3D71A

Crystal structure of e253q bmrr bound to 22 base pair promoter site
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIRILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BMR promoter DNA
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
total genus 78
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d71A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d71A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d71A03
2GOVA 2VZ4A 2J5UA 4J2NA 1EXIA 3GPVA 1Q07A 1Q05A 2KCUA 5E01A 3Q2YA 1BOWA 3G9RA 3D71A 2DG6A 2HVAA 5GQQA 3UCSA 1Q09A 1R8EA 4WLSA 5KATA 4B0YA 3GK6A 3T97B 5KAXA 3R8JA 3GP4A 4R24B 5I41B 1D5YA 5D90A 1R8DA 4AYZA 4R4EA 3Q3DA 1JYHA 3HH0A 1Q08A 2ZHGA 3Q1MA 3IAOA 3Q5PA 5KCBA 1Q06A 3D6ZA 1JBGA 4R4MA 4R4LA 5KAUA 2ZHHA 3Q5RA 1DIPA 1EXJA 5KAVA 2BOWA 2JMLA 4AYZB 4R22B 3B49A 1Q0AA 5D8CA 5KAWA 3D70A 3LURA 3R8KA 4A1MA 2OQQA 5I44A 3E0HA 4WLWA 3Q5SA 3QAOA 3D6YA
chains in the Genus database with same CATH superfamily
3ABVC 1X79B 3GPVA 3VMZA 4TLFA 2Q7CA 1X0TA 1T2KC 3FWLA 2HVAA 4LLHA 2QG4A 3L35A 1AA0A 2YKQA 2RMZA 3C9IA 1LTTC 2P2UA 2OYHC 3QAOA 2QJKC 2FYUJ 1EXIA 1IFNA 1NO4A 2E76D 1SQXD 1L4AB 1NU1J 3VTPC 3MUDA 1VQLP 3AECC 3IFMA 2W90A 3L72E 2I1KA 2WPRA 1EDLA 4Y99C 2YO3A 1LTIC 2Q3EA 3A0HE 2Q9IA 1L0LK 5APQA 4IL6E 3RGUA 1ZP0C 1M1KQ 2KCUA 1NYHA 1N7SD 2IBZD 1YBKA 2OYHB 1NKZB 2QJKB 3H1HE 1N8RQ 1URQA 3TF5A 1VQNP 2KLUA 2HR3A 2FYNC 3H1LG 2Y0CA 3CX5E 4Y99B 2UWJE 1SQVG 1QLED 2WVRA 4PD4E 1FZCC 1LTJA 2KZIA 5CCGC 1M1JA 3H1HD 1ZOYC 3FX0A 3CWBJ 1LTAC 4R4MA 1BE3G 1U57A 3A2AA 4WLWA 3L72J 2FYNB 1FAVA 1QEXA 3CX5D 3CXHE 2Y9YA 1X9VA 2E42A 1M8OB 3L71D 2KSEA 1NWQA 3B5NC 4CPGA 4IL6H 1FZCB 2E76C 1U7MA 3CD6P 1KQFB 4JPZB 3GG2A 5KTBA 4PV1D 1NH4A 2FYUG 1QVGO 5KAXA 4R4EA 1Q90D 1NU1G 2OTJP 1P84H 2R5BA 1GK4A 1AV1A 2YKPA 4PD4H 2OG0A 2FYZA 3PTZA 1N7SC 3TNUA 5B5EE 2E76B 2P1JA 5AW5B 2LXCB 1NTZG 2HPCB 3GF7A 3R4YA 1VQ5P 1AVYA 3CI9A 3NXSA 3EZFA 1ZMEC 1M1JB 1H0TB 5KAFE 1L0NE 4EOTA 2Z5HA 3CXHH 5KAWA 1MFZA 2ITAA 3AEAC 3BRTB 2J5UA 2H43A 1N7SB 4HH2A 1YTZI 3L70E 2JWDA 3CCRP 4H44C 5KLIC 3T97B 1BSNA 2R32A 5CMZA 1Q06A 3D6ZA 1T3JA 2YIUC 4Y28J 3TGUE 1E5WA 2OTKE 2IZ0A 1BGYJ 2BCCJ 2ZYAA 3L72G 5BU8B 3HUSC 4JBZA 5KJ7D 1PP9D 2K1AA 5B5EH 2ZT9B 5KLIB 1WT6A 3SFEC 2K88A 1Q82Q 1N86A 3TGUD 2KI7B 1AJYA 2YIUB 1SS1A 3H1HG 2PAJA 2Z4EA 3JCUE 3E1RA 4UB8E 1Q05A 2O1KA 2SPZA 3CCEP 1HWTC 1L0NJ 3UCSA 3RK3E 2G8YA 2P10A 1KYOH 1OVVA 2XKMA 2QEXP 1SVFA 1SQXK 2K3RA 2AEMA 2DW3A 2A06D 1YTZT 1QVFO 2D2CD 3L70J 2KOGA 2WTYA 3I55P 1LT9A 3MZWB 4L76A 1SQPJ 3USSA 3CC4P 1QL1A 4PV1B 1L2PA 3LW5H 5BU5A 1N7LA 4ZNCA 4K3AA 1QX8A 3RK3D 1SFCC 1KILA 4WVZA 1VQPP 1OX3A 4U3FE 1IK7A 1JO5A 4WY4D 4JF7A 4A1MA 1IZNB 3KDPB 1PV3A 1J1EB 4HJGH 1NVOA 2WSSH 2ZFCA 1N73C 2WZ7A 2M3BA 3PRJA 5GTIH 4GODA 3JCUH 1S5LE 3AEFC 2HYNA 1LTBC 1S3JA 2YKOA 1S2EA 1JTHA 1GMJA 5APUA 5KJ7C 4RESB 1NGMB 3BVHA 3AE5C 5AW3B 2ZHGA 1ZRTE 3AE8C 3HRNA 2JWAA 1NTMJ 1LTGC 1K9MQ 1ZR4A 4JYCA 1RQVA 3U1CA 4U3FJ 1SQQK 2D2CC 1L0NG 3QWOC 1KFMA 1N2DC 1OVUA 1KQLA 3PLNA 3VMXA 1ZRTD 3L70G 4A7PA 4C7NA 3AE7C 3M06A 1S9KD 3TGUG 1RF0A 2M5AA 3AE6C 3EZ9A 2D2CB 1IFPA 3E7KA 1Q7YQ 1FZAA 1Q0AA 1FDIA 2LKMA 3D70A 4OGQD 1FDOA 5KAIE 1YJNP 1FDMA 3GHGC 4DJGA 2P67A 4YTPC 2HG5D 1JTHB 3H32A 3H1KJ 3II6A 2FFDA 3RK3B 2B9BA 4EYYQ 1OMIA 4O9BA 3IAOA 4W7YA 2QJYC 4WY4B 2FXOA 4ASWA 4UB6E 3CL3D 1FC2C 1KC8Q 1IFDA 2IFMA 1P84I 3RBXA 1S1CX 1PPJE 1GL2C 3L75E 4PD4I 2N1TD 1EDKA 3MHVA 4JYBA 4EDFA 5CCHD 2E5YA 1RE4A 3Q5SA 2GUVA 2QJYB 1GU4A 2FBWC 1NAFA 2IPPA 2OTLP 1DH3A 1FZBA 3OA7A 4U3FG 3CXHI 3ITKA 3L75D 1RE3C 4D6TJ 2IYOA 3L36A 1PGOA 2AXTE 2N1TA 2K37A 3H1LD 1SQVD 4UB6H 3V6IA 3FGAD 2KB7P 2JJLA 1KMIZ 3N4XA 3IN6A 3N7NA 3F5HA 3H1KG 5KLVK 4OVNF 4TT3H 1Y9BA 2IFNA 1K73Q 1GK6A 2QSIA 4OGQB 1DEEG 2GOVA 1KYOI 1K04A 1DD3A 1NTKK 2H7HA 1JM0A 1KFNA 5APVA 5CCHC 1S4XA 1Q2NA 3WMM0 1RF1C 1KD1Q 2W8ZA 1M90Q 2HLOA 2FYUD 1M56D 5AVWB 1L4AC 3B4SA 1LP1A 1NU1D 2B88A 4N6JA 1KQGB 3Q2YA 3M9BA 2J59M 3C8VA 1NJIQ 1G2CA 2C9LY 1R8DA 4AYZA 2I1JA 2W6AA 5KCBA 2N1TB 1URQD 4BXLA 3U59A 1RF1B 1NTZD 5APYA 2B87A 3EFGA 2GA1A 1YQ4C 3CWBE 2E74D 3A7OA 2OGUA 2YNYA 3BATA 1M57D 2LR2A 2H8PD 4I2LC 2WT7A 4LHFA 1PPJG 3L75G 3EZ7A 3CWBD 1JY2O 4K35A 4B0YA 3H25A 2BASA 1Y8AA 1WMKA 3WUVA 2Y0EA 1ZN5A 3L72D 5CHXA 2QVAA 2OYIA 4PJ0H 1P84E 2H88C 1FE6A 4DCKA 1UIXA 3L73J 1LP1B 3KQGA 3MUDC 3NMDA 3M0DA 4B86A 3R2PA 2ZT9D 2FXMA 2IDBA 1YYCA 1A02F 1EDJA 1P84D 1K05A 3A5TA 3BCCJ 4PD4D 1OXZA 1URQC 5DJTB 1JBGA 1JY2N 5H2FH 3GW6A 1VQ8P 4YXWH 5AVVB 2E74C 4I1LA 3M9QA 2WT7B 3H1JE 1LTJC 3LIDA 2PRRA 1M1JC 3CXHD 2N9YB 2QJPC 1BGYE 2BCCE 3HTKA 1URQB 3M91A 1SQVK 2C0XA 3AE1C 1ZR2A 2NZ2A 5AW6B 1J1DB 2OYIB 3VN0A 5AVZB 2E74B 1VF5D 1Q09A 1HBWA 5C39A 4AYCA 5BVZA 3AE4C 1LTJB 2KS1A 1IFMA 1BGYD 1KYOE 2BCCD 4HYTB 3CCVP 2POHA 2QJPB 5I44A 3G9RA 4YPCA 3D71A 3VP9A 1OVRA 1SQQJ 2ZT9C 2NPSD 2W6JH 1JY2P 3KHUA 1SQPE 3Q1MA 2IX7C 2WWWA 2MKVA 3QH9A 3H1JJ 1JY3O 3O8ZA 1KILE 3CWBG 1KYOD 1LWUA 1L0ND 2FYUK 4IFFA 3WUUA 2DG6A 1NU1K 1R8EA 4WLSA 1GTWA 2OYOA 1KZUB 3L70D 1HGVA 1RQUA 1JB0J 1NOHA 1WRGA 4PV1C 3L4FA 2Y9ZA 1CSBA 1VQMP 1KILD 3HTKB 5GTIE 3RL0D 1NTZK 2NPSA 1EQ7A 2WSCJ 3TNUB 2XZRA 4WBAA 2WSCH 4R24B 1VQKP 1RH5B 1VL2A 2NRGA 2KVVA 3Q5RA 2R3SA 5AW1B 1SQBE 3U1AA 3ZDMA 2W83C 1J1EC 1PGQA 4DZOA 4OWFA 1Q07A 3VYIA 2R44A 1VDFA 2V7QJ 1N73A 2V7QH 2ZJSE 1JEKA 1NTME 2H89C 1PP9J 4Z1MH 3A0BH 1BSHA 3R8KA 1LWUB 1VF5B 4IOIH 3I56P 1BCCE 3MD0A 1FOSE 2KK7A 1YJ9P 1LGHB 1NTMD 3NTNA 2WMMA 1LT9C 5DJUB 3H1JG 4I7ZB 4U3FD 2A45H 1J2JB 1FZEA 2I8DA 1Q86Q 1SQBJ 1BGYG 2BCCG 2NPSB 2N9BA 1EZVI 3Q3DA 2Q1KA 3VMYA 3IF4A 1OW8A 3CCQP 3C1LA 1NKNA 1KILC 2BEQD 1ZW0A 5KAUA 3RL0C 3LURA 4N78E 1JY3P 3W68A 3H1KE 1GDTA 3H1IJ 5EFWB 4BRYA 3VP8A 5CBNA 1LT9B 2WPVB 2ZVOB 3L74J 3V2QA 3B71A 4RJTA 5KLVJ 1PM6A 1KB9H 1EDIA 1BCCJ 2JKVA 3B49A 4I6MC 3PHLA 3MGNA 1KILB 3A3YB 3GHGA 2G3AA 2Q5UA 4N78D 3RL0B 3H1KD 3KYQA 1JMBA 1QGKB 3RK3C 1SQPG 1NTKJ 2XU6A 5KATA 4KHXA 5AW7B 1USDA 1L0LE 2QM7A 1D5YA 2ZYGA 4WY4C 4KT0J 4XFJA 1FJPA 2KYVA 2E75D 2VZ4A 4HB1A 2IZ1A 2IBZI 3GLMA 4D6TE 2FXPA 3KXDA 4WWIA 1DIPA 2BOWA 3TDKA 4NPDA 1JUNA 4LGDE 2OARA 1L0NK 1VPCA 3NFQA 4D6TD 5APSA 3HD7A 1RF0C 1SQBG 1CZQA 5K5GB 2HFED 2Y0DA 1UIIA 4KJMA 3CCUP 1XTCC 1L0LJ 1PGJA 1S72P 1FBMA 1AQTA 1NTMG 2M0BA 3PJSK 2M3EA 3OW2O 2ZAEB 2FFDC 4C7NB 2XNXA 4DT0A 2RH0A 2PP6A 1PPJD 1K8AQ 1KTMA 2M5AB 2OQQA 1MKMA 2AEJA 1DD4A 4IL6X 1BCCG 1YQ3C 1T3UA 5APXA 3S4RA 1HJ0A 1T2KD 2CK3H 3CMAP 1M7LA 3MIWA 3H32B 2QIWA 4OGQC 2XV5A 2E75C 2FFDB 1VQ7P 2JMLA 4GOEA 1RE4C 3VOPA 2P58A 2XDJA 2KP8A 5APWA 1AVOA 1YI2P 5CJ0A 3GK6A 3TYYA 1CW5A 4AQRD 3CC2P 3OJAB 4IFDK 3HD7B 1XTGB 2QE7H 4R22B 3HE5A 1L4AA 1FU1A 1GU5A 2E75B 3WU2E 2CPSA 5AW9B 3EWKA 1JNMA 1EZVE 5AVSB 1HUCA 2N1TC 1Y6UA 1YHQP 4EIJA 1CI6A 2YXQB 4W80A 2M8RA 3AE3C 2OYHA 1R5LA 5GTHE 1MV8A 1L0LG 2BEZF 2K9YA 1AFOA 5GQQA 1EZVD 3GF3A 4XA4A 4PJ0E 1BE3J 5AVRB 2KXPB 4OH8B 2ZHHA 3L73E 1SQXE 4D6TG 3D6YA 1IFJA 1ZLLA 2FKWB 2AEFA 3EZ6A 3MP7B 1HTLC 1FZFA 1OZHA 5B66H 2JDIH 3WU2H 5AVXB 3CCMP 2C0WA 2QRXA 1NHLA 3B5ND 2RKLA 3IR9A 2A45I 3BCCE 2IBZE 3L73D 1D7MA 3HE5B 5H2FE 3AEGC 3WUTA 1FZCA 5CBOA 5CCGA 2JR8A 1MUUA 5GTHH 3FWNA 2YO2A 1YJWP 1PIXA 1H8AA 5AVQB 3F89A 2GM4A 1CI6B 3UIAA 1NTZJ 2JP3A 3BCCD 1QL2A 4ZMDA 1KB9I 3GMAA 1SQXJ 4RO0A 4ASVA 3B5NA 3JSVC 1G2CB 4AYZB 1R5SA 4ZKUA 2PGDA 3CPWO 4WB4A 2HPCA 1KN7A 3L71E 2B87B 1X8YA 1T8ZA 4RKUJ 4U7JA 1H0TA 3G6EP 4H44D 2ZXEB 2KNCA 5AW4B 1J1DC 3SWYA 1FS0E 2OYIC 1N7SA 5M1BA 1SQQE 2FY8A 2VRSA 1YITP 3CCLP 3AEBC 3CCJP 3T97A 5TJHA 5AW0B 2R5DA 3A0HH 3EFFK 3M0DC 3H1HJ 4JQ0D 1EZVG 4H0LD 3G71P 2KIKA 3L37A 1SQQD 3E1IA 1VQ9P 2P7JA 5D90A 3H1JD 3CX5H 2V4HA 2O1JA 3L71J 4DCZA 1PZQA 3M0AA 3V4WA 3P8MC 3B5NB 1DX7A 1S5LX 2B89A 5TISE 3E0HA 1LTSC 4J2NA 3K5BA 4NPEA 1GW3A 3HUSA 3H6PA 3L73G 3G4SP 4HKZH 3RK2D 1SQXG 3P8CE 1SFCD 2KNCB 1OIPA 2ZYDA 3A0BE 1PP9E 5L8RJ 4BWNA 1Q08A 1GW4A 3BCCG 2IBZG 1SQPD 2E5TA 3V4QA 3PP5A 3KPEA 1YIJP 3P8CD 1HVVA 2A06E 1SP4A 2O01N 4L73A 1IJDB 5TISH 3S9OA 4H13D 4H44B 4H0LC 1SFCA 1ZXGA 2WPSA 4W7ZA 2KZJA 3AEDC 1LJ2A 3TSIA 1ZV8A 5AVYB 1LWUC 1VF5C 2KS1B 2WSEJ 1BOWA 1JY3N 2WSEH 4GT1A 4YXDC 5KAFH 3CC7P 2K9JA 3CCSP 1OW7A 3HH0A 3H1IE 3HUSB 1EC5A 2JO1A 1G1JA 4I7ZC 3VMAA 2AXCA 2O3JA 3L71G 4H0LB 1JCDA 2WQYC 3LW5J 1SQBD 2LXBA 2NPSC 3TGUJ 1IK9A 1KB9E 3L74E 5KLVE 5KJ7A 3RK2C 1NAYA 1JMMA 1VQOP 2W27A 1SQQG 3TK1A 3SSUA 3H1ID 5D8CA 1NTKE 4LC1A 2KSJA 1W2EA 4GDOA 1HH0A 1OFCX 3AEEC 1IO4A 1OW6A 1Q81Q 1KB9D 3L74D 5KLVD 5I41B 3I5CA 1W2BO 1BCCD 3V2PA 1SLQA 2CPBA 4UB8H 3RK2B 2HODA 4DOJA 4EI2A 3BRVB 1SFCB 1NTKD 3S1KA 2Z5IA 5E01A 4GKGA 5APTA 4H13C 1MZ9A 1GZLA 3SFDC 4WY4A 1BDCA 2K9JB 1PFIA 1U7JA 1N73B 1GL2D 2MJZA 1EXJA 1G1IA 1RH6A 2PFXA 5E79E 1JOCA 2ZVNB 1S9KE 3EQ2A 1HJBA 3MTUE 4H13B 2Q3IA 3KZIE 3HD7D 4AUWA 1VQ6P 3JC22 5CJ4A 1PP9G 2KLVA 4QMAA 5AVUB 3FXDA 1S5LH 2L91A 3RL0g 1T6AA 1GL2A 1L0LD 1FJKA 1PL5A 1KQSO 3O6QA 3CLQA 4M3LA 3EZ2A 2HODB 1X22A 1MFTA 2A06G 1H88A 3SWFA 1H89A 3B8EB 2A45G 3R8JA 3V2RA 4BRYB 1RHZB 3P32A 1FZGA 2QM8A 5E79H 1RE3A 1LX8A 2C9NY 2L5GB 3V2NA 4GIFA 3FXEA 1USEA 1SQPK 3BASA 3RBZA 5AVTB 3CX5I 3H1IG 3KZIH 3GHGB 1VQ4P 3P7KA 2YMYA 2Q6QA 5KKZC 1LT1A 2YXRB 2J58A 1E79H 3HE4A 3AE9C 3L74G 1JCCA 5KLVG 2JEEA 4GOFA 1IFIA 3H1LE 1L4AD 1SQVE 3GP4A 2E43A 1FOSF 3HD7C 1NTKG 5KAIH 4L74A 4R4LA 1GL2B 2IYPA 2WSFJ 4NPFX 1Y47A 2WSFH 3O6QB 3SWKA 5KKZB 1BE3E 3W67A 4N3YB 3M9HA 1SQBK 1OWAA 4L75A 2WITA 2O01J 3G3ZA 1PGPA 5CCHA 1RF1A 2O01H 2YMKA 4ZKPA 5AW2B 1Z56A 3L75J 1NTMK 1IC2A 4XE5B 1HGZA 5B66E 3OAKA 1DEBA 2WPQA 1KV4A 1BE3D 3LIEA 2R3CA 2KUBA 2XNDH 4IFMA 3PH0A 1JYHA 2IEFA 2FYUE 3H1LJ 2QA4P 1GD2E 1NU1E 2ZXXA 1SQVJ 1W5CE 4C7RA 4C46A 1LNQA 3HE4B 2W6BA 1KORA 1RY3A 1TU3F 1HF9A 1AQ5A 3CMEP 1BDDA 1A02J 2GUSA 3Q5PA 5AW8B 1NTZE 5KAVA 5CCGD 4MN4C 3V5BA 3AE2C 2RN0A 2AXTH
chains in the Genus database with same CATH topology
2GOVA 2VZ4A 2H88C 2WSEJ 3ABVC 3GPVA 1GMJA 1K04A 1DD3A 1BOWA 3G9RA 3D71A 1UIXA 1VF5B 3GLMA 2HVAA 2FXPA 4YXDC 3AEGC 2ZT9C 1NGMB 3GK6A 1S1CX 3GP4A 5D90A 3AE5C 1OW7A 4H13B 3HH0A 3Q1MA 2ZHGA 2ZT9B 4DCZA 1PIXA 1ZRTE 2MKVA 2ZT9D 2IDBA 2JO1A 3AE8C 4R4LA 3SFEC 1DIPA 4I7ZC 2BOWA 2WSFJ 4R22B 1KILE 1S5LX 2E76C 4H0LB 1AJYA 3E0HA 3Q5SA 3QAOA 2QJKC 4I7ZB 2E75B 2WQYC 3LW5J 1KQFB 4J2NA 1EXIA 1KQGB 2JP3A 3EWKA 4PV1D 1Q05A 3Q2YA 2FBWC 2E76D 2DG6A 1RQVA 3UCSA 1R8EA 4WLSA 1K05A 2G8YA 3RK3E 3C8VA 3RL0g 2P10A 2D2CC 5KAXA 2O01J 1R8DA 3AECC 3GMAA 4R4EA 3Q3DA 1Q90D 4AYZA 1Y6UA 1OW8A 2YMKA 5KCBA 1PL5A 1JBGA 2BEQD 1RQUA 2D2CD 3O6QA 5KAUA 1JB0J 4AYZB 2OG0A 5D8CA 4PV1C 3EZ2A 3LURA 2E74C 3AE3C 1ZP0C 1YQ4C 4PV1B 4GDOA 2KCUA 1NYHA 2E76B 2WSCJ 2BEZF 3AEEC 3AE7C 1OW6A 2K9YA 2E74D 5GQQA 2WPVB 3GF3A 3R8JA 4U7JA 4RKUJ 4R24B 5I41B 5L8RJ 3GF7A 3R4YA 1VL2A 3B71A 2IEFA 2QJPC 1Q08A 4H44D 1JYHA 1PM6A 3AE6C 2KVVA 3EZ9A 1LX8A 3EZFA 2ZHHA 3Q5RA 2D2CB 2FYNC 1ZMEC 3B49A 1Q0AA 1IK7A 1FDIA 3FGAD 3AE1C 5M1BA 1KTMA 3D70A 4OGQD 5KAWA 4A1MA 1FDOA 2OQQA 3AEAC 1MKMA 3D6YA 1DD4A 3AEBC 4IL6X 4LHFA 2G3AA 2J5UA 2NZ2A 1KMIZ 1Q07A 1YQ3C 5E01A 1PV3A 4YTPC 2E74B 2V7QJ 3EZ6A 1KORA 1Q09A 1VF5D 4H13C 3EZ7A 1HJ0A 3IN6A 4H44C 5KATA 4B0YA 5KLIC 3T97B 3H25A 1TU3F 1D5YA 1HF9A 1ZOYC 3SFDC 3S9OA 1WMKA 4H13D 4H44B 1OMIA 3Q5PA 4H0LC 3IAOA 3AE4C 2H89C 1Q06A 2QIWA 3D6ZA 2YIUC 4OGQC 4TT3H 1Y9BA 4R4MA 4Y28J 2E75C 5KKZC 5KAVA 1EXJA 2QJYC 2JMLA 4Z1MH 3AEDC 1U57A 4KT0J 3AE2C 3AE9C 3AEFC 4XFJA 2QSIA 4OGQB 3R8KA 1RH6A 4H0LD 5I44A 4WLWA 1VF5C 2E75D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOV A;  2VZ4 A;  2J5U A;  4J2N A;  1EXI A;  3GPV A;  1Q07 A;  1Q05 A;  2KCU A;  5E01 A;  3Q2Y A;  1BOW A;  3G9R A;  3D71 A;  2DG6 A;  2HVA A;  5GQQ A;  3UCS A;  1Q09 A;  1R8E A;  4WLS A;  5KAT A;  4B0Y A;  3GK6 A;  3T97 B;  5KAX A;  3R8J A;  3GP4 A;  4R24 B;  5I41 B;  1D5Y A;  5D90 A;  1R8D A;  4AYZ A;  4R4E A;  3Q3D A;  1JYH A;  3HH0 A;  1Q08 A;  2ZHG A;  3Q1M A;  3IAO A;  3Q5P A;  5KCB A;  1Q06 A;  3D6Z A;  1JBG A;  4R4M A;  4R4L A;  5KAU A;  2ZHH A;  3Q5R A;  1DIP A;  1EXJ A;  5KAV A;  2BOW A;  2JML A;  4AYZ B;  4R22 B;  3B49 A;  1Q0A A;  5D8C A;  5KAW A;  3D70 A;  3LUR A;  3R8K A;  4A1M A;  2OQQ A;  5I44 A;  3E0H A;  4WLW A;  3Q5S A;  3QAO A;  3D6Y A; 
#chains in the Genus database with same CATH topology
 3ABV C;  1X79 B;  3GPV A;  3VMZ A;  4TLF A;  2Q7C A;  1X0T A;  1T2K C;  3FWL A;  2HVA A;  4LLH A;  2QG4 A;  3L35 A;  1AA0 A;  2YKQ A;  2RMZ A;  3C9I A;  1LTT C;  2P2U A;  2OYH C;  3QAO A;  2QJK C;  2FYU J;  1EXI A;  1IFN A;  1NO4 A;  2E76 D;  1SQX D;  1L4A B;  1NU1 J;  3VTP C;  3MUD A;  1VQL P;  3AEC C;  3IFM A;  2W90 A;  3L72 E;  2I1K A;  2WPR A;  1EDL A;  4Y99 C;  2YO3 A;  1LTI C;  2Q3E A;  3A0H E;  2Q9I A;  1L0L K;  5APQ A;  4IL6 E;  3RGU A;  1ZP0 C;  1M1K Q;  2KCU A;  1NYH A;  1N7S D;  2IBZ D;  1YBK A;  2OYH B;  1NKZ B;  2QJK B;  3H1H E;  1N8R Q;  1URQ A;  3TF5 A;  1VQN P;  2KLU A;  2HR3 A;  2FYN C;  3H1L G;  2Y0C A;  3CX5 E;  4Y99 B;  2UWJ E;  1SQV G;  1QLE D;  2WVR A;  4PD4 E;  1FZC C;  1LTJ A;  2KZI A;  5CCG C;  1M1J A;  3H1H D;  1ZOY C;  3FX0 A;  3CWB J;  1LTA C;  4R4M A;  1BE3 G;  1U57 A;  3A2A A;  4WLW A;  3L72 J;  2FYN B;  1FAV A;  1QEX A;  3CX5 D;  3CXH E;  2Y9Y A;  1X9V A;  2E42 A;  1M8O B;  3L71 D;  2KSE A;  1NWQ A;  3B5N C;  4CPG A;  4IL6 H;  1FZC B;  2E76 C;  1U7M A;  3CD6 P;  1KQF B;  4JPZ B;  3GG2 A;  5KTB A;  4PV1 D;  1NH4 A;  2FYU G;  1QVG O;  5KAX A;  4R4E A;  1Q90 D;  1NU1 G;  2OTJ P;  1P84 H;  2R5B A;  1GK4 A;  1AV1 A;  2YKP A;  4PD4 H;  2OG0 A;  2FYZ A;  3PTZ A;  1N7S C;  3TNU A;  5B5E E;  2E76 B;  2P1J A;  5AW5 B;  2LXC B;  1NTZ G;  2HPC B;  3GF7 A;  3R4Y A;  1VQ5 P;  1AVY A;  3CI9 A;  3NXS A;  3EZF A;  1ZME C;  1M1J B;  1H0T B;  5KAF E;  1L0N E;  4EOT A;  2Z5H A;  3CXH H;  5KAW A;  1MFZ A;  2ITA A;  3AEA C;  3BRT B;  2J5U A;  2H43 A;  1N7S B;  4HH2 A;  1YTZ I;  3L70 E;  2JWD A;  3CCR P;  4H44 C;  5KLI C;  3T97 B;  1BSN A;  2R32 A;  5CMZ A;  1Q06 A;  3D6Z A;  1T3J A;  2YIU C;  4Y28 J;  3TGU E;  1E5W A;  2OTK E;  2IZ0 A;  1BGY J;  2BCC J;  2ZYA A;  3L72 G;  5BU8 B;  3HUS C;  4JBZ A;  5KJ7 D;  1PP9 D;  2K1A A;  5B5E H;  2ZT9 B;  5KLI B;  1WT6 A;  3SFE C;  2K88 A;  1Q82 Q;  1N86 A;  3TGU D;  2KI7 B;  1AJY A;  2YIU B;  1SS1 A;  3H1H G;  2PAJ A;  2Z4E A;  3JCU E;  3E1R A;  4UB8 E;  1Q05 A;  2O1K A;  2SPZ A;  3CCE P;  1HWT C;  1L0N J;  3UCS A;  3RK3 E;  2G8Y A;  2P10 A;  1KYO H;  1OVV A;  2XKM A;  2QEX P;  1SVF A;  1SQX K;  2K3R A;  2AEM A;  2DW3 A;  2A06 D;  1YTZ T;  1QVF O;  2D2C D;  3L70 J;  2KOG A;  2WTY A;  3I55 P;  1LT9 A;  3MZW B;  4L76 A;  1SQP J;  3USS A;  3CC4 P;  1QL1 A;  4PV1 B;  1L2P A;  3LW5 H;  5BU5 A;  1N7L A;  4ZNC A;  4K3A A;  1QX8 A;  3RK3 D;  1SFC C;  1KIL A;  4WVZ A;  1VQP P;  1OX3 A;  4U3F E;  1IK7 A;  1JO5 A;  4WY4 D;  4JF7 A;  4A1M A;  1IZN B;  3KDP B;  1PV3 A;  1J1E B;  4HJG H;  1NVO A;  2WSS H;  2ZFC A;  1N73 C;  2WZ7 A;  2M3B A;  3PRJ A;  5GTI H;  4GOD A;  3JCU H;  1S5L E;  3AEF C;  2HYN A;  1LTB C;  1S3J A;  2YKO A;  1S2E A;  1JTH A;  1GMJ A;  5APU A;  5KJ7 C;  4RES B;  1NGM B;  3BVH A;  3AE5 C;  5AW3 B;  2ZHG A;  1ZRT E;  3AE8 C;  3HRN A;  2JWA A;  1NTM J;  1LTG C;  1K9M Q;  1ZR4 A;  4JYC A;  1RQV A;  3U1C A;  4U3F J;  1SQQ K;  2D2C C;  1L0N G;  3QWO C;  1KFM A;  1N2D C;  1OVU A;  1KQL A;  3PLN A;  3VMX A;  1ZRT D;  3L70 G;  4A7P A;  4C7N A;  3AE7 C;  3M06 A;  1S9K D;  3TGU G;  1RF0 A;  2M5A A;  3AE6 C;  3EZ9 A;  2D2C B;  1IFP A;  3E7K A;  1Q7Y Q;  1FZA A;  1Q0A A;  1FDI A;  2LKM A;  3D70 A;  4OGQ D;  1FDO A;  5KAI E;  1YJN P;  1FDM A;  3GHG C;  4DJG A;  2P67 A;  4YTP C;  2HG5 D;  1JTH B;  3H32 A;  3H1K J;  3II6 A;  2FFD A;  3RK3 B;  2B9B A;  4EYY Q;  1OMI A;  4O9B A;  3IAO A;  4W7Y A;  2QJY C;  4WY4 B;  2FXO A;  4ASW A;  4UB6 E;  3CL3 D;  1FC2 C;  1KC8 Q;  1IFD A;  2IFM A;  1P84 I;  3RBX A;  1S1C X;  1PPJ E;  1GL2 C;  3L75 E;  4PD4 I;  2N1T D;  1EDK A;  3MHV A;  4JYB A;  4EDF A;  5CCH D;  2E5Y A;  1RE4 A;  3Q5S A;  2GUV A;  2QJY B;  1GU4 A;  2FBW C;  1NAF A;  2IPP A;  2OTL P;  1DH3 A;  1FZB A;  3OA7 A;  4U3F G;  3CXH I;  3ITK A;  3L75 D;  1RE3 C;  4D6T J;  2IYO A;  3L36 A;  1PGO A;  2AXT E;  2N1T A;  2K37 A;  3H1L D;  1SQV D;  4UB6 H;  3V6I A;  3FGA D;  2KB7 P;  2JJL A;  1KMI Z;  3N4X A;  3IN6 A;  3N7N A;  3F5H A;  3H1K G;  5KLV K;  4OVN F;  4TT3 H;  1Y9B A;  2IFN A;  1K73 Q;  1GK6 A;  2QSI A;  4OGQ B;  1DEE G;  2GOV A;  1KYO I;  1K04 A;  1DD3 A;  1NTK K;  2H7H A;  1JM0 A;  1KFN A;  5APV A;  5CCH C;  1S4X A;  1Q2N A;  3WMM 0;  1RF1 C;  1KD1 Q;  2W8Z A;  1M90 Q;  2HLO A;  2FYU D;  1M56 D;  5AVW B;  1L4A C;  3B4S A;  1LP1 A;  1NU1 D;  2B88 A;  4N6J A;  1KQG B;  3Q2Y A;  3M9B A;  2J59 M;  3C8V A;  1NJI Q;  1G2C A;  2C9L Y;  1R8D A;  4AYZ A;  2I1J A;  2W6A A;  5KCB A;  2N1T B;  1URQ D;  4BXL A;  3U59 A;  1RF1 B;  1NTZ D;  5APY A;  2B87 A;  3EFG A;  2GA1 A;  1YQ4 C;  3CWB E;  2E74 D;  3A7O A;  2OGU A;  2YNY A;  3BAT A;  1M57 D;  2LR2 A;  2H8P D;  4I2L C;  2WT7 A;  4LHF A;  1PPJ G;  3L75 G;  3EZ7 A;  3CWB D;  1JY2 O;  4K35 A;  4B0Y A;  3H25 A;  2BAS A;  1Y8A A;  1WMK A;  3WUV A;  2Y0E A;  1ZN5 A;  3L72 D;  5CHX A;  2QVA A;  2OYI A;  4PJ0 H;  1P84 E;  2H88 C;  1FE6 A;  4DCK A;  1UIX A;  3L73 J;  1LP1 B;  3KQG A;  3MUD C;  3NMD A;  3M0D A;  4B86 A;  3R2P A;  2ZT9 D;  2FXM A;  2IDB A;  1YYC A;  1A02 F;  1EDJ A;  1P84 D;  1K05 A;  3A5T A;  3BCC J;  4PD4 D;  1OXZ A;  1URQ C;  5DJT B;  1JBG A;  1JY2 N;  5H2F H;  3GW6 A;  1VQ8 P;  4YXW H;  5AVV B;  2E74 C;  4I1L A;  3M9Q A;  2WT7 B;  3H1J E;  1LTJ C;  3LID A;  2PRR A;  1M1J C;  3CXH D;  2N9Y B;  2QJP C;  1BGY E;  2BCC E;  3HTK A;  1URQ B;  3M91 A;  1SQV K;  2C0X A;  3AE1 C;  1ZR2 A;  2NZ2 A;  5AW6 B;  1J1D B;  2OYI B;  3VN0 A;  5AVZ B;  2E74 B;  1VF5 D;  1Q09 A;  1HBW A;  5C39 A;  4AYC A;  5BVZ A;  3AE4 C;  1LTJ B;  2KS1 A;  1IFM A;  1BGY D;  1KYO E;  2BCC D;  4HYT B;  3CCV P;  2POH A;  2QJP B;  5I44 A;  3G9R A;  4YPC A;  3D71 A;  3VP9 A;  1OVR A;  1SQQ J;  2ZT9 C;  2NPS D;  2W6J H;  1JY2 P;  3KHU A;  1SQP E;  3Q1M A;  2IX7 C;  2WWW A;  2MKV A;  3QH9 A;  3H1J J;  1JY3 O;  3O8Z A;  1KIL E;  3CWB G;  1KYO D;  1LWU A;  1L0N D;  2FYU K;  4IFF A;  3WUU A;  2DG6 A;  1NU1 K;  1R8E A;  4WLS A;  1GTW A;  2OYO A;  1KZU B;  3L70 D;  1HGV A;  1RQU A;  1JB0 J;  1NOH A;  1WRG A;  4PV1 C;  3L4F A;  2Y9Z A;  1CSB A;  1VQM P;  1KIL D;  3HTK B;  5GTI E;  3RL0 D;  1NTZ K;  2NPS A;  1EQ7 A;  2WSC J;  3TNU B;  2XZR A;  4WBA A;  2WSC H;  4R24 B;  1VQK P;  1RH5 B;  1VL2 A;  2NRG A;  2KVV A;  3Q5R A;  2R3S A;  5AW1 B;  1SQB E;  3U1A A;  3ZDM A;  2W83 C;  1J1E C;  1PGQ A;  4DZO A;  4OWF A;  1Q07 A;  3VYI A;  2R44 A;  1VDF A;  2V7Q J;  1N73 A;  2V7Q H;  2ZJS E;  1JEK A;  1NTM E;  2H89 C;  1PP9 J;  4Z1M H;  3A0B H;  1BSH A;  3R8K A;  1LWU B;  1VF5 B;  4IOI H;  3I56 P;  1BCC E;  3MD0 A;  1FOS E;  2KK7 A;  1YJ9 P;  1LGH B;  1NTM D;  3NTN A;  2WMM A;  1LT9 C;  5DJU B;  3H1J G;  4I7Z B;  4U3F D;  2A45 H;  1J2J B;  1FZE A;  2I8D A;  1Q86 Q;  1SQB J;  1BGY G;  2BCC G;  2NPS B;  2N9B A;  1EZV I;  3Q3D A;  2Q1K A;  3VMY A;  3IF4 A;  1OW8 A;  3CCQ P;  3C1L A;  1NKN A;  1KIL C;  2BEQ D;  1ZW0 A;  5KAU A;  3RL0 C;  3LUR A;  4N78 E;  1JY3 P;  3W68 A;  3H1K E;  1GDT A;  3H1I J;  5EFW B;  4BRY A;  3VP8 A;  5CBN A;  1LT9 B;  2WPV B;  2ZVO B;  3L74 J;  3V2Q A;  3B71 A;  4RJT A;  5KLV J;  1PM6 A;  1KB9 H;  1EDI A;  1BCC J;  2JKV A;  3B49 A;  4I6M C;  3PHL A;  3MGN A;  1KIL B;  3A3Y B;  3GHG A;  2G3A A;  2Q5U A;  4N78 D;  3RL0 B;  3H1K D;  3KYQ A;  1JMB A;  1QGK B;  3RK3 C;  1SQP G;  1NTK J;  2XU6 A;  5KAT A;  4KHX A;  5AW7 B;  1USD A;  1L0L E;  2QM7 A;  1D5Y A;  2ZYG A;  4WY4 C;  4KT0 J;  4XFJ A;  1FJP A;  2KYV A;  2E75 D;  2VZ4 A;  4HB1 A;  2IZ1 A;  2IBZ I;  3GLM A;  4D6T E;  2FXP A;  3KXD A;  4WWI A;  1DIP A;  2BOW A;  3TDK A;  4NPD A;  1JUN A;  4LGD E;  2OAR A;  1L0N K;  1VPC A;  3NFQ A;  4D6T D;  5APS A;  3HD7 A;  1RF0 C;  1SQB G;  1CZQ A;  5K5G B;  2HFE D;  2Y0D A;  1UII A;  4KJM A;  3CCU P;  1XTC C;  1L0L J;  1PGJ A;  1S72 P;  1FBM A;  1AQT A;  1NTM G;  2M0B A;  3PJS K;  2M3E A;  3OW2 O;  2ZAE B;  2FFD C;  4C7N B;  2XNX A;  4DT0 A;  2RH0 A;  2PP6 A;  1PPJ D;  1K8A Q;  1KTM A;  2M5A B;  2OQQ A;  1MKM A;  2AEJ A;  1DD4 A;  4IL6 X;  1BCC G;  1YQ3 C;  1T3U A;  5APX A;  3S4R A;  1HJ0 A;  1T2K D;  2CK3 H;  3CMA P;  1M7L A;  3MIW A;  3H32 B;  2QIW A;  4OGQ C;  2XV5 A;  2E75 C;  2FFD B;  1VQ7 P;  2JML A;  4GOE A;  1RE4 C;  3VOP A;  2P58 A;  2XDJ A;  2KP8 A;  5APW A;  1AVO A;  1YI2 P;  5CJ0 A;  3GK6 A;  3TYY A;  1CW5 A;  4AQR D;  3CC2 P;  3OJA B;  4IFD K;  3HD7 B;  1XTG B;  2QE7 H;  4R22 B;  3HE5 A;  1L4A A;  1FU1 A;  1GU5 A;  2E75 B;  3WU2 E;  2CPS A;  5AW9 B;  3EWK A;  1JNM A;  1EZV E;  5AVS B;  1HUC A;  2N1T C;  1Y6U A;  1YHQ P;  4EIJ A;  1CI6 A;  2YXQ B;  4W80 A;  2M8R A;  3AE3 C;  2OYH A;  1R5L A;  5GTH E;  1MV8 A;  1L0L G;  2BEZ F;  2K9Y A;  1AFO A;  5GQQ A;  1EZV D;  3GF3 A;  4XA4 A;  4PJ0 E;  1BE3 J;  5AVR B;  2KXP B;  4OH8 B;  2ZHH A;  3L73 E;  1SQX E;  4D6T G;  3D6Y A;  1IFJ A;  1ZLL A;  2FKW B;  2AEF A;  3EZ6 A;  3MP7 B;  1HTL C;  1FZF A;  1OZH A;  5B66 H;  2JDI H;  3WU2 H;  5AVX B;  3CCM P;  2C0W A;  2QRX A;  1NHL A;  3B5N D;  2RKL A;  3IR9 A;  2A45 I;  3BCC E;  2IBZ E;  3L73 D;  1D7M A;  3HE5 B;  5H2F E;  3AEG C;  3WUT A;  1FZC A;  5CBO A;  5CCG A;  2JR8 A;  1MUU A;  5GTH H;  3FWN A;  2YO2 A;  1YJW P;  1PIX A;  1H8A A;  5AVQ B;  3F89 A;  2GM4 A;  1CI6 B;  3UIA A;  1NTZ J;  2JP3 A;  3BCC D;  1QL2 A;  4ZMD A;  1KB9 I;  3GMA A;  1SQX J;  4RO0 A;  4ASV A;  3B5N A;  3JSV C;  1G2C B;  4AYZ B;  1R5S A;  4ZKU A;  2PGD A;  3CPW O;  4WB4 A;  2HPC A;  1KN7 A;  3L71 E;  2B87 B;  1X8Y A;  1T8Z A;  4RKU J;  4U7J A;  1H0T A;  3G6E P;  4H44 D;  2ZXE B;  2KNC A;  5AW4 B;  1J1D C;  3SWY A;  1FS0 E;  2OYI C;  1N7S A;  5M1B A;  1SQQ E;  2FY8 A;  2VRS A;  1YIT P;  3CCL P;  3AEB C;  3CCJ P;  3T97 A;  5TJH A;  5AW0 B;  2R5D A;  3A0H H;  3EFF K;  3M0D C;  3H1H J;  4JQ0 D;  1EZV G;  4H0L D;  3G71 P;  2KIK A;  3L37 A;  1SQQ D;  3E1I A;  1VQ9 P;  2P7J A;  5D90 A;  3H1J D;  3CX5 H;  2V4H A;  2O1J A;  3L71 J;  4DCZ A;  1PZQ A;  3M0A A;  3V4W A;  3P8M C;  3B5N B;  1DX7 A;  1S5L X;  2B89 A;  5TIS E;  3E0H A;  1LTS C;  4J2N A;  3K5B A;  4NPE A;  1GW3 A;  3HUS A;  3H6P A;  3L73 G;  3G4S P;  4HKZ H;  3RK2 D;  1SQX G;  3P8C E;  1SFC D;  2KNC B;  1OIP A;  2ZYD A;  3A0B E;  1PP9 E;  5L8R J;  4BWN A;  1Q08 A;  1GW4 A;  3BCC G;  2IBZ G;  1SQP D;  2E5T A;  3V4Q A;  3PP5 A;  3KPE A;  1YIJ P;  3P8C D;  1HVV A;  2A06 E;  1SP4 A;  2O01 N;  4L73 A;  1IJD B;  5TIS H;  3S9O A;  4H13 D;  4H44 B;  4H0L C;  1SFC A;  1ZXG A;  2WPS A;  4W7Z A;  2KZJ A;  3AED C;  1LJ2 A;  3TSI A;  1ZV8 A;  5AVY B;  1LWU C;  1VF5 C;  2KS1 B;  2WSE J;  1BOW A;  1JY3 N;  2WSE H;  4GT1 A;  4YXD C;  5KAF H;  3CC7 P;  2K9J A;  3CCS P;  1OW7 A;  3HH0 A;  3H1I E;  3HUS B;  1EC5 A;  2JO1 A;  1G1J A;  4I7Z C;  3VMA A;  2AXC A;  2O3J A;  3L71 G;  4H0L B;  1JCD A;  2WQY C;  3LW5 J;  1SQB D;  2LXB A;  2NPS C;  3TGU J;  1IK9 A;  1KB9 E;  3L74 E;  5KLV E;  5KJ7 A;  3RK2 C;  1NAY A;  1JMM A;  1VQO P;  2W27 A;  1SQQ G;  3TK1 A;  3SSU A;  3H1I D;  5D8C A;  1NTK E;  4LC1 A;  2KSJ A;  1W2E A;  4GDO A;  1HH0 A;  1OFC X;  3AEE C;  1IO4 A;  1OW6 A;  1Q81 Q;  1KB9 D;  3L74 D;  5KLV D;  5I41 B;  3I5C A;  1W2B O;  1BCC D;  3V2P A;  1SLQ A;  2CPB A;  4UB8 H;  3RK2 B;  2HOD A;  4DOJ A;  4EI2 A;  3BRV B;  1SFC B;  1NTK D;  3S1K A;  2Z5I A;  5E01 A;  4GKG A;  5APT A;  4H13 C;  1MZ9 A;  1GZL A;  3SFD C;  4WY4 A;  1BDC A;  2K9J B;  1PFI A;  1U7J A;  1N73 B;  1GL2 D;  2MJZ A;  1EXJ A;  1G1I A;  1RH6 A;  2PFX A;  5E79 E;  1JOC A;  2ZVN B;  1S9K E;  3EQ2 A;  1HJB A;  3MTU E;  4H13 B;  2Q3I A;  3KZI E;  3HD7 D;  4AUW A;  1VQ6 P;  3JC2 2;  5CJ4 A;  1PP9 G;  2KLV A;  4QMA A;  5AVU B;  3FXD A;  1S5L H;  2L91 A;  3RL0 g;  1T6A A;  1GL2 A;  1L0L D;  1FJK A;  1PL5 A;  1KQS O;  3O6Q A;  3CLQ A;  4M3L A;  3EZ2 A;  2HOD B;  1X22 A;  1MFT A;  2A06 G;  1H88 A;  3SWF A;  1H89 A;  3B8E B;  2A45 G;  3R8J A;  3V2R A;  4BRY B;  1RHZ B;  3P32 A;  1FZG A;  2QM8 A;  5E79 H;  1RE3 A;  1LX8 A;  2C9N Y;  2L5G B;  3V2N A;  4GIF A;  3FXE A;  1USE A;  1SQP K;  3BAS A;  3RBZ A;  5AVT B;  3CX5 I;  3H1I G;  3KZI H;  3GHG B;  1VQ4 P;  3P7K A;  2YMY A;  2Q6Q A;  5KKZ C;  1LT1 A;  2YXR B;  2J58 A;  1E79 H;  3HE4 A;  3AE9 C;  3L74 G;  1JCC A;  5KLV G;  2JEE A;  4GOF A;  1IFI A;  3H1L E;  1L4A D;  1SQV E;  3GP4 A;  2E43 A;  1FOS F;  3HD7 C;  1NTK G;  5KAI H;  4L74 A;  4R4L A;  1GL2 B;  2IYP A;  2WSF J;  4NPF X;  1Y47 A;  2WSF H;  3O6Q B;  3SWK A;  5KKZ B;  1BE3 E;  3W67 A;  4N3Y B;  3M9H A;  1SQB K;  1OWA A;  4L75 A;  2WIT A;  2O01 J;  3G3Z A;  1PGP A;  5CCH A;  1RF1 A;  2O01 H;  2YMK A;  4ZKP A;  5AW2 B;  1Z56 A;  3L75 J;  1NTM K;  1IC2 A;  4XE5 B;  1HGZ A;  5B66 E;  3OAK A;  1DEB A;  2WPQ A;  1KV4 A;  1BE3 D;  3LIE A;  2R3C A;  2KUB A;  2XND H;  4IFM A;  3PH0 A;  1JYH A;  2IEF A;  2FYU E;  3H1L J;  2QA4 P;  1GD2 E;  1NU1 E;  2ZXX A;  1SQV J;  1W5C E;  4C7R A;  4C46 A;  1LNQ A;  3HE4 B;  2W6B A;  1KOR A;  1RY3 A;  1TU3 F;  1HF9 A;  1AQ5 A;  3CME P;  1BDD A;  1A02 J;  2GUS A;  3Q5P A;  5AW8 B;  1NTZ E;  5KAV A;  5CCG D;  4MN4 C;  3V5B A;  3AE2 C;  2RN0 A;  2AXT H; 
#chains in the Genus database with same CATH homology
 2GOV A;  2VZ4 A;  2H88 C;  2WSE J;  3ABV C;  3GPV A;  1GMJ A;  1K04 A;  1DD3 A;  1BOW A;  3G9R A;  3D71 A;  1UIX A;  1VF5 B;  3GLM A;  2HVA A;  2FXP A;  4YXD C;  3AEG C;  2ZT9 C;  1NGM B;  3GK6 A;  1S1C X;  3GP4 A;  5D90 A;  3AE5 C;  1OW7 A;  4H13 B;  3HH0 A;  3Q1M A;  2ZHG A;  2ZT9 B;  4DCZ A;  1PIX A;  1ZRT E;  2MKV A;  2ZT9 D;  2IDB A;  2JO1 A;  3AE8 C;  4R4L A;  3SFE C;  1DIP A;  4I7Z C;  2BOW A;  2WSF J;  4R22 B;  1KIL E;  1S5L X;  2E76 C;  4H0L B;  1AJY A;  3E0H A;  3Q5S A;  3QAO A;  2QJK C;  4I7Z B;  2E75 B;  2WQY C;  3LW5 J;  1KQF B;  4J2N A;  1EXI A;  1KQG B;  2JP3 A;  3EWK A;  4PV1 D;  1Q05 A;  3Q2Y A;  2FBW C;  2E76 D;  2DG6 A;  1RQV A;  3UCS A;  1R8E A;  4WLS A;  1K05 A;  2G8Y A;  3RK3 E;  3C8V A;  3RL0 g;  2P10 A;  2D2C C;  5KAX A;  2O01 J;  1R8D A;  3AEC C;  3GMA A;  4R4E A;  3Q3D A;  1Q90 D;  4AYZ A;  1Y6U A;  1OW8 A;  2YMK A;  5KCB A;  1PL5 A;  1JBG A;  2BEQ D;  1RQU A;  2D2C D;  3O6Q A;  5KAU A;  1JB0 J;  4AYZ B;  2OG0 A;  5D8C A;  4PV1 C;  3EZ2 A;  3LUR A;  2E74 C;  3AE3 C;  1ZP0 C;  1YQ4 C;  4PV1 B;  4GDO A;  2KCU A;  1NYH A;  2E76 B;  2WSC J;  2BEZ F;  3AEE C;  3AE7 C;  1OW6 A;  2K9Y A;  2E74 D;  5GQQ A;  2WPV B;  3GF3 A;  3R8J A;  4U7J A;  4RKU J;  4R24 B;  5I41 B;  5L8R J;  3GF7 A;  3R4Y A;  1VL2 A;  3B71 A;  2IEF A;  2QJP C;  1Q08 A;  4H44 D;  1JYH A;  1PM6 A;  3AE6 C;  2KVV A;  3EZ9 A;  1LX8 A;  3EZF A;  2ZHH A;  3Q5R A;  2D2C B;  2FYN C;  1ZME C;  3B49 A;  1Q0A A;  1IK7 A;  1FDI A;  3FGA D;  3AE1 C;  5M1B A;  1KTM A;  3D70 A;  4OGQ D;  5KAW A;  4A1M A;  1FDO A;  2OQQ A;  3AEA C;  1MKM A;  3D6Y A;  1DD4 A;  3AEB C;  4IL6 X;  4LHF A;  2G3A A;  2J5U A;  2NZ2 A;  1KMI Z;  1Q07 A;  1YQ3 C;  5E01 A;  1PV3 A;  4YTP C;  2E74 B;  2V7Q J;  3EZ6 A;  1KOR A;  1Q09 A;  1VF5 D;  4H13 C;  3EZ7 A;  1HJ0 A;  3IN6 A;  4H44 C;  5KAT A;  4B0Y A;  5KLI C;  3T97 B;  3H25 A;  1TU3 F;  1D5Y A;  1HF9 A;  1ZOY C;  3SFD C;  3S9O A;  1WMK A;  4H13 D;  4H44 B;  1OMI A;  3Q5P A;  4H0L C;  3IAO A;  3AE4 C;  2H89 C;  1Q06 A;  2QIW A;  3D6Z A;  2YIU C;  4OGQ C;  4TT3 H;  1Y9B A;  4R4M A;  4Y28 J;  2E75 C;  5KKZ C;  5KAV A;  1EXJ A;  2QJY C;  2JML A;  4Z1M H;  3AED C;  1U57 A;  4KT0 J;  3AE2 C;  3AE9 C;  3AEF C;  4XFJ A;  2QSI A;  4OGQ B;  3R8K A;  1RH6 A;  4H0L D;  5I44 A;  4WLW A;  1VF5 C;  2E75 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...