1EXJA

Crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*A
publication title Crystal structure of the transcription activator BmrR bound to DNA and a drug.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 68
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2000-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1exjA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1exjA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1exjA01
3Q3DA 1D5YA 3UCSA 5I41B 1R8DA 2OQQA 3R8KA 5KAWA 2GOVA 5GQQA 1EXJA 5D8CA 3LURA 5I44A 5E01A 4B0YA 1Q0AA 4AYZA 1Q08A 3GP4A 4R22B 5KAVA 1Q06A 5KATA 5D90A 5KCBA 4A1MA 2ZHHA 3QAOA 4J2NA 2ZHGA 3Q5RA 2KCUA 1Q09A 5KAUA 1DIPA 3E0HA 2VZ4A 2DG6A 3R8JA 4AYZB 3Q2YA 1Q05A 1JBGA 4R4LA 3Q1MA 3G9RA 3B49A 3Q5PA 1JYHA 3D6ZA 4WLSA 2JMLA 4WLWA 3GPVA 1R8EA 5KAXA 3T97B 3D6YA 3D71A 3Q5SA 1Q07A 4R24B 2BOWA 2HVAA 3GK6A 4R4EA 1EXIA 3D70A 3IAOA 1BOWA 3HH0A 4R4MA 2J5UA
chains in the Genus database with same CATH superfamily
3VP8A 2R5DA 2JWAA 2IFNA 1DX7A 3OAKA 3RK3B 1LX8A 1E5WA 3H32A 2W27A 1KYOH 4JQ0D 3T97B 4ASWA 1VQ6P 1GK6A 1SQVE 3H1JJ 3CXHE 2OYHC 1NAYA 3B5NB 1LTJB 2NRGA 3U1AA 3L70J 1A02J 2M0BA 1AVOA 2O1JA 3H1ID 2XZRA 3I5CA 1LWUA 1P84E 1PPJG 1SQQG 1G2CB 3SSUA 1JMMA 2YKOA 3HE5A 3H1KD 1VF5B 3KXDA 5D8CA 1LTSC 2KS1B 2R32A 1L0LG 1J1EC 2AXTE 1GK4A 2OTJP 3H1JE 2HODB 1PFIA 1WT6A 2QM8A 2BOWA 4H44B 5KKZB 3L70E 3CXHH 3H1HG 2Y0DA 5DJUB 1IZNB 1YTZT 1G1JA 5GTHE 3HD7C 1DD4A 4DCKA 2IBZD 3BRTB 2O1KA 1OW8A 2N9YB 2L5GB 1L4AD 4YTPC 1SQQK 3L73E 3PH0A 1X79B 1RF1B 1Y6UA 2HFED 2FYNC 3BCCD 3WU2E 5KJ7A 1H89A 2AXTH 4PD4D 3RK2B 1LTGC 1NYHA 4L76A 1BGYJ 3CX5D 5KLIB 1CSBA 3CWBJ 1YI2P 2D2CD 5APQA 3PP5A 5APXA 1Y47A 3VN0A 1LTTC 5GTHH 2K88A 5B5EH 1ZRTE 1K9MQ 3L4FA 3VP9A 5AW5B 2OG0A 1MFTA 4KT0J 4H13B 1T2KC 1LWUC 3H25A 2E74C 1BGYE 3WU2H 3PTZA 2GUSA 1OMIA 2G3AA 1IC2A 3B71A 3CXHD 3PRJA 3GHGC 2M5AB 3Q3DA 1N73A 1QVFO 1ZOYC 1LGHB 2B87A 1SS1A 4B86A 1PP9D 3L73G 3IR9A 3LIDA 4IOIH 2YO2A 2KOGA 1FZEA 4U3FJ 2KVVA 4QMAA 1WRGA 3AE8C 1EXJA 3IFMA 3MD0A 3H1JD 1JM0A 1M1JB 3M91A 2QJKC 4N6JA 1CI6A 2QSIA 3A5TA 2IYOA 3G71P 2KZIA 1IFJA 3EZ7A 2JJLA 1IJDB 1LTJA 4R4MA 1AJYA 4W7YA 1S9KE 1N8RQ 1RF0A 2P58A 3L72J 4EYYQ 2CK3H 4U3FE 2RH0A 3CCQP 5BVZA 3B8EB 1BGYG 2H43A 3USSA 2KXPB 2KB7P 2OYHB 1YITP 2KS1A 1K8AQ 1H0TB 5KAWA 1JY2O 5AW4B 3RBZA 2Y9ZA 1M90Q 2O01J 2E42A 2VZ4A 2WZ7A 4U7JA 1Q81Q 1HJBA 4W7ZA 3G6EP 1L4AB 4N78D 5KJ7D 1YJWP 3EZFA 2WPVB 3L72E 1X9VA 2IZ0A 2PP6A 2WPRA 4RJTA 2LR2A 3VMXA 2P1JA 1J1EB 5KCBA 1N7LA 3Q1MA 1N73C 1YQ3C 3B49A 2D2CB 1QGKB 1Q2NA 3I55P 1FOSE 2QE7H 2W83C 3CWBD 5D90A 3CD6P 3RK3C 1SQBD 2G8YA 3BRVB 1IFNA 1SQXJ 2FYNB 2FYUJ 3L74D 2HLOA 2FKWB 3S1KA 2KSJA 2LKMA 1U7MA 3FX0A 1LT9A 2ZFCA 1LTJC 1Q09A 1OW7A 4PV1B 3A7OA 1Q05A 3SFDC 3HE4A 3H32B 1RF0C 1HBWA 2W6JH 1JO5A 2SPZA 2O01H 3BATA 3S9OA 1GZLA 3N7NA 1SQPD 4WY4A 1KMIZ 1VF5C 3CCRP 2WPSA 3OJAB 5AW3B 2QIWA 1FBMA 1SQXE 1L0ND 2B89A 2FYUE 5AW8B 3IAOA 3PLNA 3F5HA 3SWYA 5AW0B 1LWUB 4U3FD 4BRYA 4JYBA 4H44C 2V7QH 3HE5B 2KIKA 2Y9YA 2JMLA 4OVNF 2O3JA 1YQ4C 3D71A 4Z1MH 2KZJA 1IFDA 3VOPA 1M1KQ 1YHQP 1HWTC 3NXSA 5KLVD 2JP3A 1USEA 2WWWA 4ZKPA 1RF1C 1CZQA 1A02F 5DJTB 4UB6E 2ZYAA 3MP7B 2ZYGA 3L72D 3RK2C 2Z4EA 1LTAC 2B88A 5KLIC 3GW6A 3EFFK 1JEKA 1OFCX 2V4HA 1PGJA 2WT7A 3CI9A 1JY2P 1QL2A 3H6PA 1LTBC 2I1KA 3C8VA 4I1LA 2OYIA 1FZCA 2R44A 2YO3A 3EZ2A 1LT9C 1SQQJ 2XDJA 1PM6A 3FWNA 5KAIE 1X0TA 1NHLA 5CCGA 2WMMA 2VRSA 4H13C 4UB6H 3L75J 2H7HA 1KILA 1RQUA 2GA1A 1IK9A 2ITAA 2ZT9B 2K3RA 2QJPB 4OWFA 2HPCA 1EDIA 2WITA 1KILE 2J58A 1BE3D 2Q3EA 3LIEA 5AW7B 1FDOA 3EQ2A 1HF9A 4GOFA 2WQYC 4L74A 2XV5A 1M7LA 3A0BE 1U57A 1J2JB 2C9LY 2H89C 5CBNA 1FE6A 5KAIH 2ZVOB 3L75E 3EZ6A 4H13D 5KTBA 2BCCG 1P84I 1N73B 2FYZA 3AEGC 4WY4D 1M1JC 3H1LG 1FS0E 2J5UA 1KB9I 1OX3A 1R5LA 3L35A 1PV3A 2JWDA 1JY3O 2K9YA 1RY3A 2RMZA 3WMM0 2JR8A 3AE3C 2ZVNB 5E79E 3AE2C 4DZOA 4R4EA 4I7ZB 2CPBA 1CI6B 3A0BH 2GOVA 3FXEA 1VPCA 2K9JA 2Q9IA 3G3ZA 4JYCA 2L91A 1KQFB 1JY3N 2NPSB 5CCHA 2P10A 2PAJA 2QA4P 2H8PD 5CCGC 1L4AC 1H8AA 2ZXEB 1R8DA 1NKNA 1GU5A 2XNXA 5KAVA 1KB9E 3L73J 3L75G 1DIPA 1NTMJ 2R5BA 3CMAP 5E79H 1OVRA 1DD3A 3OA7A 3BCCG 3FWLA 4C7RA 1GTWA 3TDKA 2D2CC 1BCCJ 4DJGA 3UIAA 3CLQA 3ABVC 1URQA 3R8JA 4LHFA 3EWKA 2I8DA 5CCGD 1P84H 1EXIA 2KK7A 1YJ9P 3V4WA 3TNUA 5AVRB 3W67A 1IO4A 4UB8E 2DW3A 1KYOD 1BSNA 4EOTA 1NTME 1PPJD 1X22A 1SQQD 1KB9H 1FOSF 3BVHA 1USDA 1ZMEC 3KZIE 2IYPA 1Q07A 4PV1C 1BCCE 1EDLA 3WUTA 1MFZA 3F89A 1L0LD 3QWOC 4AUWA 4GOEA 1JB0J 3V6IA 4TLFA 2XKMA 2AXCA 3NMDA 3IF4A 1NGMB 1NTKG 1EZVG 1T3JA 4HKZH 1S2EA 2KSEA 3H1HD 3KDPB 1LT9B 2PFXA 1ZLLA 2HG5D 1JCCA 3HE4B 3CCEP 1KFMA 4UB8H 1L2PA 5B66E 3TF5A 5AVWB 2WSSH 1JUNA 1OWAA 2KCUA 1NOHA 4WY4B 1LNQA 1SQVD 3B4SA 2H88C 4PV1D 3KZIH 3WUUA 1WMKA 2YIUB 2JO1A 2P67A 1ZR2A 1EC5A 5KATA 1NTKK 2W90A 1YTZI 3L71G 1YYCA 1P84D 4BRYB 1KC8Q 1NTMG 2IDBA 3VYIA 4R4LA 3AEAC 3TYYA 4D6TE 1FZBA 3O8ZA 1NO4A 5CCHD 3A3YB 3AE6C 3U59A 1BCCG 5B66H 2A06E 4WBAA 2B9BA 4CPGA 3L70D 4BXLA 1XTCC 1MZ9A 5KJ7C 5C39A 1YIJP 2NPSA 2UWJE 4XA4A 3ZDMA 1K05A 2ZHGA 1QLED 1NTMK 2WT7B 2R3SA 5AW9B 4DCZA 3SWKA 5AVSB 3L73D 4Y28J 2ZT9C 2OYIB 1FZCB 2QJPC 3R8KA 5K5GB 1S5LX 1JOCA 4L75A 2WSEJ 1T3UA 1NTZJ 1OVUA 3SWFA 3K5BA 2KI7B 3M9QA 1W2EA 3MGNA 3KHUA 1KILB 4D6TG 4HB1A 4K3AA 5CMZA 1MKMA 1VQMP 1ZRTD 3NTNA 1IFPA 2K37A 1KD1Q 2HPCB 4J2NA 4XE5B 2A06G 5L8RJ 1AQTA 5GTIE 3TK1A 1DEEG 3E1IA 1FAVA 2V7QJ 3AE7C 1FDIA 2ZT9D 3OW2O 2ZAEB 5AVZB 3CC2P 3CCJP 1BGYD 1NTZE 4MN4C 2QEXP 4RO0A 4W80A 2OTLP 3TGUJ 1NU1E 1W5CE 2E75D 4EI2A 3HTKA 1AV1A 1VQ4P 1SQBK 2KNCA 2OQQA 4I7ZC 4C7NA 1UIIA 1KZUB 4WWIA 3AE1C 1BSHA 1ZV8A 3KYQA 1VQ7P 2C9NY 5CBOA 2Q3IA 4KJMA 5GTIH 2E43A 5KAXA 3QH9A 2NPSC 3JCUE 1UIXA 2IEFA 1VQPP 1PGQA 2WSEH 3MTUE 4IFDK 1NKZB 1MUUA 4ASVA 3TGUE 3KPEA 1NVOA 1DEBA 3M9BA 3ITKA 3EFGA 1SQPK 2K9JB 3G9RA 5APVA 5KLVG 2YXQB 1U7JA 2P7JA 3V2NA 1S9KD 3RBXA 2FFDA 2C0WA 3L36A 1NTZG 3PHLA 2BCCJ 4RKUJ 4NPFX 2NPSD 1OIPA 4WLWA 1E79H 3P8CE 1NU1G 2QVAA 3H1LJ 3JCUH 1LT1A 4JF7A 1D5YA 4HJGH 3H1IJ 1S4XA 1FU1A 1K73Q 1HJ0A 1FC2C 2R3CA 1Q86Q 3QAOA 1VQOP 5KAFE 5KLVK 4ZKUA 3GPVA 3AEEC 1AA0A 1URQB 3GK6A 3EZ9A 1SFCA 3HH0A 1SP4A 3VMZA 1JTHA 1RH5B 2P2UA 1S3JA 2BCCE 3TNUB 1NTZK 4GKGA 3TGUG 5M1BA 3E0HA 1QEXA 3H1LE 1NU1K 3H1IE 3D70A 1AVYA 2KLUA 2WTYA 5APSA 1ZW0A 4I6MC 2Y0EA 3H1KE 1VQ5P 2WSFJ 4PD4I 1T8ZA 3AE4C 5KAFH 3CX5I 1KTMA 5AW1B 1JYHA 2JKVA 1JCDA 2QJYB 3C9IA 4WY4C 3BCCJ 1QVGO 2A45I 3MUDA 2YIUC 4WVZA 2YMYA 1Q06A 3AEDC 3E7KA 3P7KA 2Q6QA 1VQ9P 2E75B 1X8YA 3CCSP 1OVVA 3HUSA 3S4RA 4L73A 1SLQA 5AVVB 4Y99B 5TJHA 1J1DB 4DT0A 2M3EA 5APTA 1SQXD 3WUVA 3CC4P 3BCCE 2FYUD 3PJSK 3D6YA 1LJ2A 4RESB 1GMJA 4PD4E 3HD7A 2HYNA 1EZVI 3CX5E 2W6AA 1NH4A 3H1IG 1DH3A 5I44A 4LLHA 1Q08A 1Q90D 4OGQD 1RQVA 2WVRA 1NTKJ 1GU4A 3H1KG 3LW5J 1PP9J 2E5YA 3MIWA 1BDDA 3AECC 2WSFH 1AQ5A 2OYIC 4YPCA 1FZCC 3FGAD 2POHA 2BEZF 5AVUB 1FJKA 1EDKA 1HH0A 4R24B 4PD4H 3VTPC 2BCCD 3CX5H 2IBZG 1RHZB 2E76D 4K35A 1KILC 3HRNA 3H1LD 1NTKE 4IL6E 1KFNA 1SFCD 1EZVE 4GIFA 2A45H 3GLMA 2Y0CA 4GT1A 2W8ZA 3V2RA 1PP9E 3L71J 3MUDC 4YXWH 1KQLA 2YNYA 1S5LE 4JBZA 1M57D 1LP1B 4EIJA 4H0LC 4AYZA 1N7SB 1FDMA 3GHGA 2IPPA 3HUSC 4NPEA 1GDTA 3P32A 2A45G 2FXMA 4ZNCA 1KILD 1YBKA 5GQQA 4HH2A 3L71E 4IL6H 5B5EE 3AE9C 3LW5H 1S5LH 5APUA 2Q7CA 4M3LA 5TISE 1GL2A 4H0LD 2QRXA 3L75D 1SQVG 3MHVA 2YKPA 3HTKB 2QG4A 1L0LK 2KNCB 2IX7C 4C7NB 2I1JA 2AEFA 1MV8A 2KUBA 1PP9G 2HVAA 3V2PA 2FY8A 4N78E 2N1TA 1IK7A 4WB4A 1SQBJ 5CCHC 3HD7D 4D6TJ 1JMBA 3Q5RA 3JSVC 3V4QA 1KV4A 1VQLP 1VQNP 1Y8AA 2QM7A 3L74J 3H1JG 5TISH 1SQVK 5AVXB 2OTKE 2AEMA 3L70G 3AEFC 2FFDB 2XNDH 4R22B 1JY3P 3CWBE 4OGQB 1M8OB 1PL5A 1TU3F 5CJ0A 3V2QA 1SQPJ 3P8MC 1K04A 3R4YA 4AYCA 1SQBE 1NTKD 1EZVD 2YXRB 1URQC 2M8RA 4TT3H 1KB9D 1FZAA 2BEQD 1Q0AA 4GODA 1L0NJ 3L74E 2DG6A 1EQ7A 4WLSA 1IFIA 5APYA 1T2KD 4OH8B 1Q7YQ 2E76B 2E74D 2Q5UA 2LXCB 1SFCB 1KN7A 2FXPA 3CCUP 3T97A 1SQPE 1GL2C 1JTHB 1JNMA 3RK3E 3M06A 1D7MA 5KLVJ 3Q5SA 4EDFA 1GD2E 4IL6X 1URQD 3B5NA 1FZGA 3CC7P 3L71D 4GDOA 1Y9BA 1NTMD 2QJYC 1L0NE 1AFOA 3LURA 2PGDA 4IFMA 3GP4A 3O6QB 4O9BA 4I2LC 2FBWC 1BCCD 1G2CA 1OXZA 2N1TC 3CWBG 1LP1A 2ZXXA 4C46A 2OARA 2Z5HA 2YKQA 2J59M 1NU1J 1N7SA 1HGVA 1R5SA 2E75C 1SQBG 2ZYDA 5AW6B 4PJ0E 1GL2D 2HODA 1NJIQ 4Y99C 2O01N 1J1DC 3C1LA 1Z56A 5KLVE 1HGZA 3CPWO 3G4SP 1NAFA 1PGOA 3L74G 1QX8A 4H0LB 5AVQB 3W68A 1GW3A 2ZJSE 3RL0C 1IFMA 3HUSB 1N2DC 1S72P 2N9BA 1JY2N 2N1TD 2ZHHA 2OYOA 2CPSA 2WSCJ 3CCLP 1PIXA 1SQPG 1NWQA 1RF1A 2IFMA 2BASA 1BE3J 1OW6A 1CW5A 3A0HE 3GF3A 5EFWB 3GG2A 4A7PA 1N86A 3HD7B 4PJ0H 1L0NG 2JEEA 4A1MA 1SVFA 3VMAA 3CCMP 4LC1A 2KLVA 1ZP0C 4D6TD 4U3FG 3U1CA 3RL0D 4JPZB 2A06D 2MJZA 3A2AA 3II6A 1RH6A 1HUCA 1PZQA 1VL2A 1RE4A 3B5NC 3GF7A 1VDFA 1BE3E 1ZN5A 3RL0g 2OGUA 2RKLA 1RE3A 3JC22 1BOWA 3A0HH 3IN6A 2NZ2A 4XFJA 2FXOA 4YXDC 3L72G 1L0NK 3RK3D 2AEJA 1LTIC 2MKVA 4KHXA 4LGDE 5KAUA 1N7SC 1S1CX 3V5BA 5AVTB 2M5AA 3M9HA 2WPQA 3KQGA 2IZ1A 3UCSA 5I41B 2E74B 2RN0A 3M0DA 1ZR4A 5KKZC 5E01A 3B5ND 2WSCH 3CL3D 3RGUA 2K1AA 4ZMDA 4AYZB 4N3YB 3GHGB 4IFFA 3H1KJ 5AW2B 3GMAA 1XTGB 1M56D 1FZFA 1OZHA 3NFQA 3VMYA 1VF5D 1M1JA 3I56P 5H2FE 1GW4A 2YMKA 2Q1KA 3MZWB 1N7SD 2M3BA 2IBZI 1FJPA 5CJ4A 2LXBA 1BE3G 3N4XA 3CCVP 5APWA 2HR3A 1NTZD 4H44D 3O6QA 1BDCA 3E1RA 1ZXGA 1KYOI 3BASA 2E5TA 1GL2B 1NU1D 2GUVA 2QJKB 2W6BA 2PRRA 1H88A 3Q2YA 2OYHA 1Q82Q 2XU6A 3D6ZA 1H0TA 3FXDA 2KP8A 1KORA 1RE4C 3AEBC 1SQXG 1T6AA 1HVVA 3SFEC 2FYUG 1G1IA 1HTLC 4NPDA 4BWNA 5BU5A 5H2FH 1RE3C 1VQ8P 1L4AA 2N1TB 3R2PA 2FFDC 2KYVA 1L0LJ 3RK2D 4OGQC 2Z5IA 2IBZE 2GM4A 3TGUD 1EDJA 1W2BO 5CHXA 4AQRD 4B0YA 1VQKP 3H1HJ 5AVYB 3CMEP 1KYOE 1PPJE 3M0DC 1SQQE 3Q5PA 3CXHI 1YJNP 1KQSO 2C0XA 3RL0B 1SQXK 3AE5C 2FYUK 1PGPA 3M0AA 1SQVJ 2JDIH 1KQGB 1L0LE 2E76C 3P8CD 2B87B 1SFCC 3L37A 1JBGA 4DOJA 1QL1A 5BU8B 1R8EA 4HYTB 3TSIA 3H1HE
chains in the Genus database with same CATH topology
1Y9BA 2QJYC 2H89C 1IK7A 2E76D 3AE8C 2D2CC 1RH6A 1EXJA 3LURA 2YIUC 1Y6UA 1MKMA 2JP3A 3GP4A 3ABVC 1Q06A 3EZ6A 2FYNC 3AEDC 4H13D 5KATA 1VL2A 5D90A 1LX8A 2FBWC 3GF7A 3GLMA 4J2NA 3Q5RA 5L8RJ 3B49A 3AEGC 3R8JA 2QJKC 3Q2YA 2IDBA 4RKUJ 4LHFA 2QSIA 1NYHA 3AEAC 3EWKA 4R4LA 3D6ZA 2V7QJ 4WLWA 3RL0g 2E75B 3T97B 3AE7C 1KORA 3EZ7A 1FDIA 2ZT9D 1EXIA 2G8YA 2D2CD 3AEBC 5KLIC 1BOWA 2E75C 4R4MA 2J5UA 3SFEC 1AJYA 3AE6C 3IN6A 1D5YA 2NZ2A 4H0LC 4XFJA 1PV3A 4AYZA 4YXDC 1HJ0A 3AEFC 4R22B 2K9YA 2MKVA 3QAOA 4OGQB 1Q09A 1OW7A 1PL5A 1S1CX 1ZRTE 3C8VA 1TU3F 5KAUA 4PV1B 1Q05A 3AE3C 3SFDC 1ZMEC 4OGQC 3GPVA 3D6YA 2E75D 2OG0A 3AEEC 3AE2C 1GMJA 1Q07A 1K04A 3R4YA 4PV1C 3GK6A 3EZ2A 4R4EA 4I7ZB 4H0LB 3EZ9A 4KT0J 3HH0A 1JB0J 1PM6A 3UCSA 5I41B 2E74B 2OQQA 3S9OA 1VF5B 4I7ZC 4TT3H 2GOVA 5KKZC 5D8CA 5GQQA 5KAWA 5I44A 5E01A 2BEQD 1Q0AA 4B0YA 4H13B 1Q08A 3AE1C 3H25A 2E74C 2O01J 1KMIZ 1VF5C 1K05A 1Q90D 2ZHHA 2ZHGA 4OGQD 1RQVA 3AE9C 4H13C 5M1BA 1NGMB 3E0HA 2VZ4A 2DG6A 1KQFB 4AYZB 4U7JA 2WSCJ 1RQUA 1OMIA 2G3AA 2P10A 1PIXA 3Q5PA 3B71A 5KAXA 4WLSA 4DCZA 2QIWA 2ZT9B 3LW5J 3GMAA 2BOWA 4Y28J 3EZFA 3D70A 3IAOA 1OW6A 3AE5C 4H0LD 2WPVB 4H44B 1UIXA 3Q3DA 2ZT9C 3GF3A 2IEFA 3AECC 2E76B 1R8DA 2E74D 2QJPC 3R8KA 1ZOYC 1VF5D 4H44C 1KQGB 1S5LX 2YMKA 1KILE 5KAVA 2E76C 3FGAD 2FXPA 2WSEJ 2WSFJ 5KCBA 4A1MA 1DD4A 2KCUA 1DIPA 3AE4C 1FDOA 1ZP0C 1JBGA 2BEZF 4GDOA 3Q1MA 3G9RA 1OW8A 1YQ3C 2H88C 4PV1D 3RK3E 1HF9A 1KTMA 2JMLA 1R8EA 1JYHA 1YQ4C 1DD3A 3D71A 3Q5SA 2KVVA 4R24B 2WQYC 4YTPC 4Z1MH 2HVAA 4IL6X 2D2CB 1WMKA 2JO1A 4H44D 3O6QA 1U57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3D A;  1D5Y A;  3UCS A;  5I41 B;  1R8D A;  2OQQ A;  3R8K A;  5KAW A;  2GOV A;  5GQQ A;  1EXJ A;  5D8C A;  3LUR A;  5I44 A;  5E01 A;  4B0Y A;  1Q0A A;  4AYZ A;  1Q08 A;  3GP4 A;  4R22 B;  5KAV A;  1Q06 A;  5KAT A;  5D90 A;  5KCB A;  4A1M A;  2ZHH A;  3QAO A;  4J2N A;  2ZHG A;  3Q5R A;  2KCU A;  1Q09 A;  5KAU A;  1DIP A;  3E0H A;  2VZ4 A;  2DG6 A;  3R8J A;  4AYZ B;  3Q2Y A;  1Q05 A;  1JBG A;  4R4L A;  3Q1M A;  3G9R A;  3B49 A;  3Q5P A;  1JYH A;  3D6Z A;  4WLS A;  2JML A;  4WLW A;  3GPV A;  1R8E A;  5KAX A;  3T97 B;  3D6Y A;  3D71 A;  3Q5S A;  1Q07 A;  4R24 B;  2BOW A;  2HVA A;  3GK6 A;  4R4E A;  1EXI A;  3D70 A;  3IAO A;  1BOW A;  3HH0 A;  4R4M A;  2J5U A; 
#chains in the Genus database with same CATH topology
 3VP8 A;  2R5D A;  2JWA A;  2IFN A;  1DX7 A;  3OAK A;  3RK3 B;  1LX8 A;  1E5W A;  3H32 A;  2W27 A;  1KYO H;  4JQ0 D;  3T97 B;  4ASW A;  1VQ6 P;  1GK6 A;  1SQV E;  3H1J J;  3CXH E;  2OYH C;  1NAY A;  3B5N B;  1LTJ B;  2NRG A;  3U1A A;  3L70 J;  1A02 J;  2M0B A;  1AVO A;  2O1J A;  3H1I D;  2XZR A;  3I5C A;  1LWU A;  1P84 E;  1PPJ G;  1SQQ G;  1G2C B;  3SSU A;  1JMM A;  2YKO A;  3HE5 A;  3H1K D;  1VF5 B;  3KXD A;  5D8C A;  1LTS C;  2KS1 B;  2R32 A;  1L0L G;  1J1E C;  2AXT E;  1GK4 A;  2OTJ P;  3H1J E;  2HOD B;  1PFI A;  1WT6 A;  2QM8 A;  2BOW A;  4H44 B;  5KKZ B;  3L70 E;  3CXH H;  3H1H G;  2Y0D A;  5DJU B;  1IZN B;  1YTZ T;  1G1J A;  5GTH E;  3HD7 C;  1DD4 A;  4DCK A;  2IBZ D;  3BRT B;  2O1K A;  1OW8 A;  2N9Y B;  2L5G B;  1L4A D;  4YTP C;  1SQQ K;  3L73 E;  3PH0 A;  1X79 B;  1RF1 B;  1Y6U A;  2HFE D;  2FYN C;  3BCC D;  3WU2 E;  5KJ7 A;  1H89 A;  2AXT H;  4PD4 D;  3RK2 B;  1LTG C;  1NYH A;  4L76 A;  1BGY J;  3CX5 D;  5KLI B;  1CSB A;  3CWB J;  1YI2 P;  2D2C D;  5APQ A;  3PP5 A;  5APX A;  1Y47 A;  3VN0 A;  1LTT C;  5GTH H;  2K88 A;  5B5E H;  1ZRT E;  1K9M Q;  3L4F A;  3VP9 A;  5AW5 B;  2OG0 A;  1MFT A;  4KT0 J;  4H13 B;  1T2K C;  1LWU C;  3H25 A;  2E74 C;  1BGY E;  3WU2 H;  3PTZ A;  2GUS A;  1OMI A;  2G3A A;  1IC2 A;  3B71 A;  3CXH D;  3PRJ A;  3GHG C;  2M5A B;  3Q3D A;  1N73 A;  1QVF O;  1ZOY C;  1LGH B;  2B87 A;  1SS1 A;  4B86 A;  1PP9 D;  3L73 G;  3IR9 A;  3LID A;  4IOI H;  2YO2 A;  2KOG A;  1FZE A;  4U3F J;  2KVV A;  4QMA A;  1WRG A;  3AE8 C;  1EXJ A;  3IFM A;  3MD0 A;  3H1J D;  1JM0 A;  1M1J B;  3M91 A;  2QJK C;  4N6J A;  1CI6 A;  2QSI A;  3A5T A;  2IYO A;  3G71 P;  2KZI A;  1IFJ A;  3EZ7 A;  2JJL A;  1IJD B;  1LTJ A;  4R4M A;  1AJY A;  4W7Y A;  1S9K E;  1N8R Q;  1RF0 A;  2P58 A;  3L72 J;  4EYY Q;  2CK3 H;  4U3F E;  2RH0 A;  3CCQ P;  5BVZ A;  3B8E B;  1BGY G;  2H43 A;  3USS A;  2KXP B;  2KB7 P;  2OYH B;  1YIT P;  2KS1 A;  1K8A Q;  1H0T B;  5KAW A;  1JY2 O;  5AW4 B;  3RBZ A;  2Y9Z A;  1M90 Q;  2O01 J;  2E42 A;  2VZ4 A;  2WZ7 A;  4U7J A;  1Q81 Q;  1HJB A;  4W7Z A;  3G6E P;  1L4A B;  4N78 D;  5KJ7 D;  1YJW P;  3EZF A;  2WPV B;  3L72 E;  1X9V A;  2IZ0 A;  2PP6 A;  2WPR A;  4RJT A;  2LR2 A;  3VMX A;  2P1J A;  1J1E B;  5KCB A;  1N7L A;  3Q1M A;  1N73 C;  1YQ3 C;  3B49 A;  2D2C B;  1QGK B;  1Q2N A;  3I55 P;  1FOS E;  2QE7 H;  2W83 C;  3CWB D;  5D90 A;  3CD6 P;  3RK3 C;  1SQB D;  2G8Y A;  3BRV B;  1IFN A;  1SQX J;  2FYN B;  2FYU J;  3L74 D;  2HLO A;  2FKW B;  3S1K A;  2KSJ A;  2LKM A;  1U7M A;  3FX0 A;  1LT9 A;  2ZFC A;  1LTJ C;  1Q09 A;  1OW7 A;  4PV1 B;  3A7O A;  1Q05 A;  3SFD C;  3HE4 A;  3H32 B;  1RF0 C;  1HBW A;  2W6J H;  1JO5 A;  2SPZ A;  2O01 H;  3BAT A;  3S9O A;  1GZL A;  3N7N A;  1SQP D;  4WY4 A;  1KMI Z;  1VF5 C;  3CCR P;  2WPS A;  3OJA B;  5AW3 B;  2QIW A;  1FBM A;  1SQX E;  1L0N D;  2B89 A;  2FYU E;  5AW8 B;  3IAO A;  3PLN A;  3F5H A;  3SWY A;  5AW0 B;  1LWU B;  4U3F D;  4BRY A;  4JYB A;  4H44 C;  2V7Q H;  3HE5 B;  2KIK A;  2Y9Y A;  2JML A;  4OVN F;  2O3J A;  1YQ4 C;  3D71 A;  4Z1M H;  2KZJ A;  1IFD A;  3VOP A;  1M1K Q;  1YHQ P;  1HWT C;  3NXS A;  5KLV D;  2JP3 A;  1USE A;  2WWW A;  4ZKP A;  1RF1 C;  1CZQ A;  1A02 F;  5DJT B;  4UB6 E;  2ZYA A;  3MP7 B;  2ZYG A;  3L72 D;  3RK2 C;  2Z4E A;  1LTA C;  2B88 A;  5KLI C;  3GW6 A;  3EFF K;  1JEK A;  1OFC X;  2V4H A;  1PGJ A;  2WT7 A;  3CI9 A;  1JY2 P;  1QL2 A;  3H6P A;  1LTB C;  2I1K A;  3C8V A;  4I1L A;  2OYI A;  1FZC A;  2R44 A;  2YO3 A;  3EZ2 A;  1LT9 C;  1SQQ J;  2XDJ A;  1PM6 A;  3FWN A;  5KAI E;  1X0T A;  1NHL A;  5CCG A;  2WMM A;  2VRS A;  4H13 C;  4UB6 H;  3L75 J;  2H7H A;  1KIL A;  1RQU A;  2GA1 A;  1IK9 A;  2ITA A;  2ZT9 B;  2K3R A;  2QJP B;  4OWF A;  2HPC A;  1EDI A;  2WIT A;  1KIL E;  2J58 A;  1BE3 D;  2Q3E A;  3LIE A;  5AW7 B;  1FDO A;  3EQ2 A;  1HF9 A;  4GOF A;  2WQY C;  4L74 A;  2XV5 A;  1M7L A;  3A0B E;  1U57 A;  1J2J B;  2C9L Y;  2H89 C;  5CBN A;  1FE6 A;  5KAI H;  2ZVO B;  3L75 E;  3EZ6 A;  4H13 D;  5KTB A;  2BCC G;  1P84 I;  1N73 B;  2FYZ A;  3AEG C;  4WY4 D;  1M1J C;  3H1L G;  1FS0 E;  2J5U A;  1KB9 I;  1OX3 A;  1R5L A;  3L35 A;  1PV3 A;  2JWD A;  1JY3 O;  2K9Y A;  1RY3 A;  2RMZ A;  3WMM 0;  2JR8 A;  3AE3 C;  2ZVN B;  5E79 E;  3AE2 C;  4DZO A;  4R4E A;  4I7Z B;  2CPB A;  1CI6 B;  3A0B H;  2GOV A;  3FXE A;  1VPC A;  2K9J A;  2Q9I A;  3G3Z A;  4JYC A;  2L91 A;  1KQF B;  1JY3 N;  2NPS B;  5CCH A;  2P10 A;  2PAJ A;  2QA4 P;  2H8P D;  5CCG C;  1L4A C;  1H8A A;  2ZXE B;  1R8D A;  1NKN A;  1GU5 A;  2XNX A;  5KAV A;  1KB9 E;  3L73 J;  3L75 G;  1DIP A;  1NTM J;  2R5B A;  3CMA P;  5E79 H;  1OVR A;  1DD3 A;  3OA7 A;  3BCC G;  3FWL A;  4C7R A;  1GTW A;  3TDK A;  2D2C C;  1BCC J;  4DJG A;  3UIA A;  3CLQ A;  3ABV C;  1URQ A;  3R8J A;  4LHF A;  3EWK A;  2I8D A;  5CCG D;  1P84 H;  1EXI A;  2KK7 A;  1YJ9 P;  3V4W A;  3TNU A;  5AVR B;  3W67 A;  1IO4 A;  4UB8 E;  2DW3 A;  1KYO D;  1BSN A;  4EOT A;  1NTM E;  1PPJ D;  1X22 A;  1SQQ D;  1KB9 H;  1FOS F;  3BVH A;  1USD A;  1ZME C;  3KZI E;  2IYP A;  1Q07 A;  4PV1 C;  1BCC E;  1EDL A;  3WUT A;  1MFZ A;  3F89 A;  1L0L D;  3QWO C;  4AUW A;  4GOE A;  1JB0 J;  3V6I A;  4TLF A;  2XKM A;  2AXC A;  3NMD A;  3IF4 A;  1NGM B;  1NTK G;  1EZV G;  1T3J A;  4HKZ H;  1S2E A;  2KSE A;  3H1H D;  3KDP B;  1LT9 B;  2PFX A;  1ZLL A;  2HG5 D;  1JCC A;  3HE4 B;  3CCE P;  1KFM A;  4UB8 H;  1L2P A;  5B66 E;  3TF5 A;  5AVW B;  2WSS H;  1JUN A;  1OWA A;  2KCU A;  1NOH A;  4WY4 B;  1LNQ A;  1SQV D;  3B4S A;  2H88 C;  4PV1 D;  3KZI H;  3WUU A;  1WMK A;  2YIU B;  2JO1 A;  2P67 A;  1ZR2 A;  1EC5 A;  5KAT A;  1NTK K;  2W90 A;  1YTZ I;  3L71 G;  1YYC A;  1P84 D;  4BRY B;  1KC8 Q;  1NTM G;  2IDB A;  3VYI A;  4R4L A;  3AEA C;  3TYY A;  4D6T E;  1FZB A;  3O8Z A;  1NO4 A;  5CCH D;  3A3Y B;  3AE6 C;  3U59 A;  1BCC G;  5B66 H;  2A06 E;  4WBA A;  2B9B A;  4CPG A;  3L70 D;  4BXL A;  1XTC C;  1MZ9 A;  5KJ7 C;  5C39 A;  1YIJ P;  2NPS A;  2UWJ E;  4XA4 A;  3ZDM A;  1K05 A;  2ZHG A;  1QLE D;  1NTM K;  2WT7 B;  2R3S A;  5AW9 B;  4DCZ A;  3SWK A;  5AVS B;  3L73 D;  4Y28 J;  2ZT9 C;  2OYI B;  1FZC B;  2QJP C;  3R8K A;  5K5G B;  1S5L X;  1JOC A;  4L75 A;  2WSE J;  1T3U A;  1NTZ J;  1OVU A;  3SWF A;  3K5B A;  2KI7 B;  3M9Q A;  1W2E A;  3MGN A;  3KHU A;  1KIL B;  4D6T G;  4HB1 A;  4K3A A;  5CMZ A;  1MKM A;  1VQM P;  1ZRT D;  3NTN A;  1IFP A;  2K37 A;  1KD1 Q;  2HPC B;  4J2N A;  4XE5 B;  2A06 G;  5L8R J;  1AQT A;  5GTI E;  3TK1 A;  1DEE G;  3E1I A;  1FAV A;  2V7Q J;  3AE7 C;  1FDI A;  2ZT9 D;  3OW2 O;  2ZAE B;  5AVZ B;  3CC2 P;  3CCJ P;  1BGY D;  1NTZ E;  4MN4 C;  2QEX P;  4RO0 A;  4W80 A;  2OTL P;  3TGU J;  1NU1 E;  1W5C E;  2E75 D;  4EI2 A;  3HTK A;  1AV1 A;  1VQ4 P;  1SQB K;  2KNC A;  2OQQ A;  4I7Z C;  4C7N A;  1UII A;  1KZU B;  4WWI A;  3AE1 C;  1BSH A;  1ZV8 A;  3KYQ A;  1VQ7 P;  2C9N Y;  5CBO A;  2Q3I A;  4KJM A;  5GTI H;  2E43 A;  5KAX A;  3QH9 A;  2NPS C;  3JCU E;  1UIX A;  2IEF A;  1VQP P;  1PGQ A;  2WSE H;  3MTU E;  4IFD K;  1NKZ B;  1MUU A;  4ASV A;  3TGU E;  3KPE A;  1NVO A;  1DEB A;  3M9B A;  3ITK A;  3EFG A;  1SQP K;  2K9J B;  3G9R A;  5APV A;  5KLV G;  2YXQ B;  1U7J A;  2P7J A;  3V2N A;  1S9K D;  3RBX A;  2FFD A;  2C0W A;  3L36 A;  1NTZ G;  3PHL A;  2BCC J;  4RKU J;  4NPF X;  2NPS D;  1OIP A;  4WLW A;  1E79 H;  3P8C E;  1NU1 G;  2QVA A;  3H1L J;  3JCU H;  1LT1 A;  4JF7 A;  1D5Y A;  4HJG H;  3H1I J;  1S4X A;  1FU1 A;  1K73 Q;  1HJ0 A;  1FC2 C;  2R3C A;  1Q86 Q;  3QAO A;  1VQO P;  5KAF E;  5KLV K;  4ZKU A;  3GPV A;  3AEE C;  1AA0 A;  1URQ B;  3GK6 A;  3EZ9 A;  1SFC A;  3HH0 A;  1SP4 A;  3VMZ A;  1JTH A;  1RH5 B;  2P2U A;  1S3J A;  2BCC E;  3TNU B;  1NTZ K;  4GKG A;  3TGU G;  5M1B A;  3E0H A;  1QEX A;  3H1L E;  1NU1 K;  3H1I E;  3D70 A;  1AVY A;  2KLU A;  2WTY A;  5APS A;  1ZW0 A;  4I6M C;  2Y0E A;  3H1K E;  1VQ5 P;  2WSF J;  4PD4 I;  1T8Z A;  3AE4 C;  5KAF H;  3CX5 I;  1KTM A;  5AW1 B;  1JYH A;  2JKV A;  1JCD A;  2QJY B;  3C9I A;  4WY4 C;  3BCC J;  1QVG O;  2A45 I;  3MUD A;  2YIU C;  4WVZ A;  2YMY A;  1Q06 A;  3AED C;  3E7K A;  3P7K A;  2Q6Q A;  1VQ9 P;  2E75 B;  1X8Y A;  3CCS P;  1OVV A;  3HUS A;  3S4R A;  4L73 A;  1SLQ A;  5AVV B;  4Y99 B;  5TJH A;  1J1D B;  4DT0 A;  2M3E A;  5APT A;  1SQX D;  3WUV A;  3CC4 P;  3BCC E;  2FYU D;  3PJS K;  3D6Y A;  1LJ2 A;  4RES B;  1GMJ A;  4PD4 E;  3HD7 A;  2HYN A;  1EZV I;  3CX5 E;  2W6A A;  1NH4 A;  3H1I G;  1DH3 A;  5I44 A;  4LLH A;  1Q08 A;  1Q90 D;  4OGQ D;  1RQV A;  2WVR A;  1NTK J;  1GU4 A;  3H1K G;  3LW5 J;  1PP9 J;  2E5Y A;  3MIW A;  1BDD A;  3AEC C;  2WSF H;  1AQ5 A;  2OYI C;  4YPC A;  1FZC C;  3FGA D;  2POH A;  2BEZ F;  5AVU B;  1FJK A;  1EDK A;  1HH0 A;  4R24 B;  4PD4 H;  3VTP C;  2BCC D;  3CX5 H;  2IBZ G;  1RHZ B;  2E76 D;  4K35 A;  1KIL C;  3HRN A;  3H1L D;  1NTK E;  4IL6 E;  1KFN A;  1SFC D;  1EZV E;  4GIF A;  2A45 H;  3GLM A;  2Y0C A;  4GT1 A;  2W8Z A;  3V2R A;  1PP9 E;  3L71 J;  3MUD C;  4YXW H;  1KQL A;  2YNY A;  1S5L E;  4JBZ A;  1M57 D;  1LP1 B;  4EIJ A;  4H0L C;  4AYZ A;  1N7S B;  1FDM A;  3GHG A;  2IPP A;  3HUS C;  4NPE A;  1GDT A;  3P32 A;  2A45 G;  2FXM A;  4ZNC A;  1KIL D;  1YBK A;  5GQQ A;  4HH2 A;  3L71 E;  4IL6 H;  5B5E E;  3AE9 C;  3LW5 H;  1S5L H;  5APU A;  2Q7C A;  4M3L A;  5TIS E;  1GL2 A;  4H0L D;  2QRX A;  3L75 D;  1SQV G;  3MHV A;  2YKP A;  3HTK B;  2QG4 A;  1L0L K;  2KNC B;  2IX7 C;  4C7N B;  2I1J A;  2AEF A;  1MV8 A;  2KUB A;  1PP9 G;  2HVA A;  3V2P A;  2FY8 A;  4N78 E;  2N1T A;  1IK7 A;  4WB4 A;  1SQB J;  5CCH C;  3HD7 D;  4D6T J;  1JMB A;  3Q5R A;  3JSV C;  3V4Q A;  1KV4 A;  1VQL P;  1VQN P;  1Y8A A;  2QM7 A;  3L74 J;  3H1J G;  5TIS H;  1SQV K;  5AVX B;  2OTK E;  2AEM A;  3L70 G;  3AEF C;  2FFD B;  2XND H;  4R22 B;  1JY3 P;  3CWB E;  4OGQ B;  1M8O B;  1PL5 A;  1TU3 F;  5CJ0 A;  3V2Q A;  1SQP J;  3P8M C;  1K04 A;  3R4Y A;  4AYC A;  1SQB E;  1NTK D;  1EZV D;  2YXR B;  1URQ C;  2M8R A;  4TT3 H;  1KB9 D;  1FZA A;  2BEQ D;  1Q0A A;  4GOD A;  1L0N J;  3L74 E;  2DG6 A;  1EQ7 A;  4WLS A;  1IFI A;  5APY A;  1T2K D;  4OH8 B;  1Q7Y Q;  2E76 B;  2E74 D;  2Q5U A;  2LXC B;  1SFC B;  1KN7 A;  2FXP A;  3CCU P;  3T97 A;  1SQP E;  1GL2 C;  1JTH B;  1JNM A;  3RK3 E;  3M06 A;  1D7M A;  5KLV J;  3Q5S A;  4EDF A;  1GD2 E;  4IL6 X;  1URQ D;  3B5N A;  1FZG A;  3CC7 P;  3L71 D;  4GDO A;  1Y9B A;  1NTM D;  2QJY C;  1L0N E;  1AFO A;  3LUR A;  2PGD A;  4IFM A;  3GP4 A;  3O6Q B;  4O9B A;  4I2L C;  2FBW C;  1BCC D;  1G2C A;  1OXZ A;  2N1T C;  3CWB G;  1LP1 A;  2ZXX A;  4C46 A;  2OAR A;  2Z5H A;  2YKQ A;  2J59 M;  1NU1 J;  1N7S A;  1HGV A;  1R5S A;  2E75 C;  1SQB G;  2ZYD A;  5AW6 B;  4PJ0 E;  1GL2 D;  2HOD A;  1NJI Q;  4Y99 C;  2O01 N;  1J1D C;  3C1L A;  1Z56 A;  5KLV E;  1HGZ A;  3CPW O;  3G4S P;  1NAF A;  1PGO A;  3L74 G;  1QX8 A;  4H0L B;  5AVQ B;  3W68 A;  1GW3 A;  2ZJS E;  3RL0 C;  1IFM A;  3HUS B;  1N2D C;  1S72 P;  2N9B A;  1JY2 N;  2N1T D;  2ZHH A;  2OYO A;  2CPS A;  2WSC J;  3CCL P;  1PIX A;  1SQP G;  1NWQ A;  1RF1 A;  2IFM A;  2BAS A;  1BE3 J;  1OW6 A;  1CW5 A;  3A0H E;  3GF3 A;  5EFW B;  3GG2 A;  4A7P A;  1N86 A;  3HD7 B;  4PJ0 H;  1L0N G;  2JEE A;  4A1M A;  1SVF A;  3VMA A;  3CCM P;  4LC1 A;  2KLV A;  1ZP0 C;  4D6T D;  4U3F G;  3U1C A;  3RL0 D;  4JPZ B;  2A06 D;  2MJZ A;  3A2A A;  3II6 A;  1RH6 A;  1HUC A;  1PZQ A;  1VL2 A;  1RE4 A;  3B5N C;  3GF7 A;  1VDF A;  1BE3 E;  1ZN5 A;  3RL0 g;  2OGU A;  2RKL A;  1RE3 A;  3JC2 2;  1BOW A;  3A0H H;  3IN6 A;  2NZ2 A;  4XFJ A;  2FXO A;  4YXD C;  3L72 G;  1L0N K;  3RK3 D;  2AEJ A;  1LTI C;  2MKV A;  4KHX A;  4LGD E;  5KAU A;  1N7S C;  1S1C X;  3V5B A;  5AVT B;  2M5A A;  3M9H A;  2WPQ A;  3KQG A;  2IZ1 A;  3UCS A;  5I41 B;  2E74 B;  2RN0 A;  3M0D A;  1ZR4 A;  5KKZ C;  5E01 A;  3B5N D;  2WSC H;  3CL3 D;  3RGU A;  2K1A A;  4ZMD A;  4AYZ B;  4N3Y B;  3GHG B;  4IFF A;  3H1K J;  5AW2 B;  3GMA A;  1XTG B;  1M56 D;  1FZF A;  1OZH A;  3NFQ A;  3VMY A;  1VF5 D;  1M1J A;  3I56 P;  5H2F E;  1GW4 A;  2YMK A;  2Q1K A;  3MZW B;  1N7S D;  2M3B A;  2IBZ I;  1FJP A;  5CJ4 A;  2LXB A;  1BE3 G;  3N4X A;  3CCV P;  5APW A;  2HR3 A;  1NTZ D;  4H44 D;  3O6Q A;  1BDC A;  3E1R A;  1ZXG A;  1KYO I;  3BAS A;  2E5T A;  1GL2 B;  1NU1 D;  2GUV A;  2QJK B;  2W6B A;  2PRR A;  1H88 A;  3Q2Y A;  2OYH A;  1Q82 Q;  2XU6 A;  3D6Z A;  1H0T A;  3FXD A;  2KP8 A;  1KOR A;  1RE4 C;  3AEB C;  1SQX G;  1T6A A;  1HVV A;  3SFE C;  2FYU G;  1G1I A;  1HTL C;  4NPD A;  4BWN A;  5BU5 A;  5H2F H;  1RE3 C;  1VQ8 P;  1L4A A;  2N1T B;  3R2P A;  2FFD C;  2KYV A;  1L0L J;  3RK2 D;  4OGQ C;  2Z5I A;  2IBZ E;  2GM4 A;  3TGU D;  1EDJ A;  1W2B O;  5CHX A;  4AQR D;  4B0Y A;  1VQK P;  3H1H J;  5AVY B;  3CME P;  1KYO E;  1PPJ E;  3M0D C;  1SQQ E;  3Q5P A;  3CXH I;  1YJN P;  1KQS O;  2C0X A;  3RL0 B;  1SQX K;  3AE5 C;  2FYU K;  1PGP A;  3M0A A;  1SQV J;  2JDI H;  1KQG B;  1L0L E;  2E76 C;  3P8C D;  2B87 B;  1SFC C;  3L37 A;  1JBG A;  4DOJ A;  1QL1 A;  5BU8 B;  1R8E A;  4HYT B;  3TSI A;  3H1H E; 
#chains in the Genus database with same CATH homology
 1Y9B A;  2QJY C;  2H89 C;  1IK7 A;  2E76 D;  3AE8 C;  2D2C C;  1RH6 A;  1EXJ A;  3LUR A;  2YIU C;  1Y6U A;  1MKM A;  2JP3 A;  3GP4 A;  3ABV C;  1Q06 A;  3EZ6 A;  2FYN C;  3AED C;  4H13 D;  5KAT A;  1VL2 A;  5D90 A;  1LX8 A;  2FBW C;  3GF7 A;  3GLM A;  4J2N A;  3Q5R A;  5L8R J;  3B49 A;  3AEG C;  3R8J A;  2QJK C;  3Q2Y A;  2IDB A;  4RKU J;  4LHF A;  2QSI A;  1NYH A;  3AEA C;  3EWK A;  4R4L A;  3D6Z A;  2V7Q J;  4WLW A;  3RL0 g;  2E75 B;  3T97 B;  3AE7 C;  1KOR A;  3EZ7 A;  1FDI A;  2ZT9 D;  1EXI A;  2G8Y A;  2D2C D;  3AEB C;  5KLI C;  1BOW A;  2E75 C;  4R4M A;  2J5U A;  3SFE C;  1AJY A;  3AE6 C;  3IN6 A;  1D5Y A;  2NZ2 A;  4H0L C;  4XFJ A;  1PV3 A;  4AYZ A;  4YXD C;  1HJ0 A;  3AEF C;  4R22 B;  2K9Y A;  2MKV A;  3QAO A;  4OGQ B;  1Q09 A;  1OW7 A;  1PL5 A;  1S1C X;  1ZRT E;  3C8V A;  1TU3 F;  5KAU A;  4PV1 B;  1Q05 A;  3AE3 C;  3SFD C;  1ZME C;  4OGQ C;  3GPV A;  3D6Y A;  2E75 D;  2OG0 A;  3AEE C;  3AE2 C;  1GMJ A;  1Q07 A;  1K04 A;  3R4Y A;  4PV1 C;  3GK6 A;  3EZ2 A;  4R4E A;  4I7Z B;  4H0L B;  3EZ9 A;  4KT0 J;  3HH0 A;  1JB0 J;  1PM6 A;  3UCS A;  5I41 B;  2E74 B;  2OQQ A;  3S9O A;  1VF5 B;  4I7Z C;  4TT3 H;  2GOV A;  5KKZ C;  5D8C A;  5GQQ A;  5KAW A;  5I44 A;  5E01 A;  2BEQ D;  1Q0A A;  4B0Y A;  4H13 B;  1Q08 A;  3AE1 C;  3H25 A;  2E74 C;  2O01 J;  1KMI Z;  1VF5 C;  1K05 A;  1Q90 D;  2ZHH A;  2ZHG A;  4OGQ D;  1RQV A;  3AE9 C;  4H13 C;  5M1B A;  1NGM B;  3E0H A;  2VZ4 A;  2DG6 A;  1KQF B;  4AYZ B;  4U7J A;  2WSC J;  1RQU A;  1OMI A;  2G3A A;  2P10 A;  1PIX A;  3Q5P A;  3B71 A;  5KAX A;  4WLS A;  4DCZ A;  2QIW A;  2ZT9 B;  3LW5 J;  3GMA A;  2BOW A;  4Y28 J;  3EZF A;  3D70 A;  3IAO A;  1OW6 A;  3AE5 C;  4H0L D;  2WPV B;  4H44 B;  1UIX A;  3Q3D A;  2ZT9 C;  3GF3 A;  2IEF A;  3AEC C;  2E76 B;  1R8D A;  2E74 D;  2QJP C;  3R8K A;  1ZOY C;  1VF5 D;  4H44 C;  1KQG B;  1S5L X;  2YMK A;  1KIL E;  5KAV A;  2E76 C;  3FGA D;  2FXP A;  2WSE J;  2WSF J;  5KCB A;  4A1M A;  1DD4 A;  2KCU A;  1DIP A;  3AE4 C;  1FDO A;  1ZP0 C;  1JBG A;  2BEZ F;  4GDO A;  3Q1M A;  3G9R A;  1OW8 A;  1YQ3 C;  2H88 C;  4PV1 D;  3RK3 E;  1HF9 A;  1KTM A;  2JML A;  1R8E A;  1JYH A;  1YQ4 C;  1DD3 A;  3D71 A;  3Q5S A;  2KVV A;  4R24 B;  2WQY C;  4YTP C;  4Z1M H;  2HVA A;  4IL6 X;  2D2C B;  1WMK A;  2JO1 A;  4H44 D;  3O6Q A;  1U57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...