3D71A

Crystal structure of e253q bmrr bound to 22 base pair promoter site
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIRILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
total genus 78
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d71A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d71A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d71A03
3E0HA 3Q1MA 2ZHGA 1Q07A 3HH0A 3Q3DA 4J2NA 4R22B 4WLWA 1EXJA 1Q09A 1Q08A 2VZ4A 3T97B 2DG6A 3G9RA 4R4MA 5E01A 3LURA 1D5YA 1JYHA 5GQQA 3Q5SA 3R8KA 2HVAA 2KCUA 5D90A 5KAVA 3UCSA 1Q0AA 4R24B 3D6ZA 1BOWA 3Q2YA 1JBGA 5D8CA 3B49A 5KAWA 4B0YA 4R4EA 5I41B 2GOVA 1DIPA 3GP4A 5I44A 4AYZB 2OQQA 3R8JA 3D6YA 2JMLA 5KATA 5KCBA 1Q06A 3D71A 5KAXA 3Q5RA 3D70A 1R8EA 2BOWA 1EXIA 4WLSA 3IAOA 5KAUA 4AYZA 1R8DA 4A1MA 3GPVA 2J5UA 3Q5PA 4R4LA 2ZHHA 1Q05A 3GK6A 3QAOA
chains in the Genus database with same CATH superfamily
3H25A 3ZDMA 3L72D 4M3LA 1KB9E 1SQXG 4I6MC 1FZBA 1L2PA 3OAKA 3MIWA 3KQGA 1NU1D 2ZAEB 1N7SA 2Y0DA 5AVVB 1S9KE 1H0TB 3L35A 2W83C 3D70A 1Y6UA 1NTZG 3H1JD 1FZAA 3CWBD 2Y9ZA 2FXMA 1L0NG 4RKUJ 1G2CA 3F5HA 1OVVA 3CCUP 4PD4I 3RL0B 5AVSB 3VP8A 4EIJA 1Q81Q 1FZCA 3RK3B 3H1KJ 5GQQA 3K5BA 2K9YA 3G6EP 3MTUE 5CMZA 2KS1A 3BRVB 5CCGA 3CC2P 2JJLA 2E74C 1TU3F 2P2UA 1P84H 2YIUB 2C0XA 1YITP 2D2CD 3E7KA 1OX3A 3MHVA 1FZCC 1QVFO 4W7YA 3AEDC 1RY3A 2E75C 3EWKA 3L74E 1G1IA 4D6TE 2Q9IA 2GOVA 1T3UA 2KB7P 2QE7H 4IL6E 3L75D 2HODB 2OYOA 2KNCA 3A0BE 3B5NB 1PGQA 2I1KA 1FDOA 4IOIH 2W6AA 3H1IG 2E5TA 1JY2P 1HJ0A 3G9RA 1KYOI 1LWUA 2WTYA 4JYBA 5E79H 3GHGB 4A7PA 5D8CA 1GW3A 2Q7CA 2POHA 4OGQD 2OYHB 2OTLP 2M5AB 2ZVOB 3GG2A 2GA1A 1A02J 1LT1A 1JO5A 4H13C 5AVQB 1D5YA 2B89A 4EYYQ 1HBWA 2Z4EA 1LWUC 4H0LB 1LT9B 2B88A 3KZIH 4PV1D 2E76D 1Q06A 1KILD 1WT6A 3NMDA 2IYOA 2N1TD 5CCHA 2YNYA 5AW1B 2B9BA 1L0LK 4GDOA 2W90A 4K3AA 4LHFA 3JCUH 2O01H 1SQQK 3HE4A 5AVRB 2KCUA 1LTJA 1U7JA 1QLED 2FFDB 1LJ2A 3PHLA 2OYIA 1ZXGA 3PTZA 3MP7B 2RN0A 5APVA 3M9BA 1HGVA 1YI2P 3SWKA 1LGHB 2UWJE 5KLVJ 1LTJC 4EDFA 2IFMA 1DIPA 3GLMA 1P84D 2KLUA 3USSA 3LIDA 1L4AD 1S1CX 1NU1E 1N73A 3CC4P 3AE3C 2BASA 1M57D 4MN4C 3UIAA 2WVRA 1VQOP 4HB1A 2K88A 5K5GB 1FJKA 1Q7YQ 3CWBE 5KJ7D 5KATA 4DCKA 3EZFA 1PL5A 3RGUA 1GU4A 3OA7A 1GL2D 1S5LH 1JB0J 3V2QA 4ZKPA 1KORA 2FYNB 1JY3N 3VYIA 1IFPA 3L74J 1MV8A 4D6TJ 1UIIA 1KTMA 1N73C 1YQ4C 1DEEG 2PGDA 1KV4A 1BSNA 3RK2B 3L73E 1EC5A 3HD7A 3CX5D 2R44A 1P84I 1RH5B 3M0DA 1URQB 2Z5IA 5KKZC 3H1KD 1SVFA 1CW5A 2WSCJ 2KUBA 1VF5C 1R5SA 2WITA 4C7NB 1OW7A 3O6QB 3HD7C 2C0WA 2H7HA 2ZHGA 1RE3A 2KP8A 3L75E 3M0DC 4WVZA 4H44B 1W2EA 3L4FA 4W7ZA 1RHZB 1UIXA 4N6JA 2WPVB 3M9QA 1NHLA 3CX5I 2V7QJ 4L74A 2JWAA 3B8EB 1RE3C 1IFNA 2IBZD 2PAJA 2BCCJ 2XZRA 3L72G 3TSIA 1L0LG 3EFGA 1ZN5A 2P58A 2ZXXA 2WSSH 1SQQG 3GMAA 1N7LA 4LGDE 1IC2A 1KILE 3CMAP 3V6IA 1JTHA 1KZUB 2WSCH 3I55P 3H1JG 1Q90D 2Q3EA 1NYHA 4YTPC 1HUCA 2W8ZA 1KFMA 2K3RA 1NU1J 5APYA 3WUUA 2R32A 4BXLA 1GU5A 2YXRB 1W5CE 1JCCA 2NZ2A 3LURA 3CWBJ 3PP5A 1S9KD 3PRJA 5KAWA 3H1LG 1PZQA 2HPCB 3AEBC 2AEMA 4AYZA 2FKWB 2V7QH 2ZXEB 3L70G 2IFNA 2IEFA 2K37A 1FOSE 3H1HD 1P84E 3L73J 1ZP0C 5KLVD 1KFNA 1RF0C 2J59M 5AW0B 3L71G 1DD3A 2FYUD 1GK6A 1SQVD 1SFCC 1KB9I 3NFQA 1KD1Q 3BCCG 1CI6A 1ZLLA 4OWFA 1FE6A 5CHXA 1NTMD 2QG4A 1CZQA 2D2CB 2Z5HA 1RQVA 5KAXA 4Y99B 2OYHA 2MKVA 1M1JB 2IYPA 3HTKB 5E79E 2I1JA 2RKLA 1LTBC 3R2PA 1VL2A 4ASWA 4D6TD 3CX5E 5BU5A 3RL0g 2H43A 2XV5A 5APWA 1JBGA 4JQ0D 3AEFC 4EOTA 1VQ4P 2Q3IA 3GW6A 3KZIE 4TLFA 3QAOA 1FZGA 1EZVG 1MFZA 3G4SP 5DJTB 3IR9A 4OGQB 1RF1B 1X0TA 3AE7C 2E74D 2FFDA 3JCUE 1NTKD 2YXQB 4KHXA 3I56P 2YKOA 3GPVA 2JP3A 4ZKUA 3TGUJ 2KYVA 3A3YB 4PV1B 2A06D 2E76B 1XTGB 3OW2O 2E75D 5CJ4A 2QJYC 1YTZI 1NKNA 4R24B 1KILB 2CPSA 4JF7A 2IPPA 3IF4A 4W80A 2IBZE 3H32B 2R3CA 2N1TB 5AVTB 2E5YA 1IJDB 1GZLA 1U7MA 4XA4A 1FC2C 2BCCD 1RQUA 2O01N 2A45G 2WSFH 1QL2A 3HUSC 2XU6A 3FXDA 4ZMDA 2RMZA 1Q05A 4ZNCA 3EZ7A 1GW4A 4H13D 3AEAC 2LR2A 3CCSP 1S5LE 1GD2E 1DX7A 2WPRA 1EXIA 1L4AB 2P1JA 5AW4B 2WT7B 1BCCD 3EZ9A 4R4LA 1NJIQ 4N3YB 4UB6H 1NO4A 2OTKE 2XNXA 1YJ9P 1VPCA 1AQ5A 3T97A 2HVAA 3EZ2A 1VQ8P 1Q0AA 3H1KG 2JDIH 1YYCA 3VOPA 3H1HE 1GMJA 3L36A 2QEXP 4K35A 1GL2B 4C7NA 2QM7A 3CCEP 3O6QA 1S4XA 5KLVE 2W27A 1N7SC 1SP4A 1T6AA 3CXHH 3A5TA 2FYUE 1BDDA 1SQVE 3L73D 1ZR4A 1OVRA 1M7LA 1MZ9A 1KQLA 2WSEH 3C8VA 3P8CD 5AVXB 2ZYDA 4AUWA 1A02F 1NTME 1YQ3C 1GK4A 1J1DB 1OW6A 1K8AQ 1SQPE 4DCZA 2O01J 3SFDC 1LNQA 5GTHH 2IZ0A 4JBZA 5KLIC 3FXEA 3S4RA 5CCGC 3BATA 1JY3O 2QJPB 2Y0CA 3VN0A 3MZWB 3N4XA 1USDA 1QL1A 1PPJD 1X79B 1Q86Q 3FX0A 3V2RA 3W67A 1AFOA 1PGOA 4B86A 5KAFH 2ZHHA 4OVNF 1NTKE 3B4SA 2IZ1A 4GOEA 1VF5D 3FGAD 2C9NY 3LW5H 2HPCA 2A06E 3HD7D 1PGPA 2J5UA 3VP9A 2NPSA 3TGUD 1QVGO 2OTJP 3II6A 3A0HE 2ZT9C 2FXOA 3OJAB 1BDCA 4N78D 3WUTA 1H8AA 3WMM0 1FBMA 3JC22 3VMYA 3HE5A 1NU1K 1VQNP 1JNMA 1BGYE 3R8JA 2BCCE 2BOWA 4WY4A 5BVZA 2M8RA 2ITAA 3CXHD 3Q3DA 2NPSC 5CCHC 3RBXA 3H1HJ 1SQBD 2OG0A 1K9MQ 4L73A 3H6PA 4I7ZC 1AJYA 2FYUJ 2OYIC 1M1JA 4WY4C 1SQVJ 3HTKA 4YXWH 2LXBA 1EXJA 1MUUA 2O1KA 1IFIA 1JYHA 3L74G 1BCCE 4D6TG 1JCDA 3IFMA 3U1CA 4GKGA 1PP9E 4NPDA 1NTMJ 5KAUA 1R8EA 4WBAA 3WU2E 3CCQP 1LTGC 1OVUA 4WB4A 1FU1A 4U3FD 5KTBA 5APQA 1OIPA 1SQPJ 3V5BA 1JMMA 5GTIH 1KQSO 4KJMA 1JOCA 3C1LA 4GODA 1ZMEC 1RF1A 2M0BA 1CSBA 1K73Q 2QM8A 1ZRTD 4LLHA 1SQXD 3M91A 1Q09A 2O3JA 1J1EC 3P8CE 5AVUB 1IFMA 3CD6P 3UCSA 4Z1MH 3D6YA 1NTZD 3H32A 2N1TA 1BSHA 1SFCD 1NTKJ 4UB8H 1NVOA 4IFFA 1QGKB 1G2CB 3EZ6A 2E74B 3U59A 2ZFCA 3VMAA 1PPJE 2KI7B 1JUNA 3FWNA 1FZCB 3L37A 2E75B 1AA0A 1WMKA 3TNUB 2AXCA 1N86A 1BGYJ 1R5LA 2R3SA 1MKMA 2HYNA 2BEZF 3VMXA 4XFJA 2WPSA 1L4AA 1RE4A 2XNDH 1NU1G 5H2FH 1H0TA 1YJWP 5AVWB 1DD4A 3TGUE 1PFIA 1G1JA 4UB6E 3CWBG 1VQKP 4N78E 4LC1A 1LP1B 2YMKA 1GL2A 4DJGA 3H1ID 1HJBA 1M8OB 2N9YB 4H13B 4KT0J 1RE4C 1BCCJ 1JY2O 4WLWA 2YMYA 3S9OA 1LWUB 1Q08A 2DG6A 1L0LJ 5B66H 1PP9J 2OARA 2HG5D 4BWNA 5CBNA 2IBZI 2WMMA 3CXHE 3G71P 3L73G 3AEEC 2FBWC 1SQBE 2E42A 3BVHA 2G8YA 4CPGA 5EFWB 1U57A 2L91A 3RL0C 2CK3H 2CPBA 3PJSK 3RK3C 3TYYA 2MJZA 4C46A 1FS0E 3CCJP 2HODA 3L75G 2YIUC 5GTHE 3B5NA 1AV1A 1WRGA 2BEQD 4C7RA 1VQPP 1N2DC 1AQTA 1LTJB 2KOGA 3H1LJ 2AEJA 4U3FE 3D6ZA 2ZYGA 2L5GB 1PPJG 4PD4H 3GHGA 1YJNP 3L70J 3P32A 1HVVA 2M5AA 1X8YA 1DEBA 1NAFA 1SQPD 1FDMA 3AE6C 2XKMA 2NRGA 5KAFE 3B5NC 1OWAA 3AE1C 1ZRTE 4XE5B 3CPWO 2N9BA 1SQXE 1NWQA 1LT9A 2WSFJ 4PJ0H 2G3AA 2JKVA 3GHGC 2ZYAA 4O9BA 2Y0EA 1N7SD 2K9JB 3RBZA 2OYHC 1N73B 5M1BA 1FAVA 2E43A 2HLOA 1NTZE 3E1RA 1VQ6P 1ZR2A 1L0NE 1AVYA 2P10A 1M56D 4H0LC 1LT9C 4WWIA 3GF7A 4L75A 5KKZB 1H88A 1ZW0A 3V4WA 1KYOH 1YBKA 1OMIA 1VF5B 5AW3B 2JEEA 3R8KA 4I1LA 3HD7B 5CCGD 3EQ2A 5L8RJ 1YTZT 5APUA 1LTSC 2FFDC 1R8DA 4YPCA 2FXPA 4NPFX 1USEA 1HGZA 3QWOC 1BGYD 5APSA 3AE9C 1SQBJ 4L76A 2AXTH 1PV3A 3AEGC 4QMAA 2KLVA 2WSEJ 4OH8B 3CLQA 3PLNA 3FWLA 1VDFA 3MD0A 4EI2A 1IFDA 1YIJP 5AW9B 3H1IE 2C9LY 4Y28J 5KLVK 5TJHA 3IN6A 2FYUK 4PD4D 5I41B 2OQQA 4GIFA 4RO0A 4JYCA 1SQVK 5GTIE 1NAYA 3Q5PA 1S72P 1KQFB 3HH0A 2KZIA 4R22B 2ZT9D 4U3FJ 1L0LD 1PP9D 1URQA 1RH6A 2FYNC 3MGNA 1SQQD 1NTMK 5TISH 3JSVC 1BE3J 1J2JB 1JEKA 1QEXA 1SQPK 3M06A 3RK2C 2W6JH 1DH3A 2NPSD 5KAIH 5CCHD 1JTHB 2Q1KA 2QIWA 1SQXJ 1QX8A 2KSEA 2P7JA 1URQC 2JO1A 3SSUA 2O1JA 1H89A 1T2KC 2YO3A 1VQLP 4UB8E 2HR3A 4HKZH 2B87B 5APXA 3LW5J 1FZFA 1NTZJ 4DZOA 1LX8A 4WY4D 4JPZB 1KYOD 2WZ7A 1L0NJ 4GT1A 1ZOYC 2P67A 3H1LD 2KVVA 3TNUA 1PM6A 3AE4C 4RESB 2IBZG 4H44C 4R4EA 3LIEA 1D7MA 1SFCB 2PFXA 4AYZB 1NTKK 3L70D 3KXDA 1GTWA 1HH0A 3S1KA 1HF9A 2PRRA 1EDLA 2A45H 2VZ4A 4IL6X 3L71D 3V2NA 2GM4A 5H2FE 2J58A 3AE5C 1LTTC 1LTAC 2FYZA 3BCCD 1LP1A 2QJKB 2R5DA 1CI6B 1Z56A 1KC8Q 2JR8A 1K04A 1OXZA 3CX5H 2KK7A 5B66E 1FJPA 4U7JA 3H1IJ 1E5WA 2QRXA 5C39A 3GF3A 5E01A 3H1HG 1JM0A 2RH0A 3V4QA 2HFED 3Q2YA 1EZVD 5KLVG 1IZNB 3R4YA 1EDJA 2FYUG 4NPEA 4AQRD 3MUDA 2M3EA 2QJYB 1SQVG 3TF5A 2YO2A 5AW8B 5B5EH 1NGMB 4BRYB 1LTIC 4IFMA 4DOJA 3M0AA 5AW5B 3BASA 2H88C 1NTMG 3CCRP 4PD4E 4YXDC 4DT0A 1VQ5P 3HUSB 3MUDC 1SQPG 3Q5SA 1W2BO 1KMIZ 2YKPA 3KHUA 3A7OA 3L72E 1Y9BA 1L0LE 2JWDA 3A2AA 1EZVI 3IAOA 1SQQE 3U1AA 2D2CC 2K9JA 3N7NA 4PJ0E 4Y99C 1Q07A 1AVOA 1M1JC 3EFFK 3CXHI 2ZVNB 2Q5UA 1VQ7P 2K1AA 3H1JE 1BE3D 3HRNA 5KCBA 2M3BA 3D71A 4ASVA 1KB9H 1FZEA 3RL0D 1MFTA 1NTKG 3CMEP 3KDPB 3G3ZA 3RK3D 4HH2A 2R5BA 1KYOE 1FDIA 1EQ7A 2A06G 1KILA 5I44A 1N7SB 2JMLA 3H1LE 4OGQC 1PGJA 1RF1C 1X9VA 3P8MC 2IX7C 4AYCA 2QA4P 3ABVC 1L0ND 3L70E 2A45I 3PH0A 3T97B 1VQMP 5AW6B 2WQYC 1NH4A 1BGYG 4PV1C 2BCCG 2E76C 2LXCB 1M90Q 1IK9A 2YKQA 1KILC 3L71E 1X22A 2AXTE 2KZJA 2N1TC 2KSJA 1YHQP 3B5ND 3BCCE 3KPEA 5KLIB 2KS1B 1E79H 3TDKA 2FY8A 5CBOA 2IDBA 2Y9YA 1EDIA 2ZJSE 2WT7A 4HJGH 1SQBK 1BCCG 4IL6H 4IFDK 1PP9G 1HWTC 3A0BH 1EDKA 5KJ7A 3W68A 4H0LD 1ZV8A 4TT3H 3Q5RA 2KNCB 1SLQA 5TISE 3Q1MA 1OZHA 1L4AC 3KYQA 5CJ0A 2PP6A 1EZVE 3L72J 1Y8AA 2XDJA 3BRTB 1SS1A 1Q2NA 5KAIE 1SQQJ 5APTA 2QVAA 5KJ7C 2GUVA 2B87A 2Q6QA 5AVZB 1KB9D 2ZT9B 1T8ZA 2KXPB 1GL2C 1XTCC 3E0HA 3SWFA 3H1JJ 3CCMP 1RF0A 1S2EA 3A0HH 4GOFA 3VMZA 3C9IA 1VQ9P 1SFCA 4WLSA 2NPSB 2LKMA 1SQXK 1JY3P 5DJUB 5AW2B 1JMBA 2VRSA 2AEFA 3HE4B 1IO4A 1M1KQ 4I7ZB 1J1DC 3HE5B 1BOWA 2OYIB 3CI9A 2DW3A 1T3JA 4RJTA 1NTZK 1OW8A 4WY4B 1Q82Q 1OFCX 1L0NK 4I2LC 2OGUA 1BE3E 2WWWA 1Y47A 4HYTB 2QJPC 3CCLP 5AVYB 3L71J 1IFJA 2W6BA 3GP4A 2WPQA 3L75J 3RK3E 3RK2D 3BCCJ 1KN7A 5AW7B 3L74D 2QJKC 1PIXA 2V4HA 3M9HA 3TGUG 1URQD 5BU8B 3WU2H 1T2KD 5KAVA 2I8DA 1GDTA 3CC7P 2KIKA 3H1KE 3WUVA 1FOSF 4A1MA 1J1EB 3SWYA 1N8RQ 3NXSA 1NOHA 1S3JA 1HTLC 1IK7A 4H44D 3B49A 1SQBG 3AECC 4BRYA 1K05A 3B71A 5B5EE 3TK1A 2GUSA 4R4MA 1JY2N 2H89C 3HUSA 3O8ZA 3QH9A 3CCVP 5D90A 4B0YA 3AE2C 3F89A 3AE8C 1NKZB 3GK6A 2QSIA 2H8PD 3NTNA 4J2NA 4U3FG 1KQGB 3P7KA 3VTPC 3E1IA 3ITKA 2SPZA 3V2PA 3CL3D 3I5CA 1BE3G 3SFEC 1S5LX
chains in the Genus database with same CATH topology
1YQ3C 3Q1MA 3H25A 3Q3DA 1FDOA 1S1CX 2QJKC 2QIWA 1PIXA 3AE3C 1OMIA 1HJ0A 1OW6A 3G9RA 3GF3A 5E01A 1VF5B 1RQUA 2OG0A 3EZ6A 3R8KA 4DCZA 2O01J 2E74B 2JO1A 5KAVA 3Q2YA 5D8CA 1FDIA 3SFDC 4I7ZC 5I44A 2D2CB 2JMLA 4OGQD 1RQVA 3EZFA 1PL5A 4OGQC 5KLIC 5KATA 5KAXA 5L8RJ 1AJYA 2MKVA 3LW5J 2ZT9B 1R8DA 3R4YA 4A1MA 1LX8A 3GMAA 2FXPA 3D70A 1Q05A 1JB0J 1Y6UA 3E0HA 2YIUC 1VL2A 1KORA 3ABVC 1EXJA 3EZ7A 2BEQD 4H13D 2E75B 1KILE 4H13C 1WMKA 3T97B 1KTMA 1ZOYC 3AEAC 1D5YA 1JYHA 1YQ4C 2KVVA 3AE9C 1Q90D 1PM6A 1MKMA 2WQYC 1NYHA 4H0LB 3RL0g 3AE4C 1PV3A 3AEGC 4RKUJ 3D6ZA 4YTPC 1NGMB 4PV1D 1IK7A 1JBGA 2E76D 4H44D 4PV1C 3B49A 3AEFC 4R4EA 2E76C 4H44C 3AECC 4AYZB 1K05A 1Q06A 3B71A 2H88C 2WSEJ 1R8EA 5KAUA 1EXIA 4WLSA 2BEZF 4XFJA 1HF9A 3EZ9A 2ZHHA 4R4LA 3QAOA 4YXDC 3AE6C 4GDOA 1DD4A 2VZ4A 4LHFA 5KKZC 4R4MA 2NZ2A 4IL6X 3LURA 2H89C 3AE1C 5GQQA 1ZRTE 4Y28J 3Q5SA 4I7ZB 2WSCJ 2HVAA 2KCUA 3EZ2A 2K9YA 1ZMEC 5D90A 1Q0AA 1KMIZ 4OGQB 1VF5D 1BOWA 3FGAD 1VF5C 4B0YA 3AE2C 3IN6A 5KAWA 2WSFJ 3AE5C 1GMJA 5I41B 1Y9BA 3AE7C 2E74D 1OW8A 2G3AA 2OQQA 2E74C 3AEBC 1TU3F 1OW7A 2YMKA 4AYZA 3IAOA 2IDBA 3AE8C 3O6QA 3GPVA 2D2CD 3Q5PA 2J5UA 2JP3A 2D2CC 4H13B 4KT0J 1KQFB 3GK6A 5M1BA 2ZHGA 2IEFA 2QSIA 1Q07A 3HH0A 4J2NA 4R22B 4WLWA 2ZT9D 1Q09A 2ZT9C 3S9OA 1Q08A 2QJPC 2DG6A 4PV1B 1RH6A 4H44B 2E76B 1KQGB 2FYNC 2E75D 3AEDC 2QJYC 2E75C 1K04A 1ZP0C 3UCSA 4R24B 3EWKA 1UIXA 3AEEC 4Z1MH 2GOVA 2P10A 4H0LD 1DIPA 3GP4A 1DD3A 2FBWC 4H0LC 3D6YA 3C8VA 2WPVB 5KCBA 3R8JA 3GLMA 3D71A 3GF7A 3Q5RA 2G8YA 4TT3H 2BOWA 1U57A 3RK3E 3SFEC 4U7JA 2V7QJ 1S5LX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0H A;  3Q1M A;  2ZHG A;  1Q07 A;  3HH0 A;  3Q3D A;  4J2N A;  4R22 B;  4WLW A;  1EXJ A;  1Q09 A;  1Q08 A;  2VZ4 A;  3T97 B;  2DG6 A;  3G9R A;  4R4M A;  5E01 A;  3LUR A;  1D5Y A;  1JYH A;  5GQQ A;  3Q5S A;  3R8K A;  2HVA A;  2KCU A;  5D90 A;  5KAV A;  3UCS A;  1Q0A A;  4R24 B;  3D6Z A;  1BOW A;  3Q2Y A;  1JBG A;  5D8C A;  3B49 A;  5KAW A;  4B0Y A;  4R4E A;  5I41 B;  2GOV A;  1DIP A;  3GP4 A;  5I44 A;  4AYZ B;  2OQQ A;  3R8J A;  3D6Y A;  2JML A;  5KAT A;  5KCB A;  1Q06 A;  3D71 A;  5KAX A;  3Q5R A;  3D70 A;  1R8E A;  2BOW A;  1EXI A;  4WLS A;  3IAO A;  5KAU A;  4AYZ A;  1R8D A;  4A1M A;  3GPV A;  2J5U A;  3Q5P A;  4R4L A;  2ZHH A;  1Q05 A;  3GK6 A;  3QAO A; 
#chains in the Genus database with same CATH topology
 3H25 A;  3ZDM A;  3L72 D;  4M3L A;  1KB9 E;  1SQX G;  4I6M C;  1FZB A;  1L2P A;  3OAK A;  3MIW A;  3KQG A;  1NU1 D;  2ZAE B;  1N7S A;  2Y0D A;  5AVV B;  1S9K E;  1H0T B;  3L35 A;  2W83 C;  3D70 A;  1Y6U A;  1NTZ G;  3H1J D;  1FZA A;  3CWB D;  2Y9Z A;  2FXM A;  1L0N G;  4RKU J;  1G2C A;  3F5H A;  1OVV A;  3CCU P;  4PD4 I;  3RL0 B;  5AVS B;  3VP8 A;  4EIJ A;  1Q81 Q;  1FZC A;  3RK3 B;  3H1K J;  5GQQ A;  3K5B A;  2K9Y A;  3G6E P;  3MTU E;  5CMZ A;  2KS1 A;  3BRV B;  5CCG A;  3CC2 P;  2JJL A;  2E74 C;  1TU3 F;  2P2U A;  1P84 H;  2YIU B;  2C0X A;  1YIT P;  2D2C D;  3E7K A;  1OX3 A;  3MHV A;  1FZC C;  1QVF O;  4W7Y A;  3AED C;  1RY3 A;  2E75 C;  3EWK A;  3L74 E;  1G1I A;  4D6T E;  2Q9I A;  2GOV A;  1T3U A;  2KB7 P;  2QE7 H;  4IL6 E;  3L75 D;  2HOD B;  2OYO A;  2KNC A;  3A0B E;  3B5N B;  1PGQ A;  2I1K A;  1FDO A;  4IOI H;  2W6A A;  3H1I G;  2E5T A;  1JY2 P;  1HJ0 A;  3G9R A;  1KYO I;  1LWU A;  2WTY A;  4JYB A;  5E79 H;  3GHG B;  4A7P A;  5D8C A;  1GW3 A;  2Q7C A;  2POH A;  4OGQ D;  2OYH B;  2OTL P;  2M5A B;  2ZVO B;  3GG2 A;  2GA1 A;  1A02 J;  1LT1 A;  1JO5 A;  4H13 C;  5AVQ B;  1D5Y A;  2B89 A;  4EYY Q;  1HBW A;  2Z4E A;  1LWU C;  4H0L B;  1LT9 B;  2B88 A;  3KZI H;  4PV1 D;  2E76 D;  1Q06 A;  1KIL D;  1WT6 A;  3NMD A;  2IYO A;  2N1T D;  5CCH A;  2YNY A;  5AW1 B;  2B9B A;  1L0L K;  4GDO A;  2W90 A;  4K3A A;  4LHF A;  3JCU H;  2O01 H;  1SQQ K;  3HE4 A;  5AVR B;  2KCU A;  1LTJ A;  1U7J A;  1QLE D;  2FFD B;  1LJ2 A;  3PHL A;  2OYI A;  1ZXG A;  3PTZ A;  3MP7 B;  2RN0 A;  5APV A;  3M9B A;  1HGV A;  1YI2 P;  3SWK A;  1LGH B;  2UWJ E;  5KLV J;  1LTJ C;  4EDF A;  2IFM A;  1DIP A;  3GLM A;  1P84 D;  2KLU A;  3USS A;  3LID A;  1L4A D;  1S1C X;  1NU1 E;  1N73 A;  3CC4 P;  3AE3 C;  2BAS A;  1M57 D;  4MN4 C;  3UIA A;  2WVR A;  1VQO P;  4HB1 A;  2K88 A;  5K5G B;  1FJK A;  1Q7Y Q;  3CWB E;  5KJ7 D;  5KAT A;  4DCK A;  3EZF A;  1PL5 A;  3RGU A;  1GU4 A;  3OA7 A;  1GL2 D;  1S5L H;  1JB0 J;  3V2Q A;  4ZKP A;  1KOR A;  2FYN B;  1JY3 N;  3VYI A;  1IFP A;  3L74 J;  1MV8 A;  4D6T J;  1UII A;  1KTM A;  1N73 C;  1YQ4 C;  1DEE G;  2PGD A;  1KV4 A;  1BSN A;  3RK2 B;  3L73 E;  1EC5 A;  3HD7 A;  3CX5 D;  2R44 A;  1P84 I;  1RH5 B;  3M0D A;  1URQ B;  2Z5I A;  5KKZ C;  3H1K D;  1SVF A;  1CW5 A;  2WSC J;  2KUB A;  1VF5 C;  1R5S A;  2WIT A;  4C7N B;  1OW7 A;  3O6Q B;  3HD7 C;  2C0W A;  2H7H A;  2ZHG A;  1RE3 A;  2KP8 A;  3L75 E;  3M0D C;  4WVZ A;  4H44 B;  1W2E A;  3L4F A;  4W7Z A;  1RHZ B;  1UIX A;  4N6J A;  2WPV B;  3M9Q A;  1NHL A;  3CX5 I;  2V7Q J;  4L74 A;  2JWA A;  3B8E B;  1RE3 C;  1IFN A;  2IBZ D;  2PAJ A;  2BCC J;  2XZR A;  3L72 G;  3TSI A;  1L0L G;  3EFG A;  1ZN5 A;  2P58 A;  2ZXX A;  2WSS H;  1SQQ G;  3GMA A;  1N7L A;  4LGD E;  1IC2 A;  1KIL E;  3CMA P;  3V6I A;  1JTH A;  1KZU B;  2WSC H;  3I55 P;  3H1J G;  1Q90 D;  2Q3E A;  1NYH A;  4YTP C;  1HUC A;  2W8Z A;  1KFM A;  2K3R A;  1NU1 J;  5APY A;  3WUU A;  2R32 A;  4BXL A;  1GU5 A;  2YXR B;  1W5C E;  1JCC A;  2NZ2 A;  3LUR A;  3CWB J;  3PP5 A;  1S9K D;  3PRJ A;  5KAW A;  3H1L G;  1PZQ A;  2HPC B;  3AEB C;  2AEM A;  4AYZ A;  2FKW B;  2V7Q H;  2ZXE B;  3L70 G;  2IFN A;  2IEF A;  2K37 A;  1FOS E;  3H1H D;  1P84 E;  3L73 J;  1ZP0 C;  5KLV D;  1KFN A;  1RF0 C;  2J59 M;  5AW0 B;  3L71 G;  1DD3 A;  2FYU D;  1GK6 A;  1SQV D;  1SFC C;  1KB9 I;  3NFQ A;  1KD1 Q;  3BCC G;  1CI6 A;  1ZLL A;  4OWF A;  1FE6 A;  5CHX A;  1NTM D;  2QG4 A;  1CZQ A;  2D2C B;  2Z5H A;  1RQV A;  5KAX A;  4Y99 B;  2OYH A;  2MKV A;  1M1J B;  2IYP A;  3HTK B;  5E79 E;  2I1J A;  2RKL A;  1LTB C;  3R2P A;  1VL2 A;  4ASW A;  4D6T D;  3CX5 E;  5BU5 A;  3RL0 g;  2H43 A;  2XV5 A;  5APW A;  1JBG A;  4JQ0 D;  3AEF C;  4EOT A;  1VQ4 P;  2Q3I A;  3GW6 A;  3KZI E;  4TLF A;  3QAO A;  1FZG A;  1EZV G;  1MFZ A;  3G4S P;  5DJT B;  3IR9 A;  4OGQ B;  1RF1 B;  1X0T A;  3AE7 C;  2E74 D;  2FFD A;  3JCU E;  1NTK D;  2YXQ B;  4KHX A;  3I56 P;  2YKO A;  3GPV A;  2JP3 A;  4ZKU A;  3TGU J;  2KYV A;  3A3Y B;  4PV1 B;  2A06 D;  2E76 B;  1XTG B;  3OW2 O;  2E75 D;  5CJ4 A;  2QJY C;  1YTZ I;  1NKN A;  4R24 B;  1KIL B;  2CPS A;  4JF7 A;  2IPP A;  3IF4 A;  4W80 A;  2IBZ E;  3H32 B;  2R3C A;  2N1T B;  5AVT B;  2E5Y A;  1IJD B;  1GZL A;  1U7M A;  4XA4 A;  1FC2 C;  2BCC D;  1RQU A;  2O01 N;  2A45 G;  2WSF H;  1QL2 A;  3HUS C;  2XU6 A;  3FXD A;  4ZMD A;  2RMZ A;  1Q05 A;  4ZNC A;  3EZ7 A;  1GW4 A;  4H13 D;  3AEA C;  2LR2 A;  3CCS P;  1S5L E;  1GD2 E;  1DX7 A;  2WPR A;  1EXI A;  1L4A B;  2P1J A;  5AW4 B;  2WT7 B;  1BCC D;  3EZ9 A;  4R4L A;  1NJI Q;  4N3Y B;  4UB6 H;  1NO4 A;  2OTK E;  2XNX A;  1YJ9 P;  1VPC A;  1AQ5 A;  3T97 A;  2HVA A;  3EZ2 A;  1VQ8 P;  1Q0A A;  3H1K G;  2JDI H;  1YYC A;  3VOP A;  3H1H E;  1GMJ A;  3L36 A;  2QEX P;  4K35 A;  1GL2 B;  4C7N A;  2QM7 A;  3CCE P;  3O6Q A;  1S4X A;  5KLV E;  2W27 A;  1N7S C;  1SP4 A;  1T6A A;  3CXH H;  3A5T A;  2FYU E;  1BDD A;  1SQV E;  3L73 D;  1ZR4 A;  1OVR A;  1M7L A;  1MZ9 A;  1KQL A;  2WSE H;  3C8V A;  3P8C D;  5AVX B;  2ZYD A;  4AUW A;  1A02 F;  1NTM E;  1YQ3 C;  1GK4 A;  1J1D B;  1OW6 A;  1K8A Q;  1SQP E;  4DCZ A;  2O01 J;  3SFD C;  1LNQ A;  5GTH H;  2IZ0 A;  4JBZ A;  5KLI C;  3FXE A;  3S4R A;  5CCG C;  3BAT A;  1JY3 O;  2QJP B;  2Y0C A;  3VN0 A;  3MZW B;  3N4X A;  1USD A;  1QL1 A;  1PPJ D;  1X79 B;  1Q86 Q;  3FX0 A;  3V2R A;  3W67 A;  1AFO A;  1PGO A;  4B86 A;  5KAF H;  2ZHH A;  4OVN F;  1NTK E;  3B4S A;  2IZ1 A;  4GOE A;  1VF5 D;  3FGA D;  2C9N Y;  3LW5 H;  2HPC A;  2A06 E;  3HD7 D;  1PGP A;  2J5U A;  3VP9 A;  2NPS A;  3TGU D;  1QVG O;  2OTJ P;  3II6 A;  3A0H E;  2ZT9 C;  2FXO A;  3OJA B;  1BDC A;  4N78 D;  3WUT A;  1H8A A;  3WMM 0;  1FBM A;  3JC2 2;  3VMY A;  3HE5 A;  1NU1 K;  1VQN P;  1JNM A;  1BGY E;  3R8J A;  2BCC E;  2BOW A;  4WY4 A;  5BVZ A;  2M8R A;  2ITA A;  3CXH D;  3Q3D A;  2NPS C;  5CCH C;  3RBX A;  3H1H J;  1SQB D;  2OG0 A;  1K9M Q;  4L73 A;  3H6P A;  4I7Z C;  1AJY A;  2FYU J;  2OYI C;  1M1J A;  4WY4 C;  1SQV J;  3HTK A;  4YXW H;  2LXB A;  1EXJ A;  1MUU A;  2O1K A;  1IFI A;  1JYH A;  3L74 G;  1BCC E;  4D6T G;  1JCD A;  3IFM A;  3U1C A;  4GKG A;  1PP9 E;  4NPD A;  1NTM J;  5KAU A;  1R8E A;  4WBA A;  3WU2 E;  3CCQ P;  1LTG C;  1OVU A;  4WB4 A;  1FU1 A;  4U3F D;  5KTB A;  5APQ A;  1OIP A;  1SQP J;  3V5B A;  1JMM A;  5GTI H;  1KQS O;  4KJM A;  1JOC A;  3C1L A;  4GOD A;  1ZME C;  1RF1 A;  2M0B A;  1CSB A;  1K73 Q;  2QM8 A;  1ZRT D;  4LLH A;  1SQX D;  3M91 A;  1Q09 A;  2O3J A;  1J1E C;  3P8C E;  5AVU B;  1IFM A;  3CD6 P;  3UCS A;  4Z1M H;  3D6Y A;  1NTZ D;  3H32 A;  2N1T A;  1BSH A;  1SFC D;  1NTK J;  4UB8 H;  1NVO A;  4IFF A;  1QGK B;  1G2C B;  3EZ6 A;  2E74 B;  3U59 A;  2ZFC A;  3VMA A;  1PPJ E;  2KI7 B;  1JUN A;  3FWN A;  1FZC B;  3L37 A;  2E75 B;  1AA0 A;  1WMK A;  3TNU B;  2AXC A;  1N86 A;  1BGY J;  1R5L A;  2R3S A;  1MKM A;  2HYN A;  2BEZ F;  3VMX A;  4XFJ A;  2WPS A;  1L4A A;  1RE4 A;  2XND H;  1NU1 G;  5H2F H;  1H0T A;  1YJW P;  5AVW B;  1DD4 A;  3TGU E;  1PFI A;  1G1J A;  4UB6 E;  3CWB G;  1VQK P;  4N78 E;  4LC1 A;  1LP1 B;  2YMK A;  1GL2 A;  4DJG A;  3H1I D;  1HJB A;  1M8O B;  2N9Y B;  4H13 B;  4KT0 J;  1RE4 C;  1BCC J;  1JY2 O;  4WLW A;  2YMY A;  3S9O A;  1LWU B;  1Q08 A;  2DG6 A;  1L0L J;  5B66 H;  1PP9 J;  2OAR A;  2HG5 D;  4BWN A;  5CBN A;  2IBZ I;  2WMM A;  3CXH E;  3G71 P;  3L73 G;  3AEE C;  2FBW C;  1SQB E;  2E42 A;  3BVH A;  2G8Y A;  4CPG A;  5EFW B;  1U57 A;  2L91 A;  3RL0 C;  2CK3 H;  2CPB A;  3PJS K;  3RK3 C;  3TYY A;  2MJZ A;  4C46 A;  1FS0 E;  3CCJ P;  2HOD A;  3L75 G;  2YIU C;  5GTH E;  3B5N A;  1AV1 A;  1WRG A;  2BEQ D;  4C7R A;  1VQP P;  1N2D C;  1AQT A;  1LTJ B;  2KOG A;  3H1L J;  2AEJ A;  4U3F E;  3D6Z A;  2ZYG A;  2L5G B;  1PPJ G;  4PD4 H;  3GHG A;  1YJN P;  3L70 J;  3P32 A;  1HVV A;  2M5A A;  1X8Y A;  1DEB A;  1NAF A;  1SQP D;  1FDM A;  3AE6 C;  2XKM A;  2NRG A;  5KAF E;  3B5N C;  1OWA A;  3AE1 C;  1ZRT E;  4XE5 B;  3CPW O;  2N9B A;  1SQX E;  1NWQ A;  1LT9 A;  2WSF J;  4PJ0 H;  2G3A A;  2JKV A;  3GHG C;  2ZYA A;  4O9B A;  2Y0E A;  1N7S D;  2K9J B;  3RBZ A;  2OYH C;  1N73 B;  5M1B A;  1FAV A;  2E43 A;  2HLO A;  1NTZ E;  3E1R A;  1VQ6 P;  1ZR2 A;  1L0N E;  1AVY A;  2P10 A;  1M56 D;  4H0L C;  1LT9 C;  4WWI A;  3GF7 A;  4L75 A;  5KKZ B;  1H88 A;  1ZW0 A;  3V4W A;  1KYO H;  1YBK A;  1OMI A;  1VF5 B;  5AW3 B;  2JEE A;  3R8K A;  4I1L A;  3HD7 B;  5CCG D;  3EQ2 A;  5L8R J;  1YTZ T;  5APU A;  1LTS C;  2FFD C;  1R8D A;  4YPC A;  2FXP A;  4NPF X;  1USE A;  1HGZ A;  3QWO C;  1BGY D;  5APS A;  3AE9 C;  1SQB J;  4L76 A;  2AXT H;  1PV3 A;  3AEG C;  4QMA A;  2KLV A;  2WSE J;  4OH8 B;  3CLQ A;  3PLN A;  3FWL A;  1VDF A;  3MD0 A;  4EI2 A;  1IFD A;  1YIJ P;  5AW9 B;  3H1I E;  2C9L Y;  4Y28 J;  5KLV K;  5TJH A;  3IN6 A;  2FYU K;  4PD4 D;  5I41 B;  2OQQ A;  4GIF A;  4RO0 A;  4JYC A;  1SQV K;  5GTI E;  1NAY A;  3Q5P A;  1S72 P;  1KQF B;  3HH0 A;  2KZI A;  4R22 B;  2ZT9 D;  4U3F J;  1L0L D;  1PP9 D;  1URQ A;  1RH6 A;  2FYN C;  3MGN A;  1SQQ D;  1NTM K;  5TIS H;  3JSV C;  1BE3 J;  1J2J B;  1JEK A;  1QEX A;  1SQP K;  3M06 A;  3RK2 C;  2W6J H;  1DH3 A;  2NPS D;  5KAI H;  5CCH D;  1JTH B;  2Q1K A;  2QIW A;  1SQX J;  1QX8 A;  2KSE A;  2P7J A;  1URQ C;  2JO1 A;  3SSU A;  2O1J A;  1H89 A;  1T2K C;  2YO3 A;  1VQL P;  4UB8 E;  2HR3 A;  4HKZ H;  2B87 B;  5APX A;  3LW5 J;  1FZF A;  1NTZ J;  4DZO A;  1LX8 A;  4WY4 D;  4JPZ B;  1KYO D;  2WZ7 A;  1L0N J;  4GT1 A;  1ZOY C;  2P67 A;  3H1L D;  2KVV A;  3TNU A;  1PM6 A;  3AE4 C;  4RES B;  2IBZ G;  4H44 C;  4R4E A;  3LIE A;  1D7M A;  1SFC B;  2PFX A;  4AYZ B;  1NTK K;  3L70 D;  3KXD A;  1GTW A;  1HH0 A;  3S1K A;  1HF9 A;  2PRR A;  1EDL A;  2A45 H;  2VZ4 A;  4IL6 X;  3L71 D;  3V2N A;  2GM4 A;  5H2F E;  2J58 A;  3AE5 C;  1LTT C;  1LTA C;  2FYZ A;  3BCC D;  1LP1 A;  2QJK B;  2R5D A;  1CI6 B;  1Z56 A;  1KC8 Q;  2JR8 A;  1K04 A;  1OXZ A;  3CX5 H;  2KK7 A;  5B66 E;  1FJP A;  4U7J A;  3H1I J;  1E5W A;  2QRX A;  5C39 A;  3GF3 A;  5E01 A;  3H1H G;  1JM0 A;  2RH0 A;  3V4Q A;  2HFE D;  3Q2Y A;  1EZV D;  5KLV G;  1IZN B;  3R4Y A;  1EDJ A;  2FYU G;  4NPE A;  4AQR D;  3MUD A;  2M3E A;  2QJY B;  1SQV G;  3TF5 A;  2YO2 A;  5AW8 B;  5B5E H;  1NGM B;  4BRY B;  1LTI C;  4IFM A;  4DOJ A;  3M0A A;  5AW5 B;  3BAS A;  2H88 C;  1NTM G;  3CCR P;  4PD4 E;  4YXD C;  4DT0 A;  1VQ5 P;  3HUS B;  3MUD C;  1SQP G;  3Q5S A;  1W2B O;  1KMI Z;  2YKP A;  3KHU A;  3A7O A;  3L72 E;  1Y9B A;  1L0L E;  2JWD A;  3A2A A;  1EZV I;  3IAO A;  1SQQ E;  3U1A A;  2D2C C;  2K9J A;  3N7N A;  4PJ0 E;  4Y99 C;  1Q07 A;  1AVO A;  1M1J C;  3EFF K;  3CXH I;  2ZVN B;  2Q5U A;  1VQ7 P;  2K1A A;  3H1J E;  1BE3 D;  3HRN A;  5KCB A;  2M3B A;  3D71 A;  4ASV A;  1KB9 H;  1FZE A;  3RL0 D;  1MFT A;  1NTK G;  3CME P;  3KDP B;  3G3Z A;  3RK3 D;  4HH2 A;  2R5B A;  1KYO E;  1FDI A;  1EQ7 A;  2A06 G;  1KIL A;  5I44 A;  1N7S B;  2JML A;  3H1L E;  4OGQ C;  1PGJ A;  1RF1 C;  1X9V A;  3P8M C;  2IX7 C;  4AYC A;  2QA4 P;  3ABV C;  1L0N D;  3L70 E;  2A45 I;  3PH0 A;  3T97 B;  1VQM P;  5AW6 B;  2WQY C;  1NH4 A;  1BGY G;  4PV1 C;  2BCC G;  2E76 C;  2LXC B;  1M90 Q;  1IK9 A;  2YKQ A;  1KIL C;  3L71 E;  1X22 A;  2AXT E;  2KZJ A;  2N1T C;  2KSJ A;  1YHQ P;  3B5N D;  3BCC E;  3KPE A;  5KLI B;  2KS1 B;  1E79 H;  3TDK A;  2FY8 A;  5CBO A;  2IDB A;  2Y9Y A;  1EDI A;  2ZJS E;  2WT7 A;  4HJG H;  1SQB K;  1BCC G;  4IL6 H;  4IFD K;  1PP9 G;  1HWT C;  3A0B H;  1EDK A;  5KJ7 A;  3W68 A;  4H0L D;  1ZV8 A;  4TT3 H;  3Q5R A;  2KNC B;  1SLQ A;  5TIS E;  3Q1M A;  1OZH A;  1L4A C;  3KYQ A;  5CJ0 A;  2PP6 A;  1EZV E;  3L72 J;  1Y8A A;  2XDJ A;  3BRT B;  1SS1 A;  1Q2N A;  5KAI E;  1SQQ J;  5APT A;  2QVA A;  5KJ7 C;  2GUV A;  2B87 A;  2Q6Q A;  5AVZ B;  1KB9 D;  2ZT9 B;  1T8Z A;  2KXP B;  1GL2 C;  1XTC C;  3E0H A;  3SWF A;  3H1J J;  3CCM P;  1RF0 A;  1S2E A;  3A0H H;  4GOF A;  3VMZ A;  3C9I A;  1VQ9 P;  1SFC A;  4WLS A;  2NPS B;  2LKM A;  1SQX K;  1JY3 P;  5DJU B;  5AW2 B;  1JMB A;  2VRS A;  2AEF A;  3HE4 B;  1IO4 A;  1M1K Q;  4I7Z B;  1J1D C;  3HE5 B;  1BOW A;  2OYI B;  3CI9 A;  2DW3 A;  1T3J A;  4RJT A;  1NTZ K;  1OW8 A;  4WY4 B;  1Q82 Q;  1OFC X;  1L0N K;  4I2L C;  2OGU A;  1BE3 E;  2WWW A;  1Y47 A;  4HYT B;  2QJP C;  3CCL P;  5AVY B;  3L71 J;  1IFJ A;  2W6B A;  3GP4 A;  2WPQ A;  3L75 J;  3RK3 E;  3RK2 D;  3BCC J;  1KN7 A;  5AW7 B;  3L74 D;  2QJK C;  1PIX A;  2V4H A;  3M9H A;  3TGU G;  1URQ D;  5BU8 B;  3WU2 H;  1T2K D;  5KAV A;  2I8D A;  1GDT A;  3CC7 P;  2KIK A;  3H1K E;  3WUV A;  1FOS F;  4A1M A;  1J1E B;  3SWY A;  1N8R Q;  3NXS A;  1NOH A;  1S3J A;  1HTL C;  1IK7 A;  4H44 D;  3B49 A;  1SQB G;  3AEC C;  4BRY A;  1K05 A;  3B71 A;  5B5E E;  3TK1 A;  2GUS A;  4R4M A;  1JY2 N;  2H89 C;  3HUS A;  3O8Z A;  3QH9 A;  3CCV P;  5D90 A;  4B0Y A;  3AE2 C;  3F89 A;  3AE8 C;  1NKZ B;  3GK6 A;  2QSI A;  2H8P D;  3NTN A;  4J2N A;  4U3F G;  1KQG B;  3P7K A;  3VTP C;  3E1I A;  3ITK A;  2SPZ A;  3V2P A;  3CL3 D;  3I5C A;  1BE3 G;  3SFE C;  1S5L X; 
#chains in the Genus database with same CATH homology
 1YQ3 C;  3Q1M A;  3H25 A;  3Q3D A;  1FDO A;  1S1C X;  2QJK C;  2QIW A;  1PIX A;  3AE3 C;  1OMI A;  1HJ0 A;  1OW6 A;  3G9R A;  3GF3 A;  5E01 A;  1VF5 B;  1RQU A;  2OG0 A;  3EZ6 A;  3R8K A;  4DCZ A;  2O01 J;  2E74 B;  2JO1 A;  5KAV A;  3Q2Y A;  5D8C A;  1FDI A;  3SFD C;  4I7Z C;  5I44 A;  2D2C B;  2JML A;  4OGQ D;  1RQV A;  3EZF A;  1PL5 A;  4OGQ C;  5KLI C;  5KAT A;  5KAX A;  5L8R J;  1AJY A;  2MKV A;  3LW5 J;  2ZT9 B;  1R8D A;  3R4Y A;  4A1M A;  1LX8 A;  3GMA A;  2FXP A;  3D70 A;  1Q05 A;  1JB0 J;  1Y6U A;  3E0H A;  2YIU C;  1VL2 A;  1KOR A;  3ABV C;  1EXJ A;  3EZ7 A;  2BEQ D;  4H13 D;  2E75 B;  1KIL E;  4H13 C;  1WMK A;  3T97 B;  1KTM A;  1ZOY C;  3AEA C;  1D5Y A;  1JYH A;  1YQ4 C;  2KVV A;  3AE9 C;  1Q90 D;  1PM6 A;  1MKM A;  2WQY C;  1NYH A;  4H0L B;  3RL0 g;  3AE4 C;  1PV3 A;  3AEG C;  4RKU J;  3D6Z A;  4YTP C;  1NGM B;  4PV1 D;  1IK7 A;  1JBG A;  2E76 D;  4H44 D;  4PV1 C;  3B49 A;  3AEF C;  4R4E A;  2E76 C;  4H44 C;  3AEC C;  4AYZ B;  1K05 A;  1Q06 A;  3B71 A;  2H88 C;  2WSE J;  1R8E A;  5KAU A;  1EXI A;  4WLS A;  2BEZ F;  4XFJ A;  1HF9 A;  3EZ9 A;  2ZHH A;  4R4L A;  3QAO A;  4YXD C;  3AE6 C;  4GDO A;  1DD4 A;  2VZ4 A;  4LHF A;  5KKZ C;  4R4M A;  2NZ2 A;  4IL6 X;  3LUR A;  2H89 C;  3AE1 C;  5GQQ A;  1ZRT E;  4Y28 J;  3Q5S A;  4I7Z B;  2WSC J;  2HVA A;  2KCU A;  3EZ2 A;  2K9Y A;  1ZME C;  5D90 A;  1Q0A A;  1KMI Z;  4OGQ B;  1VF5 D;  1BOW A;  3FGA D;  1VF5 C;  4B0Y A;  3AE2 C;  3IN6 A;  5KAW A;  2WSF J;  3AE5 C;  1GMJ A;  5I41 B;  1Y9B A;  3AE7 C;  2E74 D;  1OW8 A;  2G3A A;  2OQQ A;  2E74 C;  3AEB C;  1TU3 F;  1OW7 A;  2YMK A;  4AYZ A;  3IAO A;  2IDB A;  3AE8 C;  3O6Q A;  3GPV A;  2D2C D;  3Q5P A;  2J5U A;  2JP3 A;  2D2C C;  4H13 B;  4KT0 J;  1KQF B;  3GK6 A;  5M1B A;  2ZHG A;  2IEF A;  2QSI A;  1Q07 A;  3HH0 A;  4J2N A;  4R22 B;  4WLW A;  2ZT9 D;  1Q09 A;  2ZT9 C;  3S9O A;  1Q08 A;  2QJP C;  2DG6 A;  4PV1 B;  1RH6 A;  4H44 B;  2E76 B;  1KQG B;  2FYN C;  2E75 D;  3AED C;  2QJY C;  2E75 C;  1K04 A;  1ZP0 C;  3UCS A;  4R24 B;  3EWK A;  1UIX A;  3AEE C;  4Z1M H;  2GOV A;  2P10 A;  4H0L D;  1DIP A;  3GP4 A;  1DD3 A;  2FBW C;  4H0L C;  3D6Y A;  3C8V A;  2WPV B;  5KCB A;  3R8J A;  3GLM A;  3D71 A;  3GF7 A;  3Q5R A;  2G8Y A;  4TT3 H;  2BOW A;  1U57 A;  3RK3 E;  3SFE C;  4U7J A;  2V7Q J;  1S5L X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...