3D71A

Crystal structure of e253q bmrr bound to 22 base pair promoter site
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIRILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
total genus 78
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d71A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d71A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d71A03
1JBGA 5KAWA 5KAVA 3E0HA 5KATA 3QAOA 4R4MA 2JMLA 5E01A 2DG6A 1DIPA 4AYZB 1JYHA 2HVAA 3D71A 3R8KA 5D8CA 2GOVA 3LURA 5I41B 3IAOA 3Q5PA 1Q05A 3HH0A 1D5YA 4WLSA 3Q2YA 2BOWA 3Q3DA 2OQQA 3R8JA 1EXIA 2ZHHA 4R4LA 2KCUA 5KAXA 4R24B 3Q5RA 2J5UA 1Q06A 1EXJA 4B0YA 5I44A 3Q1MA 3GK6A 3D70A 1R8EA 3Q5SA 3GP4A 5GQQA 1R8DA 4WLWA 4AYZA 1Q08A 3D6ZA 4R22B 2ZHGA 3D6YA 3T97B 5D90A 3UCSA 1Q09A 4J2NA 4A1MA 1Q0AA 1BOWA 3B49A 5KAUA 5KCBA 1Q07A 3GPVA 4R4EA 2VZ4A 3G9RA
chains in the Genus database with same CATH superfamily
1U57A 4IL6H 1T2KC 1OW7A 4DZOA 4W7ZA 3L71J 5KAIE 3H1KJ 3V2QA 2OQQA 2N1TA 3CWBJ 2ZYGA 1TU3F 5BU5A 1SQQK 1S4XA 4HH2A 2R32A 1SQXE 2M5AB 1VQOP 1FZCC 3GG2A 5APVA 3SFEC 2ZT9B 2ZAEB 2NPSB 5KTBA 5DJTB 1ZR2A 3WUVA 2Y0DA 3H32A 1AA0A 2R5BA 1SQBK 4PD4D 3H1HD 1NTZE 1L0NG 1K8AQ 1AV1A 2YIUC 4C7NB 3H1LD 5KCBA 2ITAA 2VZ4A 1URQC 1OMIA 2V7QJ 2I1KA 4DOJA 1PV3A 5CCGD 1L0LD 1NTME 2H8PD 1W2EA 2XU6A 1E5WA 1JO5A 4BWNA 1VPCA 3L73D 5TJHA 2WT7A 3EZ6A 3TK1A 1KD1Q 1S2EA 3HD7A 1YQ3C 3QH9A 2CPBA 1KB9E 2WSCH 1KYOE 1URQA 1KZUB 4UB8H 1N7SC 2L5GB 4OVNF 3CD6P 4I7ZB 5AW3B 1EDKA 1L4AB 3RL0B 3UIAA 4A1MA 1HGZA 1FBMA 4PD4H 3AEDC 1HGVA 1L0ND 2Q3EA 1LTJC 3V5BA 3KZIH 3A0HH 1LTBC 1X9VA 4KHXA 1XTGB 1SQXJ 2N1TB 1T8ZA 3L74J 3IFMA 2O01H 2YO3A 2JP3A 4U3FD 3HD7D 3IAOA 5AVSB 2FY8A 3L71E 2A06E 1ZLLA 3B4SA 2KLVA 1MUUA 3PH0A 2NPSA 3EZ7A 1G2CB 1SQBG 3L75J 3UCSA 1AVOA 3U1CA 1UIXA 3G9RA 2AXTH 1NU1E 2P67A 1NTKE 3TGUD 3U59A 1RHZB 2ZVOB 1LTJA 5AW1B 4ZKUA 2D2CB 1Y6UA 1LWUA 3L70J 2WVRA 4MN4C 2LXBA 2Y0CA 5DJUB 4N78D 1DX7A 1PL5A 3AE6C 3L71D 4U3FE 4C46A 3CWBD 2FBWC 2L91A 1YJWP 3GF3A 3CCRP 2IX7C 1AJYA 3EFFK 1Q08A 3MUDC 3I55P 2KZJA 4K35A 4R4EA 4JQ0D 3TF5A 1FDIA 4ASVA 3Q5PA 2H88C 1X0TA 1P84D 3O6QB 5AVWB 4Y28J 1RE3C 1FZBA 1BDCA 5KLIB 2ZHGA 5CCHA 1QL1A 3B71A 1ZXGA 4PV1B 2HPCB 1IO4A 3GF7A 3AEBC 1YHQP 3M0DC 1VQLP 4AUWA 2XNDH 1HBWA 3A0BE 2HYNA 1SQBJ 2WPSA 3II6A 3NFQA 1USEA 2XZRA 1WRGA 4TT3H 1NTKK 1JB0J 4H44C 1KC8Q 3O6QA 2HR3A 2IBZG 3S9OA 2K88A 3KPEA 2KXPB 4GIFA 2QJYB 2OGUA 1N7SD 1PGJA 3L74E 1L0NJ 2IYOA 1SQPG 1BGYD 1K04A 1M1JC 3CCUP 2Q5UA 3H32B 1SQPK 3Q5RA 1CZQA 3VOPA 1A02J 1P84I 3E7KA 3RL0g 4BXLA 1LNQA 1LTAC 3VMYA 2YMKA 3V6IA 1RF0C 2QJKB 1HUCA 4GDOA 2E43A 1J2JB 3B5ND 1NAFA 2OTLP 5AW8B 3L71G 1RE4A 3L70E 1SQQG 1FAVA 2Q6QA 1X8YA 5AVZB 1FZFA 3H1KD 4EI2A 1FDOA 3K5BA 3PTZA 1EZVI 3R4YA 2HPCA 3L75G 3EZFA 1GL2B 1FJKA 1LJ2A 1SQPD 1KTMA 1JEKA 3PLNA 4HJGH 1MKMA 3L72D 2HODA 3SWYA 4OH8B 3H1JJ 4D6TE 2IZ0A 1T2KD 3H1HE 1N8RQ 4ASWA 1FC2C 4UB8E 5AW5B 3G3ZA 1DD4A 3R8KA 2W27A 2AEFA 3M9QA 2YXRB 4KT0J 1ZN5A 3OA7A 1QVFO 3FWLA 4IOIH 1M90Q 4Y99C 1G2CA 1M1KQ 2WTYA 4WY4B 2YIUB 1U7MA 2IBZD 5AVQB 1D7MA 1ZRTD 2FXMA 3LW5J 1KB9I 2J58A 2XV5A 1SQXK 2E75D 4H13D 2GUSA 1NTKD 3TGUE 3RK2D 1NU1D 4ZKPA 2KI7B 3C1LA 4GT1A 1AQTA 3FXDA 4C7RA 3EWKA 3B49A 3M9HA 2Y0EA 3RL0C 2B88A 2IEFA 1L0LG 2A45I 1LT9C 2QEXP 1IFIA 2WSFJ 5APTA 4AYCA 2ZT9D 1DEBA 3V2PA 1BE3J 5AVYB 2GUVA 3TNUB 1N7SA 2O1KA 3HUSA 4HB1A 2GOVA 4IFDK 1IFMA 5BVZA 2QSIA 2KSEA 4WY4D 4B86A 2O01N 4JYBA 3W68A 4A7PA 1LTGC 4UB6H 2ZHHA 4R4LA 3L72G 2ZYDA 1QX8A 2R3SA 1BGYE 4ZMDA 2C9LY 2Q3IA 2QRXA 1BE3E 3PP5A 1FS0E 1IK7A 2LR2A 2A06G 1J1DC 3V4QA 3TNUA 2JMLA 1N7SB 3S4RA 3CCSP 1S9KE 1GD2E 5KLVG 4YXDC 1SS1A 3H1KG 3R8JA 3KQGA 4U3FG 3GK6A 1SQPJ 1QEXA 2FYUD 2OYHB 4RJTA 3RGUA 1EZVE 2YNYA 2H89C 1N73C 1IK9A 1SQQJ 2QIWA 3H1IG 3A7OA 1L4AA 1M1JB 1T3UA 5APQA 5E79H 1FZCB 5APYA 1VF5D 1SQVG 1QVGO 5GQQA 3U1AA 1NTMJ 1K9MQ 1IZNB 3RK3B 2HG5D 2D2CC 2QJKC 3CCQP 1RH5B 1ZOYC 3CXHE 1KMIZ 3P7KA 1DD3A 1SQBD 1LT9A 4IL6E 1P84E 1SFCD 1VL2A 3CWBG 3L37A 3B5NC 2FYUK 2FYNC 1N73B 2N1TC 1NU1J 1HVVA 2YMYA 1E79H 2W83C 2QM7A 3CWBE 2W6AA 1K05A 3L4FA 3L75E 4R22B 3H1ID 3TDKA 5CBNA 3NMDA 2NPSD 1USDA 2E5TA 5APWA 2XKMA 1MZ9A 1YYCA 4I6MC 1L4AC 5H2FH 1XTCC 3Q1MA 3H1IE 1BE3D 1PZQA 3WUUA 1ZR4A 4XE5B 1ZW0A 2E76D 1Y9BA 1DH3A 3JCUH 4WLSA 4Y99B 2Y9YA 4H44B 4U7JA 3AECC 1FZCA 1BOWA 2IFNA 3BATA 3VN0A 3D70A 1R5SA 1FZEA 1H0TB 5KLVJ 3EFGA 5AW6B 2K9YA 1JNMA 2JEEA 3SFDC 1M1JA 2N1TD 3KZIE 1NOHA 3C8VA 3OJAB 3H25A 2ZXEB 1CI6A 1L4AD 2WSEH 2E75B 4GKGA 4LC1A 4LLHA 2FFDA 5AW9B 3L72J 2WITA 3CX5H 3AE8C 4NPDA 3AEFC 3L70G 3CCEP 1CW5A 1R5LA 3AE4C 3H1JD 2NPSC 3LURA 1S1CX 1PP9E 1KFMA 3MHVA 1EXIA 2WSCJ 2JWAA 4YXWH 5D90A 1G1JA 2H43A 1SQQD 2IYPA 2MKVA 3HTKA 3P8MC 4OGQC 1ZRTE 1PPJD 1S3JA 3CPWO 1AFOA 1YJNP 3EQ2A 5KLVE 3ABVC 2B89A 3GHGB 1X22A 2O3JA 5AVTB 1NVOA 1NYHA 1NTKJ 3A0BH 4H0LB 1VQ8P 1SQVK 2KIKA 2P7JA 2P58A 2YO2A 3GW6A 1LTSC 2E76C 3IF4A 2J59M 1OW8A 2WWWA 1VDFA 2FFDC 3VP9A 1DIPA 4LHFA 4QMAA 4L76A 1KYOI 3H1IJ 4WY4A 1SQPE 1IFDA 3AE2C 1KV4A 2M5AA 1VQPP 2A45H 1NU1G 1KB9H 4WY4C 3VMZA 3H1KE 2BEZF 1VQNP 2CPSA 3AE3C 2K3RA 2OYIA 4WLWA 2E42A 2QVAA 2QJPB 5AVXB 4H13B 1BE3G 3AEGC 4BRYB 1GW4A 2KS1B 3RK3D 1NTMK 2WT7B 2P2UA 1SQVJ 5KKZB 2W6BA 1JUNA 1PM6A 2RH0A 1Q82Q 3Q3DA 1FE6A 2BEQD 2C0XA 2WPRA 1YBKA 2PFXA 1NTZJ 5GTHH 5CCGC 1OIPA 2B9BA 1JY3P 3HRNA 4JPZB 4WBAA 5KLVD 1GU4A 2OARA 2OG0A 1ZMEC 5KAVA 4R4MA 4EOTA 1PGOA 1NTKG 2OYHA 1HWTC 2P1JA 3F89A 3V4WA 1K73Q 1LT1A 3LIDA 2FYUJ 1EXJA 1HF9A 1URQB 1H88A 5AVUB 2OYHC 1QGKB 3GMAA 1KQLA 5GTHE 1JCCA 3GPVA 2FKWB 1BDDA 3QAOA 3A0HE 1SQVE 2HVAA 3L73E 2ZVNB 2RKLA 1NTMD 4DJGA 1L0LE 1IFNA 1EZVD 1AVYA 1EC5A 1RQVA 1KQFB 5B5EH 1GMJA 1M7LA 3NTNA 2AEJA 2WSFH 2M3BA 2QE7H 2VRSA 1OWAA 2PAJA 1PP9D 2PGDA 1LGHB 3KDPB 4D6TJ 5KLIC 3D6YA 4K3AA 1QL2A 2QM8A 3AE5C 2OYOA 4C7NA 2IPPA 1VQ9P 2YKQA 1NWQA 1KN7A 2JDIH 1Y47A 2IZ1A 1L2PA 2KB7P 3FGAD 1T3JA 5M1BA 1NJIQ 1IJDB 2FXOA 2W6JH 1OZHA 1JM0A 4IFFA 4YPCA 2K9JA 2FYNB 1KFNA 2M3EA 1J1DB 5CMZA 4JBZA 2YKOA 1S5LE 3JCUE 1KB9D 4HYTB 1JMMA 2YXQB 3WU2E 1T6AA 2KNCA 1OFCX 1OW6A 5KAFH 4HKZH 3RK2B 3O8ZA 2WSEJ 1SFCA 5I41B 2ZYAA 1NHLA 1Q2NA 2LKMA 2C0WA 4RKUJ 3M0AA 2Z5IA 4H13C 2PRRA 5CJ4A 1JTHA 2YKPA 2JJLA 2IBZE 3N7NA 1SLQA 2I8DA 1SQVD 2AEMA 2QJYC 3FX0A 2QG4A 2B87A 3H1LE 1NTMG 5B66H 3PJSK 5AW7B 3I56P 1NTZD 3TYYA 5KJ7C 2N9BA 5KAXA 2E74B 1MV8A 5GTIH 2KUBA 4H0LD 3AEEC 3P32A 2JR8A 3AE7C 5AW2B 1L0NE 2PP6A 1CSBA 1GDTA 1BCCE 2K37A 5KJ7A 1SQBE 2G8YA 3EZ2A 1NAYA 3B8EB 3W67A 3MTUE 2ZFCA 1LWUB 4IL6X 1BGYG 1KILC 5K5GB 2AXTE 1OX3A 1KILE 3H1HG 2HFED 3BCCG 4H44D 1OVUA 3E0HA 1YITP 1LTJB 1NU1K 1SQQE 3SSUA 3Q2YA 3LW5H 4R24B 1RF0A 1Q06A 3AE1C 1NKZB 1M57D 1NTZK 2OYIB 4I7ZC 1BCCG 1JCDA 2MJZA 1FU1A 1J1EC 2RN0A 1FJPA 2KNCB 4IFMA 2JWDA 1IC2A 5H2FE 3AEAC 1HJBA 3WUTA 5I44A 1NKNA 1JY2N 5KLVK 1ZV8A 1N73A 4PD4E 2K1AA 3BRTB 4EIJA 2DG6A 3G6EP 5D8CA 1GZLA 1SP4A 4B0YA 3BCCD 2B87B 4D6TG 5B66E 2NZ2A 2KYVA 4PJ0H 2E74C 4O9BA 1RH6A 4I2LC 1NO4A 4DCZA 1RF1C 2H7HA 2HODB 3IR9A 1FOSE 4JYCA 4W7YA 3VTPC 2OTKE 3RK3E 3CCVP 1VF5B 4M3LA 1LT9B 1VQ7P 3HD7C 2Z4EA 1N7LA 3CMAP 1PPJE 3WMM0 5APSA 1IFPA 3CXHH 4DCKA 1VQKP 1KORA 3P8CD 1VQ6P 1NGMB 1GTWA 3EZ9A 1GL2C 5E01A 1M56D 2BCCD 1M8OB 3HE4B 3HTKB 1Q86Q 5E79E 3NXSA 3HUSC 4H0LC 4N3YB 3E1IA 3CI9A 4NPEA 2QJPC 2HLOA 3IN6A 3FXEA 4Z1MH 2OTJP 4I1LA 1RE4C 3MIWA 3GHGA 2FFDB 2Z5HA 4OGQB 3H1LG 3BVHA 3L74G 5GTIE 4PV1C 1KYOH 4JF7A 3V2NA 1PIXA 1RE3A 3GHGC 2KLUA 1SQXG 2O01J 3CCMP 3HD7B 1LX8A 5CJ0A 1U7JA 4J2NA 2QA4P 3L72E 5KAUA 2RMZA 5TISE 3PRJA 2E76B 2R3CA 1Q90D 2O1JA 2Y9ZA 3HE5B 1L0LK 1PP9J 1RF1B 4D6TD 4YTPC 2IFMA 1EDLA 4WWIA 3VYIA 1YIJP 5APUA 1CI6B 1SVFA 4N78E 1LTTC 1Q0AA 1PGPA 3FWNA 1N86A 1QLED 2D2CD 1S5LH 4EDFA 3CX5D 3R2PA 1URQD 1JYHA 2A06D 5APXA 1JOCA 2WPQA 3BRVB 3L35A 3M06A 2C9NY 1WT6A 2IBZI 2KOGA 1S5LX 2SPZA 1BSHA 1L0NK 1Q07A 3HH0A 5KAIH 2IDBA 3A2AA 3BCCE 2J5UA 1S72P 3CX5I 2NRGA 1GL2A 1Q05A 5TISH 2WZ7A 3HE5A 2BASA 2GM4A 1PPJG 4UB6E 1W5CE 1IFJA 4GOEA 2UWJE 1GW3A 2BOWA 1EZVG 1N2DC 4PV1D 1EDIA 1JY2P 2WMMA 1R8EA 3AE9C 2KS1A 2K9JB 2AXCA 1H89A 3VMXA 2R44A 3H1JG 1KYOD 1FZAA 5CHXA 1HH0A 3CX5E 3VP8A 1GK6A 1X79B 1LTIC 3LIEA 3N4XA 3RL0D 1JMBA 2FYUE 3RBZA 3VMAA 3CCLP 4TLFA 4EYYQ 2Q7CA 5KKZC 1GK4A 1Q09A 1RF1A 2LXCB 2DW3A 3GLMA 1Q7YQ 2FYZA 2POHA 3ITKA 3H1LJ 3M9BA 3CC7P 3RK3C 1AQ5A 2ZT9C 1YJ9P 3PHLA 2KZIA 1ZP0C 3ZDMA 2Q9IA 5L8RJ 4L73A 5C39A 1RQUA 1BSNA 1KILD 2FXPA 3MUDA 1GU5A 3L73J 3CXHD 5CCHD 1OVRA 1H8AA 1LP1B 3RK2C 1MFTA 1BCCD 3GP4A 2M8RA 3D6ZA 1GL2D 2JKVA 1OXZA 1PP9G 5CCGA 1KILA 4PJ0E 3OW2O 2FYUG 3HUSB 2A45G 1YI2P 3KXDA 1FOSF 4WB4A 1YTZI 3CMEP 1DEEG 3S1KA 3CLQA 2E74D 1J1EB 1NTZG 1JY2O 1EQ7A 1S9KD 3F5HA 3BCCJ 1WMKA 4U3FJ 5AW0B 2WQYC 4GOFA 2KK7A 2W8ZA 3A3YB 4N6JA 4OGQD 3BASA 1JY3N 1EDJA 1KILB 2P10A 1LP1A 3WU2H 3I5CA 1KQSO 4ZNCA 3RBXA 3TGUJ 1FZGA 2N9YB 3CXHI 3MP7B 1JY3O 1SFCC 1SFCB 1RY3A 4RESB 3B5NA 2BCCJ 2JO1A 1JBGA 5KAWA 2G3AA 4PD4I 4W80A 3D71A 1PGQA 1VQ4P 1PFIA 1A02F 1G1IA 3QWOC 3E1RA 3JC22 2KSJA 4OWFA 3MD0A 2KVVA 3H1HJ 4GODA 5KJ7D 3V2RA 4WVZA 1HTLC 2M0BA 2E5YA 3USSA 2OYIC 4AYZB 2WPVB 4LGDE 5EFWB 3C9IA 4RO0A 3CC4P 1FDMA 3H6PA 1Q81Q 3Q5SA 3L73G 5AW4B 2BCCG 3CL3D 2ZJSE 1L0LJ 1VQ5P 2BCCE 3HE4A 3KYQA 5KATA 3G4SP 3TSIA 1LWUC 2CK3H 3L36A 5AVRB 1D5YA 1P84H 2ZXXA 3H1JE 4L74A 1OVVA 2W90A 3M0DA 1W2BO 3T97B 3SWKA 3B5NB 3TGUG 1Y8AA 4CPGA 5CCHC 5KAFE 2KP8A 1MFZA 4BRYA 4KJMA 1JTHB 4AQRD 2WSSH 1BCCJ 5BU8B 3SWFA 4XFJA 1KQGB 3G71P 1SQXD 4AYZA 3CCJP 2GA1A 3L74D 2E75C 4NPFX 3JSVC 1BGYJ 2XDJA 1H0TA 2R5DA 3OAKA 2I1JA 4L75A 1VQMP 1NH4A 1YQ4C 3L75D 2Q1KA 2V7QH 2XNXA 1Z56A 3CC2P 3M91A 4DT0A 3A5TA 2KCUA 3T97A 1UIIA 3P8CE 4XA4A 3MZWB 1R8DA 5B5EE 3KHUA 1YTZT 1HJ0A 1VF5C 3L70D 5CBOA 5AVVB 2V4HA 3MGNA
chains in the Genus database with same CATH topology
1U57A 1FDIA 1Q90D 5KATA 3AE7C 3LW5J 2JMLA 1OW7A 3AEDC 3Q5PA 2H88C 4YXDC 3RK3E 4OGQC 1PM6A 1VF5B 2E75D 4GDOA 1WMKA 4H13D 1D5YA 1ZRTE 2WQYC 3Q3DA 4YTPC 2OQQA 3R8JA 2G8YA 2BEQD 4Y28J 3EZ2A 3Q1MA 3GK6A 3FGAD 5M1BA 1TU3F 5KKZC 4IL6X 2ZHGA 3T97B 1Q09A 1KORA 1Q0AA 3EWKA 1KILE 3B49A 3B71A 1NGMB 4PV1B 2OG0A 3ABVC 4H44D 1ZMEC 2D2CD 2IEFA 2H89C 3GF7A 3GLMA 3EZ9A 3AEBC 4OGQD 3SFEC 3E0HA 4R4MA 5KAVA 5E01A 2QIWA 2ZT9B 2JP3A 2E76D 1JYHA 1NYHA 2P10A 1FDOA 1Y9BA 4H0LB 3IAOA 2E76B 2ZT9C 3R4YA 4WLSA 3Q2YA 2WSFJ 4H44B 4R24B 1ZP0C 1Q06A 3EZFA 1EXJA 1VF5D 3AE1C 5L8RJ 1HF9A 2ZT9D 4U7JA 3EZ7A 4XFJA 5GQQA 1KQGB 4H0LC 2E76C 3AECC 4AYZA 1S5LX 3UCSA 1RQUA 4I7ZC 2D2CC 1KTMA 1OW6A 2QJPC 3GMAA 1BOWA 1OW8A 2QJKC 2YIUC 5KCBA 1Q07A 3GPVA 3D70A 3IN6A 2VZ4A 4TT3H 2FXPA 1UIXA 1MKMA 1JBGA 2JO1A 3G9RA 2G3AA 5KAWA 3QAOA 1OMIA 1JB0J 1DIPA 2WSEJ 2HVAA 3D71A 1ZOYC 2K9YA 2YMKA 4H44C 2GOVA 5I41B 1KMIZ 3HH0A 2IDBA 1DD3A 4LHFA 2E75C 2V7QJ 4RKUJ 3O6QA 3SFDC 3AEAC 1PV3A 2J5UA 4H13C 5I44A 3C8VA 3S9OA 2D2CB 1Y6UA 1VL2A 4OGQB 3GP4A 3H25A 3D6ZA 3AE2C 2E75B 1RQVA 2KVVA 1KQFB 3AE5C 4PV1C 3AE8C 1YQ4C 1Q05A 1GMJA 3EZ6A 2QJYC 1PL5A 2FYNC 2QSIA 3AEFC 3AE6C 2DG6A 1DD4A 4AYZB 3R8KA 1PIXA 2WPVB 3AE4C 5D8CA 4Z1MH 3LURA 1YQ3C 1K04A 1S1CX 2BEZF 2FBWC 2BOWA 4PV1D 1EXIA 2ZHHA 4R4LA 2WSCJ 3AE3C 3Q5RA 2E74B 4KT0J 2KCUA 5KAXA 4B0YA 1K05A 1R8EA 3AE9C 3Q5SA 2O01J 3GF3A 3RL0g 1AJYA 1R8DA 4WLWA 4H0LD 5KLIC 1LX8A 1Q08A 4R22B 3D6YA 5D90A 2NZ2A 3AEEC 4J2NA 1IK7A 1HJ0A 1VF5C 4I7ZB 2E74C 4H13B 1RH6A 3AEGC 2E74D 4DCZA 5KAUA 4A1MA 4R4EA 2MKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBG A;  5KAW A;  5KAV A;  3E0H A;  5KAT A;  3QAO A;  4R4M A;  2JML A;  5E01 A;  2DG6 A;  1DIP A;  4AYZ B;  1JYH A;  2HVA A;  3D71 A;  3R8K A;  5D8C A;  2GOV A;  3LUR A;  5I41 B;  3IAO A;  3Q5P A;  1Q05 A;  3HH0 A;  1D5Y A;  4WLS A;  3Q2Y A;  2BOW A;  3Q3D A;  2OQQ A;  3R8J A;  1EXI A;  2ZHH A;  4R4L A;  2KCU A;  5KAX A;  4R24 B;  3Q5R A;  2J5U A;  1Q06 A;  1EXJ A;  4B0Y A;  5I44 A;  3Q1M A;  3GK6 A;  3D70 A;  1R8E A;  3Q5S A;  3GP4 A;  5GQQ A;  1R8D A;  4WLW A;  4AYZ A;  1Q08 A;  3D6Z A;  4R22 B;  2ZHG A;  3D6Y A;  3T97 B;  5D90 A;  3UCS A;  1Q09 A;  4J2N A;  4A1M A;  1Q0A A;  1BOW A;  3B49 A;  5KAU A;  5KCB A;  1Q07 A;  3GPV A;  4R4E A;  2VZ4 A;  3G9R A; 
#chains in the Genus database with same CATH topology
 1U57 A;  4IL6 H;  1T2K C;  1OW7 A;  4DZO A;  4W7Z A;  3L71 J;  5KAI E;  3H1K J;  3V2Q A;  2OQQ A;  2N1T A;  3CWB J;  2ZYG A;  1TU3 F;  5BU5 A;  1SQQ K;  1S4X A;  4HH2 A;  2R32 A;  1SQX E;  2M5A B;  1VQO P;  1FZC C;  3GG2 A;  5APV A;  3SFE C;  2ZT9 B;  2ZAE B;  2NPS B;  5KTB A;  5DJT B;  1ZR2 A;  3WUV A;  2Y0D A;  3H32 A;  1AA0 A;  2R5B A;  1SQB K;  4PD4 D;  3H1H D;  1NTZ E;  1L0N G;  1K8A Q;  1AV1 A;  2YIU C;  4C7N B;  3H1L D;  5KCB A;  2ITA A;  2VZ4 A;  1URQ C;  1OMI A;  2V7Q J;  2I1K A;  4DOJ A;  1PV3 A;  5CCG D;  1L0L D;  1NTM E;  2H8P D;  1W2E A;  2XU6 A;  1E5W A;  1JO5 A;  4BWN A;  1VPC A;  3L73 D;  5TJH A;  2WT7 A;  3EZ6 A;  3TK1 A;  1KD1 Q;  1S2E A;  3HD7 A;  1YQ3 C;  3QH9 A;  2CPB A;  1KB9 E;  2WSC H;  1KYO E;  1URQ A;  1KZU B;  4UB8 H;  1N7S C;  2L5G B;  4OVN F;  3CD6 P;  4I7Z B;  5AW3 B;  1EDK A;  1L4A B;  3RL0 B;  3UIA A;  4A1M A;  1HGZ A;  1FBM A;  4PD4 H;  3AED C;  1HGV A;  1L0N D;  2Q3E A;  1LTJ C;  3V5B A;  3KZI H;  3A0H H;  1LTB C;  1X9V A;  4KHX A;  1XTG B;  1SQX J;  2N1T B;  1T8Z A;  3L74 J;  3IFM A;  2O01 H;  2YO3 A;  2JP3 A;  4U3F D;  3HD7 D;  3IAO A;  5AVS B;  2FY8 A;  3L71 E;  2A06 E;  1ZLL A;  3B4S A;  2KLV A;  1MUU A;  3PH0 A;  2NPS A;  3EZ7 A;  1G2C B;  1SQB G;  3L75 J;  3UCS A;  1AVO A;  3U1C A;  1UIX A;  3G9R A;  2AXT H;  1NU1 E;  2P67 A;  1NTK E;  3TGU D;  3U59 A;  1RHZ B;  2ZVO B;  1LTJ A;  5AW1 B;  4ZKU A;  2D2C B;  1Y6U A;  1LWU A;  3L70 J;  2WVR A;  4MN4 C;  2LXB A;  2Y0C A;  5DJU B;  4N78 D;  1DX7 A;  1PL5 A;  3AE6 C;  3L71 D;  4U3F E;  4C46 A;  3CWB D;  2FBW C;  2L91 A;  1YJW P;  3GF3 A;  3CCR P;  2IX7 C;  1AJY A;  3EFF K;  1Q08 A;  3MUD C;  3I55 P;  2KZJ A;  4K35 A;  4R4E A;  4JQ0 D;  3TF5 A;  1FDI A;  4ASV A;  3Q5P A;  2H88 C;  1X0T A;  1P84 D;  3O6Q B;  5AVW B;  4Y28 J;  1RE3 C;  1FZB A;  1BDC A;  5KLI B;  2ZHG A;  5CCH A;  1QL1 A;  3B71 A;  1ZXG A;  4PV1 B;  2HPC B;  1IO4 A;  3GF7 A;  3AEB C;  1YHQ P;  3M0D C;  1VQL P;  4AUW A;  2XND H;  1HBW A;  3A0B E;  2HYN A;  1SQB J;  2WPS A;  3II6 A;  3NFQ A;  1USE A;  2XZR A;  1WRG A;  4TT3 H;  1NTK K;  1JB0 J;  4H44 C;  1KC8 Q;  3O6Q A;  2HR3 A;  2IBZ G;  3S9O A;  2K88 A;  3KPE A;  2KXP B;  4GIF A;  2QJY B;  2OGU A;  1N7S D;  1PGJ A;  3L74 E;  1L0N J;  2IYO A;  1SQP G;  1BGY D;  1K04 A;  1M1J C;  3CCU P;  2Q5U A;  3H32 B;  1SQP K;  3Q5R A;  1CZQ A;  3VOP A;  1A02 J;  1P84 I;  3E7K A;  3RL0 g;  4BXL A;  1LNQ A;  1LTA C;  3VMY A;  2YMK A;  3V6I A;  1RF0 C;  2QJK B;  1HUC A;  4GDO A;  2E43 A;  1J2J B;  3B5N D;  1NAF A;  2OTL P;  5AW8 B;  3L71 G;  1RE4 A;  3L70 E;  1SQQ G;  1FAV A;  2Q6Q A;  1X8Y A;  5AVZ B;  1FZF A;  3H1K D;  4EI2 A;  1FDO A;  3K5B A;  3PTZ A;  1EZV I;  3R4Y A;  2HPC A;  3L75 G;  3EZF A;  1GL2 B;  1FJK A;  1LJ2 A;  1SQP D;  1KTM A;  1JEK A;  3PLN A;  4HJG H;  1MKM A;  3L72 D;  2HOD A;  3SWY A;  4OH8 B;  3H1J J;  4D6T E;  2IZ0 A;  1T2K D;  3H1H E;  1N8R Q;  4ASW A;  1FC2 C;  4UB8 E;  5AW5 B;  3G3Z A;  1DD4 A;  3R8K A;  2W27 A;  2AEF A;  3M9Q A;  2YXR B;  4KT0 J;  1ZN5 A;  3OA7 A;  1QVF O;  3FWL A;  4IOI H;  1M90 Q;  4Y99 C;  1G2C A;  1M1K Q;  2WTY A;  4WY4 B;  2YIU B;  1U7M A;  2IBZ D;  5AVQ B;  1D7M A;  1ZRT D;  2FXM A;  3LW5 J;  1KB9 I;  2J58 A;  2XV5 A;  1SQX K;  2E75 D;  4H13 D;  2GUS A;  1NTK D;  3TGU E;  3RK2 D;  1NU1 D;  4ZKP A;  2KI7 B;  3C1L A;  4GT1 A;  1AQT A;  3FXD A;  4C7R A;  3EWK A;  3B49 A;  3M9H A;  2Y0E A;  3RL0 C;  2B88 A;  2IEF A;  1L0L G;  2A45 I;  1LT9 C;  2QEX P;  1IFI A;  2WSF J;  5APT A;  4AYC A;  2ZT9 D;  1DEB A;  3V2P A;  1BE3 J;  5AVY B;  2GUV A;  3TNU B;  1N7S A;  2O1K A;  3HUS A;  4HB1 A;  2GOV A;  4IFD K;  1IFM A;  5BVZ A;  2QSI A;  2KSE A;  4WY4 D;  4B86 A;  2O01 N;  4JYB A;  3W68 A;  4A7P A;  1LTG C;  4UB6 H;  2ZHH A;  4R4L A;  3L72 G;  2ZYD A;  1QX8 A;  2R3S A;  1BGY E;  4ZMD A;  2C9L Y;  2Q3I A;  2QRX A;  1BE3 E;  3PP5 A;  1FS0 E;  1IK7 A;  2LR2 A;  2A06 G;  1J1D C;  3V4Q A;  3TNU A;  2JML A;  1N7S B;  3S4R A;  3CCS P;  1S9K E;  1GD2 E;  5KLV G;  4YXD C;  1SS1 A;  3H1K G;  3R8J A;  3KQG A;  4U3F G;  3GK6 A;  1SQP J;  1QEX A;  2FYU D;  2OYH B;  4RJT A;  3RGU A;  1EZV E;  2YNY A;  2H89 C;  1N73 C;  1IK9 A;  1SQQ J;  2QIW A;  3H1I G;  3A7O A;  1L4A A;  1M1J B;  1T3U A;  5APQ A;  5E79 H;  1FZC B;  5APY A;  1VF5 D;  1SQV G;  1QVG O;  5GQQ A;  3U1A A;  1NTM J;  1K9M Q;  1IZN B;  3RK3 B;  2HG5 D;  2D2C C;  2QJK C;  3CCQ P;  1RH5 B;  1ZOY C;  3CXH E;  1KMI Z;  3P7K A;  1DD3 A;  1SQB D;  1LT9 A;  4IL6 E;  1P84 E;  1SFC D;  1VL2 A;  3CWB G;  3L37 A;  3B5N C;  2FYU K;  2FYN C;  1N73 B;  2N1T C;  1NU1 J;  1HVV A;  2YMY A;  1E79 H;  2W83 C;  2QM7 A;  3CWB E;  2W6A A;  1K05 A;  3L4F A;  3L75 E;  4R22 B;  3H1I D;  3TDK A;  5CBN A;  3NMD A;  2NPS D;  1USD A;  2E5T A;  5APW A;  2XKM A;  1MZ9 A;  1YYC A;  4I6M C;  1L4A C;  5H2F H;  1XTC C;  3Q1M A;  3H1I E;  1BE3 D;  1PZQ A;  3WUU A;  1ZR4 A;  4XE5 B;  1ZW0 A;  2E76 D;  1Y9B A;  1DH3 A;  3JCU H;  4WLS A;  4Y99 B;  2Y9Y A;  4H44 B;  4U7J A;  3AEC C;  1FZC A;  1BOW A;  2IFN A;  3BAT A;  3VN0 A;  3D70 A;  1R5S A;  1FZE A;  1H0T B;  5KLV J;  3EFG A;  5AW6 B;  2K9Y A;  1JNM A;  2JEE A;  3SFD C;  1M1J A;  2N1T D;  3KZI E;  1NOH A;  3C8V A;  3OJA B;  3H25 A;  2ZXE B;  1CI6 A;  1L4A D;  2WSE H;  2E75 B;  4GKG A;  4LC1 A;  4LLH A;  2FFD A;  5AW9 B;  3L72 J;  2WIT A;  3CX5 H;  3AE8 C;  4NPD A;  3AEF C;  3L70 G;  3CCE P;  1CW5 A;  1R5L A;  3AE4 C;  3H1J D;  2NPS C;  3LUR A;  1S1C X;  1PP9 E;  1KFM A;  3MHV A;  1EXI A;  2WSC J;  2JWA A;  4YXW H;  5D90 A;  1G1J A;  2H43 A;  1SQQ D;  2IYP A;  2MKV A;  3HTK A;  3P8M C;  4OGQ C;  1ZRT E;  1PPJ D;  1S3J A;  3CPW O;  1AFO A;  1YJN P;  3EQ2 A;  5KLV E;  3ABV C;  2B89 A;  3GHG B;  1X22 A;  2O3J A;  5AVT B;  1NVO A;  1NYH A;  1NTK J;  3A0B H;  4H0L B;  1VQ8 P;  1SQV K;  2KIK A;  2P7J A;  2P58 A;  2YO2 A;  3GW6 A;  1LTS C;  2E76 C;  3IF4 A;  2J59 M;  1OW8 A;  2WWW A;  1VDF A;  2FFD C;  3VP9 A;  1DIP A;  4LHF A;  4QMA A;  4L76 A;  1KYO I;  3H1I J;  4WY4 A;  1SQP E;  1IFD A;  3AE2 C;  1KV4 A;  2M5A A;  1VQP P;  2A45 H;  1NU1 G;  1KB9 H;  4WY4 C;  3VMZ A;  3H1K E;  2BEZ F;  1VQN P;  2CPS A;  3AE3 C;  2K3R A;  2OYI A;  4WLW A;  2E42 A;  2QVA A;  2QJP B;  5AVX B;  4H13 B;  1BE3 G;  3AEG C;  4BRY B;  1GW4 A;  2KS1 B;  3RK3 D;  1NTM K;  2WT7 B;  2P2U A;  1SQV J;  5KKZ B;  2W6B A;  1JUN A;  1PM6 A;  2RH0 A;  1Q82 Q;  3Q3D A;  1FE6 A;  2BEQ D;  2C0X A;  2WPR A;  1YBK A;  2PFX A;  1NTZ J;  5GTH H;  5CCG C;  1OIP A;  2B9B A;  1JY3 P;  3HRN A;  4JPZ B;  4WBA A;  5KLV D;  1GU4 A;  2OAR A;  2OG0 A;  1ZME C;  5KAV A;  4R4M A;  4EOT A;  1PGO A;  1NTK G;  2OYH A;  1HWT C;  2P1J A;  3F89 A;  3V4W A;  1K73 Q;  1LT1 A;  3LID A;  2FYU J;  1EXJ A;  1HF9 A;  1URQ B;  1H88 A;  5AVU B;  2OYH C;  1QGK B;  3GMA A;  1KQL A;  5GTH E;  1JCC A;  3GPV A;  2FKW B;  1BDD A;  3QAO A;  3A0H E;  1SQV E;  2HVA A;  3L73 E;  2ZVN B;  2RKL A;  1NTM D;  4DJG A;  1L0L E;  1IFN A;  1EZV D;  1AVY A;  1EC5 A;  1RQV A;  1KQF B;  5B5E H;  1GMJ A;  1M7L A;  3NTN A;  2AEJ A;  2WSF H;  2M3B A;  2QE7 H;  2VRS A;  1OWA A;  2PAJ A;  1PP9 D;  2PGD A;  1LGH B;  3KDP B;  4D6T J;  5KLI C;  3D6Y A;  4K3A A;  1QL2 A;  2QM8 A;  3AE5 C;  2OYO A;  4C7N A;  2IPP A;  1VQ9 P;  2YKQ A;  1NWQ A;  1KN7 A;  2JDI H;  1Y47 A;  2IZ1 A;  1L2P A;  2KB7 P;  3FGA D;  1T3J A;  5M1B A;  1NJI Q;  1IJD B;  2FXO A;  2W6J H;  1OZH A;  1JM0 A;  4IFF A;  4YPC A;  2K9J A;  2FYN B;  1KFN A;  2M3E A;  1J1D B;  5CMZ A;  4JBZ A;  2YKO A;  1S5L E;  3JCU E;  1KB9 D;  4HYT B;  1JMM A;  2YXQ B;  3WU2 E;  1T6A A;  2KNC A;  1OFC X;  1OW6 A;  5KAF H;  4HKZ H;  3RK2 B;  3O8Z A;  2WSE J;  1SFC A;  5I41 B;  2ZYA A;  1NHL A;  1Q2N A;  2LKM A;  2C0W A;  4RKU J;  3M0A A;  2Z5I A;  4H13 C;  2PRR A;  5CJ4 A;  1JTH A;  2YKP A;  2JJL A;  2IBZ E;  3N7N A;  1SLQ A;  2I8D A;  1SQV D;  2AEM A;  2QJY C;  3FX0 A;  2QG4 A;  2B87 A;  3H1L E;  1NTM G;  5B66 H;  3PJS K;  5AW7 B;  3I56 P;  1NTZ D;  3TYY A;  5KJ7 C;  2N9B A;  5KAX A;  2E74 B;  1MV8 A;  5GTI H;  2KUB A;  4H0L D;  3AEE C;  3P32 A;  2JR8 A;  3AE7 C;  5AW2 B;  1L0N E;  2PP6 A;  1CSB A;  1GDT A;  1BCC E;  2K37 A;  5KJ7 A;  1SQB E;  2G8Y A;  3EZ2 A;  1NAY A;  3B8E B;  3W67 A;  3MTU E;  2ZFC A;  1LWU B;  4IL6 X;  1BGY G;  1KIL C;  5K5G B;  2AXT E;  1OX3 A;  1KIL E;  3H1H G;  2HFE D;  3BCC G;  4H44 D;  1OVU A;  3E0H A;  1YIT P;  1LTJ B;  1NU1 K;  1SQQ E;  3SSU A;  3Q2Y A;  3LW5 H;  4R24 B;  1RF0 A;  1Q06 A;  3AE1 C;  1NKZ B;  1M57 D;  1NTZ K;  2OYI B;  4I7Z C;  1BCC G;  1JCD A;  2MJZ A;  1FU1 A;  1J1E C;  2RN0 A;  1FJP A;  2KNC B;  4IFM A;  2JWD A;  1IC2 A;  5H2F E;  3AEA C;  1HJB A;  3WUT A;  5I44 A;  1NKN A;  1JY2 N;  5KLV K;  1ZV8 A;  1N73 A;  4PD4 E;  2K1A A;  3BRT B;  4EIJ A;  2DG6 A;  3G6E P;  5D8C A;  1GZL A;  1SP4 A;  4B0Y A;  3BCC D;  2B87 B;  4D6T G;  5B66 E;  2NZ2 A;  2KYV A;  4PJ0 H;  2E74 C;  4O9B A;  1RH6 A;  4I2L C;  1NO4 A;  4DCZ A;  1RF1 C;  2H7H A;  2HOD B;  3IR9 A;  1FOS E;  4JYC A;  4W7Y A;  3VTP C;  2OTK E;  3RK3 E;  3CCV P;  1VF5 B;  4M3L A;  1LT9 B;  1VQ7 P;  3HD7 C;  2Z4E A;  1N7L A;  3CMA P;  1PPJ E;  3WMM 0;  5APS A;  1IFP A;  3CXH H;  4DCK A;  1VQK P;  1KOR A;  3P8C D;  1VQ6 P;  1NGM B;  1GTW A;  3EZ9 A;  1GL2 C;  5E01 A;  1M56 D;  2BCC D;  1M8O B;  3HE4 B;  3HTK B;  1Q86 Q;  5E79 E;  3NXS A;  3HUS C;  4H0L C;  4N3Y B;  3E1I A;  3CI9 A;  4NPE A;  2QJP C;  2HLO A;  3IN6 A;  3FXE A;  4Z1M H;  2OTJ P;  4I1L A;  1RE4 C;  3MIW A;  3GHG A;  2FFD B;  2Z5H A;  4OGQ B;  3H1L G;  3BVH A;  3L74 G;  5GTI E;  4PV1 C;  1KYO H;  4JF7 A;  3V2N A;  1PIX A;  1RE3 A;  3GHG C;  2KLU A;  1SQX G;  2O01 J;  3CCM P;  3HD7 B;  1LX8 A;  5CJ0 A;  1U7J A;  4J2N A;  2QA4 P;  3L72 E;  5KAU A;  2RMZ A;  5TIS E;  3PRJ A;  2E76 B;  2R3C A;  1Q90 D;  2O1J A;  2Y9Z A;  3HE5 B;  1L0L K;  1PP9 J;  1RF1 B;  4D6T D;  4YTP C;  2IFM A;  1EDL A;  4WWI A;  3VYI A;  1YIJ P;  5APU A;  1CI6 B;  1SVF A;  4N78 E;  1LTT C;  1Q0A A;  1PGP A;  3FWN A;  1N86 A;  1QLE D;  2D2C D;  1S5L H;  4EDF A;  3CX5 D;  3R2P A;  1URQ D;  1JYH A;  2A06 D;  5APX A;  1JOC A;  2WPQ A;  3BRV B;  3L35 A;  3M06 A;  2C9N Y;  1WT6 A;  2IBZ I;  2KOG A;  1S5L X;  2SPZ A;  1BSH A;  1L0N K;  1Q07 A;  3HH0 A;  5KAI H;  2IDB A;  3A2A A;  3BCC E;  2J5U A;  1S72 P;  3CX5 I;  2NRG A;  1GL2 A;  1Q05 A;  5TIS H;  2WZ7 A;  3HE5 A;  2BAS A;  2GM4 A;  1PPJ G;  4UB6 E;  1W5C E;  1IFJ A;  4GOE A;  2UWJ E;  1GW3 A;  2BOW A;  1EZV G;  1N2D C;  4PV1 D;  1EDI A;  1JY2 P;  2WMM A;  1R8E A;  3AE9 C;  2KS1 A;  2K9J B;  2AXC A;  1H89 A;  3VMX A;  2R44 A;  3H1J G;  1KYO D;  1FZA A;  5CHX A;  1HH0 A;  3CX5 E;  3VP8 A;  1GK6 A;  1X79 B;  1LTI C;  3LIE A;  3N4X A;  3RL0 D;  1JMB A;  2FYU E;  3RBZ A;  3VMA A;  3CCL P;  4TLF A;  4EYY Q;  2Q7C A;  5KKZ C;  1GK4 A;  1Q09 A;  1RF1 A;  2LXC B;  2DW3 A;  3GLM A;  1Q7Y Q;  2FYZ A;  2POH A;  3ITK A;  3H1L J;  3M9B A;  3CC7 P;  3RK3 C;  1AQ5 A;  2ZT9 C;  1YJ9 P;  3PHL A;  2KZI A;  1ZP0 C;  3ZDM A;  2Q9I A;  5L8R J;  4L73 A;  5C39 A;  1RQU A;  1BSN A;  1KIL D;  2FXP A;  3MUD A;  1GU5 A;  3L73 J;  3CXH D;  5CCH D;  1OVR A;  1H8A A;  1LP1 B;  3RK2 C;  1MFT A;  1BCC D;  3GP4 A;  2M8R A;  3D6Z A;  1GL2 D;  2JKV A;  1OXZ A;  1PP9 G;  5CCG A;  1KIL A;  4PJ0 E;  3OW2 O;  2FYU G;  3HUS B;  2A45 G;  1YI2 P;  3KXD A;  1FOS F;  4WB4 A;  1YTZ I;  3CME P;  1DEE G;  3S1K A;  3CLQ A;  2E74 D;  1J1E B;  1NTZ G;  1JY2 O;  1EQ7 A;  1S9K D;  3F5H A;  3BCC J;  1WMK A;  4U3F J;  5AW0 B;  2WQY C;  4GOF A;  2KK7 A;  2W8Z A;  3A3Y B;  4N6J A;  4OGQ D;  3BAS A;  1JY3 N;  1EDJ A;  1KIL B;  2P10 A;  1LP1 A;  3WU2 H;  3I5C A;  1KQS O;  4ZNC A;  3RBX A;  3TGU J;  1FZG A;  2N9Y B;  3CXH I;  3MP7 B;  1JY3 O;  1SFC C;  1SFC B;  1RY3 A;  4RES B;  3B5N A;  2BCC J;  2JO1 A;  1JBG A;  5KAW A;  2G3A A;  4PD4 I;  4W80 A;  3D71 A;  1PGQ A;  1VQ4 P;  1PFI A;  1A02 F;  1G1I A;  3QWO C;  3E1R A;  3JC2 2;  2KSJ A;  4OWF A;  3MD0 A;  2KVV A;  3H1H J;  4GOD A;  5KJ7 D;  3V2R A;  4WVZ A;  1HTL C;  2M0B A;  2E5Y A;  3USS A;  2OYI C;  4AYZ B;  2WPV B;  4LGD E;  5EFW B;  3C9I A;  4RO0 A;  3CC4 P;  1FDM A;  3H6P A;  1Q81 Q;  3Q5S A;  3L73 G;  5AW4 B;  2BCC G;  3CL3 D;  2ZJS E;  1L0L J;  1VQ5 P;  2BCC E;  3HE4 A;  3KYQ A;  5KAT A;  3G4S P;  3TSI A;  1LWU C;  2CK3 H;  3L36 A;  5AVR B;  1D5Y A;  1P84 H;  2ZXX A;  3H1J E;  4L74 A;  1OVV A;  2W90 A;  3M0D A;  1W2B O;  3T97 B;  3SWK A;  3B5N B;  3TGU G;  1Y8A A;  4CPG A;  5CCH C;  5KAF E;  2KP8 A;  1MFZ A;  4BRY A;  4KJM A;  1JTH B;  4AQR D;  2WSS H;  1BCC J;  5BU8 B;  3SWF A;  4XFJ A;  1KQG B;  3G71 P;  1SQX D;  4AYZ A;  3CCJ P;  2GA1 A;  3L74 D;  2E75 C;  4NPF X;  3JSV C;  1BGY J;  2XDJ A;  1H0T A;  2R5D A;  3OAK A;  2I1J A;  4L75 A;  1VQM P;  1NH4 A;  1YQ4 C;  3L75 D;  2Q1K A;  2V7Q H;  2XNX A;  1Z56 A;  3CC2 P;  3M91 A;  4DT0 A;  3A5T A;  2KCU A;  3T97 A;  1UII A;  3P8C E;  4XA4 A;  3MZW B;  1R8D A;  5B5E E;  3KHU A;  1YTZ T;  1HJ0 A;  1VF5 C;  3L70 D;  5CBO A;  5AVV B;  2V4H A;  3MGN A; 
#chains in the Genus database with same CATH homology
 1U57 A;  1FDI A;  1Q90 D;  5KAT A;  3AE7 C;  3LW5 J;  2JML A;  1OW7 A;  3AED C;  3Q5P A;  2H88 C;  4YXD C;  3RK3 E;  4OGQ C;  1PM6 A;  1VF5 B;  2E75 D;  4GDO A;  1WMK A;  4H13 D;  1D5Y A;  1ZRT E;  2WQY C;  3Q3D A;  4YTP C;  2OQQ A;  3R8J A;  2G8Y A;  2BEQ D;  4Y28 J;  3EZ2 A;  3Q1M A;  3GK6 A;  3FGA D;  5M1B A;  1TU3 F;  5KKZ C;  4IL6 X;  2ZHG A;  3T97 B;  1Q09 A;  1KOR A;  1Q0A A;  3EWK A;  1KIL E;  3B49 A;  3B71 A;  1NGM B;  4PV1 B;  2OG0 A;  3ABV C;  4H44 D;  1ZME C;  2D2C D;  2IEF A;  2H89 C;  3GF7 A;  3GLM A;  3EZ9 A;  3AEB C;  4OGQ D;  3SFE C;  3E0H A;  4R4M A;  5KAV A;  5E01 A;  2QIW A;  2ZT9 B;  2JP3 A;  2E76 D;  1JYH A;  1NYH A;  2P10 A;  1FDO A;  1Y9B A;  4H0L B;  3IAO A;  2E76 B;  2ZT9 C;  3R4Y A;  4WLS A;  3Q2Y A;  2WSF J;  4H44 B;  4R24 B;  1ZP0 C;  1Q06 A;  3EZF A;  1EXJ A;  1VF5 D;  3AE1 C;  5L8R J;  1HF9 A;  2ZT9 D;  4U7J A;  3EZ7 A;  4XFJ A;  5GQQ A;  1KQG B;  4H0L C;  2E76 C;  3AEC C;  4AYZ A;  1S5L X;  3UCS A;  1RQU A;  4I7Z C;  2D2C C;  1KTM A;  1OW6 A;  2QJP C;  3GMA A;  1BOW A;  1OW8 A;  2QJK C;  2YIU C;  5KCB A;  1Q07 A;  3GPV A;  3D70 A;  3IN6 A;  2VZ4 A;  4TT3 H;  2FXP A;  1UIX A;  1MKM A;  1JBG A;  2JO1 A;  3G9R A;  2G3A A;  5KAW A;  3QAO A;  1OMI A;  1JB0 J;  1DIP A;  2WSE J;  2HVA A;  3D71 A;  1ZOY C;  2K9Y A;  2YMK A;  4H44 C;  2GOV A;  5I41 B;  1KMI Z;  3HH0 A;  2IDB A;  1DD3 A;  4LHF A;  2E75 C;  2V7Q J;  4RKU J;  3O6Q A;  3SFD C;  3AEA C;  1PV3 A;  2J5U A;  4H13 C;  5I44 A;  3C8V A;  3S9O A;  2D2C B;  1Y6U A;  1VL2 A;  4OGQ B;  3GP4 A;  3H25 A;  3D6Z A;  3AE2 C;  2E75 B;  1RQV A;  2KVV A;  1KQF B;  3AE5 C;  4PV1 C;  3AE8 C;  1YQ4 C;  1Q05 A;  1GMJ A;  3EZ6 A;  2QJY C;  1PL5 A;  2FYN C;  2QSI A;  3AEF C;  3AE6 C;  2DG6 A;  1DD4 A;  4AYZ B;  3R8K A;  1PIX A;  2WPV B;  3AE4 C;  5D8C A;  4Z1M H;  3LUR A;  1YQ3 C;  1K04 A;  1S1C X;  2BEZ F;  2FBW C;  2BOW A;  4PV1 D;  1EXI A;  2ZHH A;  4R4L A;  2WSC J;  3AE3 C;  3Q5R A;  2E74 B;  4KT0 J;  2KCU A;  5KAX A;  4B0Y A;  1K05 A;  1R8E A;  3AE9 C;  3Q5S A;  2O01 J;  3GF3 A;  3RL0 g;  1AJY A;  1R8D A;  4WLW A;  4H0L D;  5KLI C;  1LX8 A;  1Q08 A;  4R22 B;  3D6Y A;  5D90 A;  2NZ2 A;  3AEE C;  4J2N A;  1IK7 A;  1HJ0 A;  1VF5 C;  4I7Z B;  2E74 C;  4H13 B;  1RH6 A;  3AEG C;  2E74 D;  4DCZ A;  5KAU A;  4A1M A;  4R4E A;  2MKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...