 3GP4A 2GUSA 1R5LA 2AEFA 3PTZA 1OVUA 1OFCX 4OGQC 1ZW0A 5M1BA 4HB1A 4N78D 3SSUA 4I7ZB 3A2AA 4I1LA 1SQXD 1LGHB 4RKUJ 1EDIA 3HE4A 2BCCD 1E79H 1NTZE 5KJ7D 2IYOA 2L91A 2DW3A 5K5GB 1PP9D 3GHGB 1AA0A 3B5NA 4Z1MH 3CPWO 3H1HJ 1JCDA 4I2LC 3C1LA 1YITP 1PFIA 1KYOH 3A7OA 2Z5IA 3AE4C 3HUSA 2NPSC 1LTTC 3AEDC 1GL2A 1FAVA 2H88C 4WY4D 2LKMA 1LTJA 1U57A 5APWA 2N1TB 1HH0A 5KLIC 1UIIA 1MFZA 1YQ4C 2P1JA 5H2FH 3H1LG 2MJZA 2JO1A 2W6BA 2OTKE 3GHGA 3KXDA 2IBZD 1GDTA 1RF1A 2N1TA 1SQXJ 3C8VA 1OXZA 2ZJSE 3CC2P 3L73G 1HJ0A 2NPSB 1EDKA 4N6JA 4UB8H 1RH5B 2KS1A 1N7SD 2M8RA 1RQVA 1T6AA 2W8ZA 3CWBJ 4H13C 1GL2B 1VQOP 1YJNP 1Y47A 3E0HA 2OQQA 1BE3D 2KXPB 3Q3DA 5E01A 3HD7A 3CWBG 3EWKA 3H6PA 1CSBA 2KSJA 1OWAA 4L73A 3VMZA 3OW2O 1YHQP 3U1CA 4GT1A 3GG2A 2WSFH 2BCCJ 2JMLA 1N73C 4IFDK 4L76A 2D2CC 1MKMA 1QL2A 3GW6A 1VQLP 2O1JA 1BCCD 5KAWA 3L75D 1X9VA 2FYUG 1SQQK 5KLVJ 1LP1B 2XU6A 3MHVA 3EZ9A 2W6AA 2IFMA 1JTHA 4LLHA 1DD4A 4IFFA 1T2KC 3RL0g 1NWQA 1SQBD 1BOWA 1L0LE 3H1KE 1GL2D 1KMIZ 1G1IA 2V7QJ 1HUCA 1JY3N 3KZIH 2PFXA 1HTLC 2XKMA 3RK3E 3TGUG 1VF5C 2HYNA 5C39A 2L5GB 2QVAA 3IR9A 1PM6A 1QGKB 2VZ4A 3RK2D 1Q2NA 1HGZA 5TISH 1DH3A 3WUVA 1Y8AA 1SQXG 1X8YA 2Z4EA 1S2EA 1NTZG 4BWNA 2O3JA 3VYIA 5B5EE 1M1KQ 2RMZA 4H44B 1LTGC 1ZRTD 1KILB 3CX5H 3AE6C 2E43A 3D70A 3VTPC 4W7YA 2YXQB 1YIJP 2ZHHA 1AJYA 4PV1B 3TK1A 3EZ7A 1JM0A 1N2DC 3H1HG 4M3LA 3WUUA 1S5LE 3JCUE 3L72G 1WRGA 3EZ2A 2HODB 2FBWC 4RJTA 1JB0J 1L0LK 4R24B 4DJGA 3H1KJ 3BCCD 1RY3A 3GMAA 3BASA 1WMKA 4R4EA 5KAFE 4OGQD 4R4LA 1NTMG 2WSSH 3W67A 4KJMA 3HD7C 1SQXE 1BGYG 1SQBJ 1XTCC 2E74C 1URQC 4WY4B 3TNUB 1H88A 4JPZB 2YMYA 1Q0AA 1H0TB 1SLQA 5KLVD 4WBAA 2OG0A 1KILD 2OTJP 4JF7A 5AW4B 2QM7A 3WMM0 5BU8B 3L75J 1YTZT 2Q3EA 1KILE 3M9BA 3LW5H 4D6TJ 2IZ0A 5GTIE 4EDFA 2YO3A 1USEA 3V6IA 4A1MA 1HGVA 1LTIC 3MGNA 1RF1C 4JYCA 3WU2E 3S1KA 1LX8A 3A0BE 1D7MA 1Q08A 4JQ0D 2KVVA 1X0TA 4AYCA 1NTMK 1OX3A 3HD7B 5H2FE 1GD2E 1G2CA 1BE3J 5KATA 3VP9A 2FFDC 4U7JA 1HF9A 1SQVE 1M8OB 4IL6H 3CWBD 4K3AA 3BCCE 3H25A 5CCHC 1OVRA 1D5YA 1NHLA 1FZGA 5KAVA 2UWJE 4MN4C 3EZFA 1Q09A 3H1JG 5AW9B 1KYOE 3FWLA 2H7HA 2QIWA 1SVFA 3Q5PA 4HJGH 3HD7D 2IBZG 3V2PA 2CK3H 3H1JE 1QLED 3MD0A 3B49A 1N73B 1K05A 5CCGA 5KAUA 2WQYC 1EZVD 1G2CB 1N8RQ 3M9HA 1M1JA 1NVOA 5DJTB 4Y99B 2N1TD 3AECC 5KAIH 1NU1J 3M91A 2WSCJ 2ZHGA 1EDLA 2HG5D 4ZNCA 1FZCA 1GK6A 3KQGA 3TNUA 1CI6A 1VDFA 2P2UA 1JY3P 1IK9A 3CC4P 4U3FD 1VQPP 3A5TA 3PH0A 5GQQA 1NGMB 4GOFA 1PP9G 2A45H 1KORA 3CI9A 3RK3C 5CBOA 5KKZC 4DOJA 2IEFA 1NO4A 1J2JB 1VQ7P 4OWFA 3P32A 2J59M 3G71P 3S4RA 1FZFA 1NTZK 1P84H 1S4XA 2OYHA 1XTGB 3N4XA 2WPRA 2HR3A 2N9BA 5KCBA 1BGYJ 3RBXA 1USDA 2B9BA 3HE4B 5B66H 1S5LX 2ZAEB 2FFDA 3L70G 2LXBA 1NTMJ 1LTSC 3HTKB 3H1ID 3H1LE 2D2CB 1JCCA 2FXMA 5E79E 2ZYGA 1Q90D 1NTKE 2E76D 3A0BH 3CCLP 2ZYDA 2Q9IA 1SQVJ 2XZRA 1SQVK 4I7ZC 3QH9A 1SFCB 2QJYC 2M5AB 2D2CD 3OAKA 5CJ0A 2NPSD 2IZ1A 1AFOA 4YTPC 2P7JA 1LWUA 2E75C 2ZVOB 4TT3H 3H1JD 1URQA 1Q7YQ 1ZXGA 2MKVA 3L73E 3KHUA 2Y0CA 1N7SA 3LW5J 3KZIE 3H32B 1NTZJ 4WY4C 2Q6QA 1PGOA 1JBGA 2ITAA 3A0HE 3MZWB 2QA4P 3CX5I 5AW0B 1E5WA 2IX7C 3M0DA 1W5CE 1BSHA 2QJPC 1ZP0C 3IAOA 3P8MC 1BGYE 1P84E 2ZXXA 2JWAA 2Y9ZA 2K9JA 1SQVG 1ZOYC 2E76B 3FGAD 1A02J 3RL0B 1FBMA 1PGPA 2KS1B 3B5NC 2QE7H 3VMXA 3JCUH 3RK2C 4C46A 4DT0A 1GU4A 1OIPA 4J2NA 1FJKA 5APXA 3CCEP 1LTJC 4PJ0E 2B89A 5BU5A 2R44A 2WZ7A 4R4MA 1L2PA 2K88A 2OYHC 3B5ND 4RESB 1IK7A 1VQKP 1KYOD 4GOEA 1QEXA 2FYUJ 1VQ8P 2C9LY 1NAYA 1ZMEC 3E7KA 4UB6H 2O01H 4H44C 3AEFC 1SQPE 2E42A 3Q2YA 3C9IA 1BCCG 2RKLA 3A0HH 1ZRTE 2QG4A 3AE3C 1M56D 1L4AC 1PV3A 5AVRB 4H44D 3TGUJ 1KB9I 2BCCE 2J58A 3A3YB 4H0LD 1FZCC 1URQD 1VQ9P 3IN6A 3AE5C 5L8RJ 3SWYA 1NTKD 1IO4A 2JKVA 2FFDB 2O1KA 3L70D 5KLVK 2E5YA 1L4AB 1SQQJ 2R5DA 3BCCG 3V4WA 3CCRP 1QX8A 2YKQA 2WSCH 1Q06A 3HTKA 2K9JB 4D6TG 2Y9YA 3L74D 1NH4A 1L4AA 2YIUC 2FYUK 2M0BA 3N7NA 1K8AQ 1R5SA 5AW7B 2FYNC 2E75B 4IL6X 1HVVA 1IZNB 4EOTA 3F5HA 3KPEA 1PGQA 4GIFA 3CX5D 1GL2C 5KJ7A 1FZAA 1DEBA 2FY8A 1SFCC 2GA1A
chains in the Genus database with same CATH topology
2ZT9B 1KQGB 4YTPC 4Z1MH 2JMLA 2E75D 3AE6C 4Y28J 2WSEJ 3D70A 2WSFJ 1VF5B 2E75C 2E74B 2D2CC 1MKMA 1LX8A 4TT3H 3T97B 1Q08A 4H0LC 2P10A 5GQQA 1NGMB 2ZHHA 1R8DA 2NZ2A 2QJKC 1Y6UA 5I44A 2KVVA 1ZRTE 3AE4C 5KAWA 1Q05A 4DCZA 1AJYA 4PV1B 4OGQB 3S9OA 2MKVA 3EZ7A 4H13B 1S1CX 3AEDC 2H88C 3AE3C 3B71A 3Q5RA 3Q1MA 1EXIA 2E76C 3O6QA 5KATA 3LW5J 1KORA 4U7JA 1U57A 1PV3A 2FXPA 4H44D 1JBGA 5KKZC 2WPVB 1HF9A 5KLIC 2IEFA 3R8KA 2JP3A 3AEGC 3D71A 3H25A 3EZ2A 4PV1C 3EZ9A 3HH0A 2FBWC 2GOVA 1D5YA 1KTMA 4H0LD 4LHFA 4AYZA 2DG6A 4WLSA 3GF7A 1JB0J 1YQ4C 4R24B 1DD4A 2BEQD 5KAVA 2JO1A 3ABVC 2QJPC 2HVAA 3IN6A 1ZP0C 3SFEC 3RL0g 3EZFA 1Q09A 3IAOA 1OW6A 3AE5C 3GF3A 3GMAA 5L8RJ 1BOWA 1OMIA 2KCUA 2QIWA 1PIXA 3AE7C 1WMKA 4KT0J 4B0YA 4R4EA 3Q5PA 3LURA 4OGQD 1DD3A 3AE1C 3C8VA 5KCBA 4R4LA 1ZOYC 4H13D 4AYZB 1GMJA 2E76B 3FGAD 2IDBA 4YXDC 1KMIZ 1DIPA 1K04A 3UCSA 2BEZF 1PL5A 2V7QJ 1JYHA 4H0LB 1RH6A 1TU3F 2YMKA 1OW8A 3SFDC 1HJ0A 1S5LX 3RK3E 3AE2C 1RQUA 1FDOA 1VF5C 3B49A 2J5UA 1K05A 3D6ZA 2E74D 1NYHA 1Q06A 2D2CB 2E74C 5KAUA 1PM6A 2ZT9C 1RQVA 3GLMA 4R22B 2VZ4A 2G8YA 5D8CA 3GPVA 1Q90D 3GP4A 2WQYC 4J2NA 5I41B 1KQFB 1R8EA 1Q0AA 1UIXA 1Y9BA 4H13C 3R4YA 2YIUC 2E76D 4OGQC 1Q07A 4WLWA 2K9YA 4R4MA 2OG0A 3Q5SA 2OQQA 3E0HA 2ZT9D 5M1BA 3Q3DA 3AEBC 5E01A 3AECC 2FYNC 3EWKA 1OW7A 1IK7A 2E75B 4IL6X 5KAXA 3EZ6A 3AEAC 4I7ZC 1VF5D 3R8JA 4GDOA 1FDIA 2H89C 2WSCJ 4I7ZB 2ZHGA 4XFJA 1KILE 3AEEC 5D90A 4RKUJ 2BOWA 2QJYC 1VL2A 2G3AA 1ZMEC 2O01J 3AE9C 4H44B 2D2CD 3D6YA 4PV1D 3G9RA 1YQ3C 3AE8C 2QSIA 4H44C 3AEFC 4A1MA 3QAOA 3GK6A 3Q2YA 1EXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q07 A;  4WLW A;  3R8K A;  4R4M A;  1DIP A;  1JYH A;  3UCS A;  3Q5S A;  2OQQ A;  3E0H A;  3D71 A;  2JML A;  3Q3D A;  5E01 A;  3D70 A;  3HH0 A;  2GOV A;  1D5Y A;  5KAX A;  4AYZ A;  2DG6 A;  4WLS A;  3T97 B;  1Q08 A;  4R24 B;  2J5U A;  3B49 A;  3D6Z A;  5GQQ A;  5KAV A;  3R8J A;  2ZHG A;  2ZHH A;  1R8D A;  2HVA A;  1Q06 A;  5D90 A;  5KAU A;  1Q09 A;  3IAO A;  5KAW A;  1Q05 A;  2BOW A;  1BOW A;  4R22 B;  2VZ4 A;  2KCU A;  5D8C A;  3GPV A;  4B0Y A;  4R4E A;  3GP4 A;  3Q5P A;  4J2N A;  5I41 B;  3Q2Y A;  3D6Y A;  3Q5R A;  3Q1M A;  1R8E A;  1EXI A;  3G9R A;  1Q0A A;  3LUR A;  5KAT A;  4A1M A;  3QAO A;  3GK6 A;  5KCB A;  4R4L A;  4AYZ B;  5I44 A;  1JBG A;  1EXJ A; 
#chains in the Genus database with same CATH topology
 4KHX A;  1N73 A;  3MUD C;  3H1I G;  1ZR2 A;  1BE3 G;  3T97 B;  5AVT B;  1J1D B;  3TGU D;  2A06 E;  1N7S B;  5AW3 B;  1RHZ B;  1FZC B;  2OYI B;  3CCM P;  1IJD B;  3H1K G;  2OYO A;  2Y0D A;  3Q1M A;  4ZMD A;  5GTH H;  1KB9 H;  3L72 J;  2B87 A;  4A7P A;  3L73 J;  1FZE A;  3AEG C;  1KFM A;  3HE5 A;  4L75 A;  3CME P;  1KQS O;  1CI6 B;  2AEJ A;  1L0N E;  1GZL A;  2AXT E;  3P8C D;  1L0N D;  2YMK A;  3AE2 C;  2H43 A;  4EI2 A;  4EYY Q;  4U3F E;  2PGD A;  3USS A;  2QEX P;  1H8A A;  2P58 A;  2IYP A;  3GLM A;  2OYH B;  1SQB G;  3K5B A;  2C9N Y;  4C7R A;  5APV A;  1T2K D;  2V7Q H;  1SQP G;  1KQL A;  1Z56 A;  3CCS P;  2ZT9 D;  3TGU E;  2IBZ I;  4WVZ A;  3H1L D;  1OW7 A;  3AEA C;  1SQB E;  1BE3 E;  1JUN A;  5CCG D;  1BDC A;  3NFQ A;  4LGD E;  1N7L A;  1T3J A;  1OZH A;  1FS0 E;  2Q1K A;  2AXC A;  2M5A A;  1EZV E;  2KIK A;  4PD4 H;  3V2N A;  1SQP J;  1JY2 O;  4H0L C;  2QJK C;  1NTZ D;  3HRN A;  1Q05 A;  5KAI E;  3L71 G;  4OGQ B;  1PPJ E;  2YIU B;  2R32 A;  2C0X A;  3U1A A;  2FXP A;  5TIS E;  4C7N B;  2JP3 A;  3D71 A;  5KLV G;  2VRS A;  1M90 Q;  1S3J A;  4LHF A;  2R5B A;  2QJP B;  3GF7 A;  3CL3 D;  2E5T A;  1OW6 A;  2KZI A;  3L70 E;  2WPS A;  2H8P D;  4B0Y A;  1H89 A;  2BCC G;  1GMJ A;  2ZFC A;  2IDB A;  1BDD A;  1JYH A;  1K04 A;  2QJK B;  3II6 A;  3PP5 A;  5AVV B;  1SP4 A;  1RH6 A;  1AVY A;  2RN0 A;  2WWW A;  1FDO A;  4JYB A;  2J5U A;  3D6Z A;  3O6Q B;  3ITK A;  1VPC A;  5I41 B;  2NRG A;  1NAF A;  3OA7 A;  1Q07 A;  3H1I J;  1FU1 A;  1NU1 K;  1J1E B;  1PGJ A;  3G6E P;  1YBK A;  1U7J A;  2K37 A;  1Q82 Q;  4N78 E;  1HWT C;  3AEE C;  3FXE A;  3U59 A;  3L4F A;  5KAF H;  4HH2 A;  5BVZ A;  1L4A D;  1KB9 D;  4PV1 D;  1ZLL A;  1S72 P;  2A45 I;  2CPB A;  2ZXE B;  1PZQ A;  5AVZ B;  2PP6 A;  1X79 B;  2R3S A;  4PD4 I;  1KD1 Q;  3CXH E;  1JTH B;  2OGU A;  3L72 D;  3H1L J;  2XNX A;  3Q5R A;  1EXI A;  2ZYA A;  3BRV B;  5KLI B;  1VQ4 P;  4ZKP A;  1JY2 N;  2JR8 A;  1YYC A;  1NKZ B;  3HH0 A;  3VMA A;  3KYQ A;  2I1J A;  2DG6 A;  4WLS A;  1SFC D;  2FKW B;  3M06 A;  3O8Z A;  4BRY A;  3L71 J;  3ABV C;  3CXH D;  3GF3 A;  1LT9 C;  1ZR4 A;  1VQ6 P;  2KCU A;  4HKZ H;  4O9B A;  1L0N J;  1DIP A;  3FXD A;  1KB9 E;  2BEZ F;  1S9K D;  1N86 A;  3IF4 A;  5APT A;  1IFD A;  1RQU A;  5B66 E;  1YTZ I;  3L37 A;  2WIT A;  3CXH H;  3L35 A;  5D8C A;  3L74 J;  2W6J H;  1L0L D;  1BSN A;  4PD4 D;  1RE4 C;  4JBZ A;  3V5B A;  1SQQ D;  1FDI A;  2H89 C;  5GTI H;  1AVO A;  3VMY A;  1KYO I;  1LTJ B;  3AE9 C;  2JJL A;  2AXT H;  3R2P A;  1NTK J;  3L75 E;  3PLN A;  2YXR B;  3GK6 A;  4YPC A;  1LTB C;  3SWK A;  3H32 A;  1SQB K;  3LIE A;  5DJU B;  2E74 B;  3SWF A;  3B4S A;  1FOS F;  4DCZ A;  3TSI A;  1MZ9 A;  3EFF K;  1G1J A;  1YJ9 P;  5AVW B;  2O01 N;  1ZN5 A;  4WY4 A;  3R8K A;  1L0L J;  3I5C A;  4WB4 A;  4YXW H;  1CZQ A;  2PRR A;  4XA4 A;  2CPS A;  1EC5 A;  4XE5 B;  3CCV P;  3V2R A;  1OMI A;  1LNQ A;  3P8C E;  1PIX A;  3AE7 C;  3IFM A;  2SPZ A;  2FYU E;  2WMM A;  2HPC A;  3WU2 H;  2KK7 A;  3AE1 C;  2FYU D;  1LT9 B;  1JY2 P;  1H0T A;  3L70 J;  5APS A;  2XV5 A;  1GW3 A;  1GW4 A;  1YJW P;  1KFN A;  3BVH A;  3V2Q A;  3L71 D;  1KIL C;  5AVY B;  1JOC A;  1W2E A;  2QRX A;  4ASW A;  4IOI H;  2G8Y A;  1UIX A;  3UIA A;  1RE3 C;  4WLW A;  2R3C A;  2A06 D;  2KNC A;  4U3F G;  3G4S P;  4UB6 E;  1URQ B;  5KAX A;  4B86 A;  1RE3 A;  1J1E C;  4XFJ A;  1SS1 A;  2HPC B;  3F89 A;  2BOW A;  2G3A A;  2GM4 A;  3T97 A;  1T3U A;  3G9R A;  5KJ7 C;  3CD6 P;  4NPD A;  2QJY B;  1PPJ G;  1EXJ A;  3H1K D;  3BCC J;  1SQQ G;  1LT9 A;  2PAJ A;  3MIW A;  3NXS A;  3TDK A;  1Y6U A;  4RO0 A;  3S9O A;  3RL0 C;  5AVQ B;  4DCK A;  1FDM A;  1L0N K;  1MUU A;  5AW8 B;  2IBZ E;  1GU5 A;  2GOV A;  4IL6 E;  3BRT B;  2YO2 A;  3CC7 P;  2Z5H A;  1FJP A;  4WWI A;  4TLF A;  4EIJ A;  5KKZ B;  3RK3 B;  3JSV C;  1VQM P;  3CXH I;  2P67 A;  4YXD C;  3PRJ A;  1M7L A;  2ZT9 C;  4PJ0 H;  3HUS C;  3I55 P;  1KQF B;  3R4Y A;  2K9Y A;  1NTM D;  1RE4 A;  5CCH D;  3EZ6 A;  2KUB A;  2BAS A;  4GDO A;  1RF1 B;  5CBN A;  3G3Z A;  2M3E A;  3PJS K;  1SQP D;  2WT7 A;  3CCQ P;  2KNC B;  5AW1 B;  1M57 D;  1NU1 G;  3QAO A;  1QVF O;  5I44 A;  1KQG B;  4W7Z A;  2E75 D;  4Y28 J;  3P7K A;  3LID A;  1K9M Q;  2LR2 A;  3VOP A;  1JEK A;  2NZ2 A;  1S9K E;  5CCG C;  1W2B O;  1SQX K;  2Q7C A;  4UB8 E;  4QMA A;  1IFN A;  1SQV D;  2E76 C;  4I6M C;  2I1K A;  2WSE H;  1BCC J;  3L75 G;  2IPP A;  3CMA P;  5B5E H;  1Q86 Q;  3V4Q A;  4U3F J;  5APQ A;  5GTH E;  2OAR A;  1GK4 A;  4HYT B;  2FXO A;  3M9Q A;  2BEQ D;  2IFN A;  2KP8 A;  2HVA A;  1ZV8 A;  2JWD A;  1PP9 E;  1YI2 P;  1DEE G;  1VQ5 P;  2N1T C;  1JY3 O;  2HFE D;  4OVN F;  1AQT A;  2M3B A;  1SFC A;  3TYY A;  3I56 P;  1FE6 A;  1IFI A;  1NU1 D;  1EZV I;  1OW8 A;  2WTY A;  1KV4 A;  1AV1 A;  4K35 A;  4DZO A;  2RH0 A;  5KLV E;  3GPV A;  1LT1 A;  4N3Y B;  3EFG A;  4NPE A;  1R8E A;  1Y9B A;  3L73 D;  1EDJ A;  4BRY B;  3Q5S A;  1L0L G;  1N7S C;  1J1D C;  1T8Z A;  3JC2 2;  2KOG A;  2W83 C;  5D90 A;  3KDP B;  1GTW A;  3RK2 B;  5APU A;  2O01 J;  3WUT A;  4GOD A;  2W27 A;  1YQ3 C;  2ZT9 B;  3RBZ A;  2WSE J;  2WSF J;  2KLV A;  2WVR A;  1NKN A;  1HBW A;  3OJA B;  3E1R A;  3BAT A;  1VQN P;  3O6Q A;  4CPG A;  1K73 Q;  2WPV B;  3H1I E;  3H1H D;  1KC8 Q;  4AYZ A;  1IFM A;  3B8E B;  3CCU P;  1PP9 J;  3B5N B;  2WPQ A;  3MUD A;  3L74 G;  4KT0 J;  1A02 F;  5AVX B;  3LUR A;  3GHG C;  2KLU A;  5E79 H;  1M1J B;  1DD3 A;  1PL5 A;  2OYI C;  1L0N G;  5AVU B;  1DX7 A;  2E74 D;  1IFP A;  4NPF X;  1P84 I;  5AW2 B;  2V4H A;  3FX0 A;  2YNY A;  4R22 B;  2LXC B;  2KB7 P;  2OTL P;  1EQ7 A;  5AW6 B;  3NTN A;  3QWO C;  1IFJ A;  2KSE A;  1NTK K;  2Y0E A;  3AEB C;  3HUS B;  3R8J A;  2A06 G;  1NTK G;  3RK3 D;  1U7M A;  2FYN B;  4AQR D;  1IC2 A;  1Q81 Q;  1JO5 A;  1VL2 A;  3W68 A;  3VP8 A;  2XDJ A;  3D6Y A;  3AE8 C;  1LJ2 A;  3HE5 B;  1CW5 A;  3L71 E;  1VF5 B;  1PPJ D;  1MFT A;  2KZJ A;  2YKP A;  2P10 A;  4D6T D;  2POH A;  5CJ4 A;  2KYV A;  1NJI Q;  2YKO A;  1M1J C;  2Q3I A;  5CHX A;  4H13 B;  1S1C X;  3B71 A;  2OYI A;  3L74 E;  1AQ5 A;  4IFM A;  2Q5U A;  2JDI H;  4D6T E;  1LWU C;  1BCC E;  1KTM A;  4C7N A;  2XND H;  3SFE C;  3CLQ A;  1NOH A;  1S5L H;  4H13 D;  4AYZ B;  4OH8 B;  5KTB A;  5TJH A;  3EQ2 A;  3UCS A;  3VN0 A;  4AUW A;  1X22 A;  3NMD A;  2N9Y B;  3MTU E;  3ZDM A;  1NU1 E;  2B88 A;  1NYH A;  3MP7 B;  4ASV A;  5CCH A;  2K3R A;  1HJB A;  4L74 A;  1WT6 A;  4LC1 A;  5EFW B;  2ZVN B;  3CX5 E;  4W80 A;  1EZV G;  2QM8 A;  3CCJ P;  1RF0 C;  1JMB A;  3RGU A;  1VF5 D;  3H1J J;  1LP1 A;  1KIL A;  1QL1 A;  1FOS E;  3PHL A;  2QSI A;  3M0A A;  5APY A;  1OVV A;  3RL0 D;  2HLO A;  2AEM A;  1LTA C;  2FYZ A;  4ZKU A;  2HOD A;  3M0D C;  4Y99 C;  1KZU B;  3H1H E;  1R8D A;  1QVG O;  2WT7 B;  1FC2 C;  5CMZ A;  3CWB E;  1JMM A;  3TF5 A;  3E1I A;  2K1A A;  2NPS A;  1JNM A;  4PV1 C;  1NTM E;  4GKG A;  1LWU B;  1SQQ E;  2JEE A;  3FWN A;  2A45 G;  5AVS B;  1RF0 A;  2KI7 B;  3L36 A;  4PD4 E;  2W90 A;  1FZB A;  1MV8 A;  1BGY D;  1P84 D;  2GUV A;  2C0W A;  5AW5 B;  4H0L B;  1TU3 F;  3L72 E;  3SFD C;  1KN7 A;  2I8D A;  4BXL A;  1SQP K;  2B87 B;  3GP4 A;  2GUS A;  1R5L A;  2AEF A;  3PTZ A;  1OVU A;  1OFC X;  4OGQ C;  1ZW0 A;  5M1B A;  4HB1 A;  4N78 D;  3SSU A;  4I7Z B;  3A2A A;  4I1L A;  1SQX D;  1LGH B;  4RKU J;  1EDI A;  3HE4 A;  2BCC D;  1E79 H;  1NTZ E;  5KJ7 D;  2IYO A;  2L91 A;  2DW3 A;  5K5G B;  1PP9 D;  3GHG B;  1AA0 A;  3B5N A;  4Z1M H;  3CPW O;  3H1H J;  1JCD A;  4I2L C;  3C1L A;  1YIT P;  1PFI A;  1KYO H;  3A7O A;  2Z5I A;  3AE4 C;  3HUS A;  2NPS C;  1LTT C;  3AED C;  1GL2 A;  1FAV A;  2H88 C;  4WY4 D;  2LKM A;  1LTJ A;  1U57 A;  5APW A;  2N1T B;  1HH0 A;  5KLI C;  1UII A;  1MFZ A;  1YQ4 C;  2P1J A;  5H2F H;  3H1L G;  2MJZ A;  2JO1 A;  2W6B A;  2OTK E;  3GHG A;  3KXD A;  2IBZ D;  1GDT A;  1RF1 A;  2N1T A;  1SQX J;  3C8V A;  1OXZ A;  2ZJS E;  3CC2 P;  3L73 G;  1HJ0 A;  2NPS B;  1EDK A;  4N6J A;  4UB8 H;  1RH5 B;  2KS1 A;  1N7S D;  2M8R A;  1RQV A;  1T6A A;  2W8Z A;  3CWB J;  4H13 C;  1GL2 B;  1VQO P;  1YJN P;  1Y47 A;  3E0H A;  2OQQ A;  1BE3 D;  2KXP B;  3Q3D A;  5E01 A;  3HD7 A;  3CWB G;  3EWK A;  3H6P A;  1CSB A;  2KSJ A;  1OWA A;  4L73 A;  3VMZ A;  3OW2 O;  1YHQ P;  3U1C A;  4GT1 A;  3GG2 A;  2WSF H;  2BCC J;  2JML A;  1N73 C;  4IFD K;  4L76 A;  2D2C C;  1MKM A;  1QL2 A;  3GW6 A;  1VQL P;  2O1J A;  1BCC D;  5KAW A;  3L75 D;  1X9V A;  2FYU G;  1SQQ K;  5KLV J;  1LP1 B;  2XU6 A;  3MHV A;  3EZ9 A;  2W6A A;  2IFM A;  1JTH A;  4LLH A;  1DD4 A;  4IFF A;  1T2K C;  3RL0 g;  1NWQ A;  1SQB D;  1BOW A;  1L0L E;  3H1K E;  1GL2 D;  1KMI Z;  1G1I A;  2V7Q J;  1HUC A;  1JY3 N;  3KZI H;  2PFX A;  1HTL C;  2XKM A;  3RK3 E;  3TGU G;  1VF5 C;  2HYN A;  5C39 A;  2L5G B;  2QVA A;  3IR9 A;  1PM6 A;  1QGK B;  2VZ4 A;  3RK2 D;  1Q2N A;  1HGZ A;  5TIS H;  1DH3 A;  3WUV A;  1Y8A A;  1SQX G;  1X8Y A;  2Z4E A;  1S2E A;  1NTZ G;  4BWN A;  2O3J A;  3VYI A;  5B5E E;  1M1K Q;  2RMZ A;  4H44 B;  1LTG C;  1ZRT D;  1KIL B;  3CX5 H;  3AE6 C;  2E43 A;  3D70 A;  3VTP C;  4W7Y A;  2YXQ B;  1YIJ P;  2ZHH A;  1AJY A;  4PV1 B;  3TK1 A;  3EZ7 A;  1JM0 A;  1N2D C;  3H1H G;  4M3L A;  3WUU A;  1S5L E;  3JCU E;  3L72 G;  1WRG A;  3EZ2 A;  2HOD B;  2FBW C;  4RJT A;  1JB0 J;  1L0L K;  4R24 B;  4DJG A;  3H1K J;  3BCC D;  1RY3 A;  3GMA A;  3BAS A;  1WMK A;  4R4E A;  5KAF E;  4OGQ D;  4R4L A;  1NTM G;  2WSS H;  3W67 A;  4KJM A;  3HD7 C;  1SQX E;  1BGY G;  1SQB J;  1XTC C;  2E74 C;  1URQ C;  4WY4 B;  3TNU B;  1H88 A;  4JPZ B;  2YMY A;  1Q0A A;  1H0T B;  1SLQ A;  5KLV D;  4WBA A;  2OG0 A;  1KIL D;  2OTJ P;  4JF7 A;  5AW4 B;  2QM7 A;  3WMM 0;  5BU8 B;  3L75 J;  1YTZ T;  2Q3E A;  1KIL E;  3M9B A;  3LW5 H;  4D6T J;  2IZ0 A;  5GTI E;  4EDF A;  2YO3 A;  1USE A;  3V6I A;  4A1M A;  1HGV A;  1LTI C;  3MGN A;  1RF1 C;  4JYC A;  3WU2 E;  3S1K A;  1LX8 A;  3A0B E;  1D7M A;  1Q08 A;  4JQ0 D;  2KVV A;  1X0T A;  4AYC A;  1NTM K;  1OX3 A;  3HD7 B;  5H2F E;  1GD2 E;  1G2C A;  1BE3 J;  5KAT A;  3VP9 A;  2FFD C;  4U7J A;  1HF9 A;  1SQV E;  1M8O B;  4IL6 H;  3CWB D;  4K3A A;  3BCC E;  3H25 A;  5CCH C;  1OVR A;  1D5Y A;  1NHL A;  1FZG A;  5KAV A;  2UWJ E;  4MN4 C;  3EZF A;  1Q09 A;  3H1J G;  5AW9 B;  1KYO E;  3FWL A;  2H7H A;  2QIW A;  1SVF A;  3Q5P A;  4HJG H;  3HD7 D;  2IBZ G;  3V2P A;  2CK3 H;  3H1J E;  1QLE D;  3MD0 A;  3B49 A;  1N73 B;  1K05 A;  5CCG A;  5KAU A;  2WQY C;  1EZV D;  1G2C B;  1N8R Q;  3M9H A;  1M1J A;  1NVO A;  5DJT B;  4Y99 B;  2N1T D;  3AEC C;  5KAI H;  1NU1 J;  3M91 A;  2WSC J;  2ZHG A;  1EDL A;  2HG5 D;  4ZNC A;  1FZC A;  1GK6 A;  3KQG A;  3TNU A;  1CI6 A;  1VDF A;  2P2U A;  1JY3 P;  1IK9 A;  3CC4 P;  4U3F D;  1VQP P;  3A5T A;  3PH0 A;  5GQQ A;  1NGM B;  4GOF A;  1PP9 G;  2A45 H;  1KOR A;  3CI9 A;  3RK3 C;  5CBO A;  5KKZ C;  4DOJ A;  2IEF A;  1NO4 A;  1J2J B;  1VQ7 P;  4OWF A;  3P32 A;  2J59 M;  3G71 P;  3S4R A;  1FZF A;  1NTZ K;  1P84 H;  1S4X A;  2OYH A;  1XTG B;  3N4X A;  2WPR A;  2HR3 A;  2N9B A;  5KCB A;  1BGY J;  3RBX A;  1USD A;  2B9B A;  3HE4 B;  5B66 H;  1S5L X;  2ZAE B;  2FFD A;  3L70 G;  2LXB A;  1NTM J;  1LTS C;  3HTK B;  3H1I D;  3H1L E;  2D2C B;  1JCC A;  2FXM A;  5E79 E;  2ZYG A;  1Q90 D;  1NTK E;  2E76 D;  3A0B H;  3CCL P;  2ZYD A;  2Q9I A;  1SQV J;  2XZR A;  1SQV K;  4I7Z C;  3QH9 A;  1SFC B;  2QJY C;  2M5A B;  2D2C D;  3OAK A;  5CJ0 A;  2NPS D;  2IZ1 A;  1AFO A;  4YTP C;  2P7J A;  1LWU A;  2E75 C;  2ZVO B;  4TT3 H;  3H1J D;  1URQ A;  1Q7Y Q;  1ZXG A;  2MKV A;  3L73 E;  3KHU A;  2Y0C A;  1N7S A;  3LW5 J;  3KZI E;  3H32 B;  1NTZ J;  4WY4 C;  2Q6Q A;  1PGO A;  1JBG A;  2ITA A;  3A0H E;  3MZW B;  2QA4 P;  3CX5 I;  5AW0 B;  1E5W A;  2IX7 C;  3M0D A;  1W5C E;  1BSH A;  2QJP C;  1ZP0 C;  3IAO A;  3P8M C;  1BGY E;  1P84 E;  2ZXX A;  2JWA A;  2Y9Z A;  2K9J A;  1SQV G;  1ZOY C;  2E76 B;  3FGA D;  1A02 J;  3RL0 B;  1FBM A;  1PGP A;  2KS1 B;  3B5N C;  2QE7 H;  3VMX A;  3JCU H;  3RK2 C;  4C46 A;  4DT0 A;  1GU4 A;  1OIP A;  4J2N A;  1FJK A;  5APX A;  3CCE P;  1LTJ C;  4PJ0 E;  2B89 A;  5BU5 A;  2R44 A;  2WZ7 A;  4R4M A;  1L2P A;  2K88 A;  2OYH C;  3B5N D;  4RES B;  1IK7 A;  1VQK P;  1KYO D;  4GOE A;  1QEX A;  2FYU J;  1VQ8 P;  2C9L Y;  1NAY A;  1ZME C;  3E7K A;  4UB6 H;  2O01 H;  4H44 C;  3AEF C;  1SQP E;  2E42 A;  3Q2Y A;  3C9I A;  1BCC G;  2RKL A;  3A0H H;  1ZRT E;  2QG4 A;  3AE3 C;  1M56 D;  1L4A C;  1PV3 A;  5AVR B;  4H44 D;  3TGU J;  1KB9 I;  2BCC E;  2J58 A;  3A3Y B;  4H0L D;  1FZC C;  1URQ D;  1VQ9 P;  3IN6 A;  3AE5 C;  5L8R J;  3SWY A;  1NTK D;  1IO4 A;  2JKV A;  2FFD B;  2O1K A;  3L70 D;  5KLV K;  2E5Y A;  1L4A B;  1SQQ J;  2R5D A;  3BCC G;  3V4W A;  3CCR P;  1QX8 A;  2YKQ A;  2WSC H;  1Q06 A;  3HTK A;  2K9J B;  4D6T G;  2Y9Y A;  3L74 D;  1NH4 A;  1L4A A;  2YIU C;  2FYU K;  2M0B A;  3N7N A;  1K8A Q;  1R5S A;  5AW7 B;  2FYN C;  2E75 B;  4IL6 X;  1HVV A;  1IZN B;  4EOT A;  3F5H A;  3KPE A;  1PGQ A;  4GIF A;  3CX5 D;  1GL2 C;  5KJ7 A;  1FZA A;  1DEB A;  2FY8 A;  1SFC C;  2GA1 A; 
#chains in the Genus database with same CATH homology
 2ZT9 B;  1KQG B;  4YTP C;  4Z1M H;  2JML A;  2E75 D;  3AE6 C;  4Y28 J;  2WSE J;  3D70 A;  2WSF J;  1VF5 B;  2E75 C;  2E74 B;  2D2C C;  1MKM A;  1LX8 A;  4TT3 H;  3T97 B;  1Q08 A;  4H0L C;  2P10 A;  5GQQ A;  1NGM B;  2ZHH A;  1R8D A;  2NZ2 A;  2QJK C;  1Y6U A;  5I44 A;  2KVV A;  1ZRT E;  3AE4 C;  5KAW A;  1Q05 A;  4DCZ A;  1AJY A;  4PV1 B;  4OGQ B;  3S9O A;  2MKV A;  3EZ7 A;  4H13 B;  1S1C X;  3AED C;  2H88 C;  3AE3 C;  3B71 A;  3Q5R A;  3Q1M A;  1EXI A;  2E76 C;  3O6Q A;  5KAT A;  3LW5 J;  1KOR A;  4U7J A;  1U57 A;  1PV3 A;  2FXP A;  4H44 D;  1JBG A;  5KKZ C;  2WPV B;  1HF9 A;  5KLI C;  2IEF A;  3R8K A;  2JP3 A;  3AEG C;  3D71 A;  3H25 A;  3EZ2 A;  4PV1 C;  3EZ9 A;  3HH0 A;  2FBW C;  2GOV A;  1D5Y A;  1KTM A;  4H0L D;  4LHF A;  4AYZ A;  2DG6 A;  4WLS A;  3GF7 A;  1JB0 J;  1YQ4 C;  4R24 B;  1DD4 A;  2BEQ D;  5KAV A;  2JO1 A;  3ABV C;  2QJP C;  2HVA A;  3IN6 A;  1ZP0 C;  3SFE C;  3RL0 g;  3EZF A;  1Q09 A;  3IAO A;  1OW6 A;  3AE5 C;  3GF3 A;  3GMA A;  5L8R J;  1BOW A;  1OMI A;  2KCU A;  2QIW A;  1PIX A;  3AE7 C;  1WMK A;  4KT0 J;  4B0Y A;  4R4E A;  3Q5P A;  3LUR A;  4OGQ D;  1DD3 A;  3AE1 C;  3C8V A;  5KCB A;  4R4L A;  1ZOY C;  4H13 D;  4AYZ B;  1GMJ A;  2E76 B;  3FGA D;  2IDB A;  4YXD C;  1KMI Z;  1DIP A;  1K04 A;  3UCS A;  2BEZ F;  1PL5 A;  2V7Q J;  1JYH A;  4H0L B;  1RH6 A;  1TU3 F;  2YMK A;  1OW8 A;  3SFD C;  1HJ0 A;  1S5L X;  3RK3 E;  3AE2 C;  1RQU A;  1FDO A;  1VF5 C;  3B49 A;  2J5U A;  1K05 A;  3D6Z A;  2E74 D;  1NYH A;  1Q06 A;  2D2C B;  2E74 C;  5KAU A;  1PM6 A;  2ZT9 C;  1RQV A;  3GLM A;  4R22 B;  2VZ4 A;  2G8Y A;  5D8C A;  3GPV A;  1Q90 D;  3GP4 A;  2WQY C;  4J2N A;  5I41 B;  1KQF B;  1R8E A;  1Q0A A;  1UIX A;  1Y9B A;  4H13 C;  3R4Y A;  2YIU C;  2E76 D;  4OGQ C;  1Q07 A;  4WLW A;  2K9Y A;  4R4M A;  2OG0 A;  3Q5S A;  2OQQ A;  3E0H A;  2ZT9 D;  5M1B A;  3Q3D A;  3AEB C;  5E01 A;  3AEC C;  2FYN C;  3EWK A;  1OW7 A;  1IK7 A;  2E75 B;  4IL6 X;  5KAX A;  3EZ6 A;  3AEA C;  4I7Z C;  1VF5 D;  3R8J A;  4GDO A;  1FDI A;  2H89 C;  2WSC J;  4I7Z B;  2ZHG A;  4XFJ A;  1KIL E;  3AEE C;  5D90 A;  4RKU J;  2BOW A;  2QJY C;  1VL2 A;  2G3A A;  1ZME C;  2O01 J;  3AE9 C;  4H44 B;  2D2C D;  3D6Y A;  4PV1 D;  3G9R A;  1YQ3 C;  3AE8 C;  2QSI A;  4H44 C;  3AEF C;  4A1M A;  3QAO A;  3GK6 A;  3Q2Y A;  1EXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...