3D71A

Crystal structure of e253q bmrr bound to 22 base pair promoter site
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
277
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYQLIIPIHYSPKKQEEYRVEMKIRILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket and Transcription Activation through Tyrosine Expulsion
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna
molecule keywords BMR promoter DNA
total genus 78
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3d71A01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3d71A02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3d71A03
4R4MA 1DIPA 5KAXA 5KCBA 5KAUA 2OQQA 3D6YA 3UCSA 3D71A 3D70A 3T97B 5GQQA 4B0YA 3GP4A 1Q05A 3Q5SA 1JYHA 5D8CA 2GOVA 4R4EA 2KCUA 2ZHGA 2VZ4A 3Q3DA 4R22B 4WLWA 1EXJA 5KAVA 3LURA 3R8JA 3Q5RA 3R8KA 3Q1MA 2DG6A 1R8DA 4J2NA 1D5YA 3G9RA 5E01A 2HVAA 1JBGA 1Q09A 1Q06A 3GPVA 2ZHHA 5I41B 5I44A 1Q0AA 5KAWA 2J5UA 1Q08A 3HH0A 4R4LA 4A1MA 3Q2YA 4AYZA 4AYZB 3GK6A 4R24B 1BOWA 4WLSA 2JMLA 5D90A 3Q5PA 1R8EA 2BOWA 3IAOA 3QAOA 3B49A 3E0HA 3D6ZA 5KATA 1EXIA 1Q07A
chains in the Genus database with same CATH superfamily
1GL2C 1S5LE 3H1LJ 3NFQA 1LTJC 3N7NA 1Q82Q 2WT7A 3SFDC 3L75D 3WUUA 2HPCA 4W7ZA 3BASA 1MFTA 4IOIH 2O3JA 3H1HG 3L70E 3W68A 1HWTC 3GMAA 1J2JB 2JDIH 5KAWA 1FU1A 1W2EA 2W6JH 3H32B 2WSCH 4Y99C 1PFIA 2WMMA 3HE5B 3HRNA 3L70G 3S9OA 3MIWA 1JY3O 3D6YA 2Z5HA 1BGYJ 1VQ6P 1A02F 1QVFO 1EDIA 2CPSA 1JBGA 2QJPC 2QVAA 3R4YA 4H13D 1NTZK 1NTZG 1BSHA 3I5CA 1HUCA 2Q3IA 3CLQA 5APSA 3VP8A 1GW4A 3F5HA 3SSUA 4C7NB 3CMAP 2WITA 5AW4B 1PP9J 1NU1E 3C9IA 3TYYA 3P32A 3HE4B 1K8AQ 2KB7P 3H1JE 5KJ7A 2NRGA 1JTHA 5APTA 1N2DC 2KI7B 3S1KA 3A0BH 4I6MC 1YJ9P 1SQVD 3VN0A 4JQ0D 3G9RA 1PGOA 3L74G 2A45H 1PGPA 3O6QA 2QJKB 3E0HA 1D7MA 4W80A 5M1BA 1OW6A 3P7KA 3GLMA 3V2QA 1YJNP 3OW2O 3V4WA 1SP4A 3CWBJ 2IX7C 3EZ2A 5KKZC 3TF5A 3MP7B 2KZIA 1SQQE 2ZXEB 1LT1A 3O6QB 2N1TC 2C0XA 1SLQA 4R4EA 1UIXA 3A7OA 1VPCA 1NTMJ 2WPQA 1IJDB 3OJAB 2WT7B 4GIFA 1BE3J 5H2FH 3L74J 1E5WA 2WSEJ 2KIKA 2WSCJ 3IFMA 3H1ID 2O1JA 2KS1A 4PD4I 2V7QH 5KLVD 1WT6A 2KVVA 1IFMA 1JM0A 4A1MA 1KQSO 1M90Q 2P58A 3KQGA 1H88A 1M1JC 2OYHC 3Q3DA 2H88C 1QGKB 3P8MC 2I8DA 1SQXJ 1W2BO 2E74D 2E75B 3AEBC 2BOWA 5APWA 2B88A 4L75A 4U3FD 3CC7P 2FXOA 4IFFA 1NAYA 5GTIE 3MTUE 4DOJA 1URQB 2FXMA 1SQPE 3A0BE 1KILC 2H89C 1BCCE 5AVQB 1HJBA 2Q5UA 4OGQD 1RF0A 3QAOA 1Y9BA 3WMM0 1L4AB 3CCLP 2IBZE 2B87A 3JCUH 2QM8A 1GL2B 1JO5A 1ZRTE 3M0AA 5AVVB 2DG6A 1YQ4C 1GD2E 1M57D 1Q06A 2K37A 2W27A 2IBZI 2N9YB 3AEAC 3T97A 1IK7A 4HH2A 4I7ZB 4H44D 2FYUJ 4BRYA 3AEFC 5BU8B 2E43A 3CCVP 4LLHA 1KN7A 2QJYC 2W6AA 3H1IG 2M0BA 1PZQA 1JNMA 1K73Q 2R5BA 1L0LJ 1RE3A 2KUBA 3B8EB 5KAXA 5GTHH 5TJHA 1HGVA 3JSVC 1PP9G 2Q7CA 4HYTB 2GUVA 2QE7H 2JEEA 3EZFA 1X0TA 3M9HA 2YIUC 1NYHA 1AVYA 2Y0CA 1S4XA 1FZBA 4RO0A 2C9LY 1RHZB 3V2PA 2JP3A 4WVZA 3D70A 4NPEA 4XFJA 5AW0B 4KJMA 3S4RA 3L75G 3IR9A 1FE6A 2V7QJ 4BRYB 1HF9A 1RF1B 2L91A 1MKMA 1NU1G 1LWUB 3L35A 1FDOA 4L73A 5KLVK 3ABVC 4ASWA 2L5GB 2WSEH 2R5DA 1YIJP 2GM4A 2OYIA 3VOPA 1NTKE 1CI6B 2HODA 2HYNA 5APUA 3TGUD 4U3FE 1BE3G 1T6AA 1FZCC 4DZOA 3CD6P 1NO4A 2H7HA 2IYPA 4ZNCA 1KB9E 1SQBE 4PJ0H 2O01J 4HJGH 1FZFA 2FYUG 2V4HA 2AXTH 1FC2C 4D6TD 1NKNA 1DEBA 1FJPA 2H8PD 4OWFA 2VZ4A 4GODA 1ZXGA 3B5NC 2KXPB 4PV1B 1SQQG 3LIEA 5CBOA 2K88A 1JCDA 4KT0J 3M06A 4GT1A 1J1EB 2LXBA 3RK2C 2YXQB 2KP8A 3B5NB 3H1JD 1LP1A 3CPWO 3H1KG 3QWOC 2N1TD 3TSIA 1U7MA 3JC22 2W8ZA 4IL6E 5AW7B 2IPPA 3HD7A 1M7LA 2QG4A 2Z5IA 2KCUA 1OFCX 1RF1C 1S9KD 2M5AA 2JR8A 3AE8C 3L70J 4RESB 3H1KE 2E75D 3RGUA 5D90A 5KJ7C 4H13B 1LX8A 3L73E 4R4MA 5GQQA 2AEMA 2D2CC 2B89A 1CSBA 1NTZE 3VMZA 1JTHB 1CI6A 2HODB 4LC1A 1M1KQ 2HG5D 3HE4A 2XV5A 3I55P 1WMKA 2W6BA 2OARA 3AE4C 2YMYA 3AE9C 2E42A 3RK3B 5GTIH 4UB6H 1SQBK 2XU6A 2YMKA 1N73C 3H1LE 2O01N 4WBAA 3FGAD 2G8YA 3TDKA 5CCGD 1K05A 1BDCA 3GW6A 1NU1J 5B5EE 1LJ2A 2PP6A 2QEXP 1PV3A 5TISH 2Q9IA 2ZJSE 1IO4A 3BRVB 3H1KD 1AQ5A 4N78D 1SQVG 1AV1A 3MD0A 1HBWA 1LTAC 3AEEC 1Q2NA 2RMZA 3H25A 2MKVA 3CWBG 3EZ9A 3C1LA 4L74A 2AEJA 3RK2B 1JY2O 3EFFK 5CCGA 5BU5A 4IFDK 1SQBG 1HH0A 1YYCA 1P84D 4GOEA 2OYIC 3M0DA 5CMZA 5DJTB 1GL2D 1GDTA 1LNQA 1VQMP 3TGUE 1QVGO 5KAVA 3D6ZA 2HR3A 2I1JA 1L0LK 2NPSD 2ZVNB 1BE3E 1R5SA 1SQXE 5I41B 3L74E 1BOWA 4OGQB 3QH9A 5AVTB 1M56D 3CI9A 1P84H 1AFOA 3RK3E 1URQD 1SQXK 3LURA 1QL2A 1SQPJ 1FOSE 3CX5I 1NH4A 1NJIQ 1UIIA 1JMBA 2AEFA 4H0LC 1X79B 2HLOA 3KPEA 4QMAA 3AECC 1LTJA 2GUSA 1EDJA 3B5ND 1KB9H 2SPZA 3HE5A 1JYHA 1HGZA 1LTIC 1OIPA 1FZCA 1NTKK 1IK9A 1SQPK 1K9MQ 4YTPC 4EDFA 3WU2E 2WPSA 4N78E 3CMEP 2AXTE 2P7JA 1JUNA 3UIAA 4WLSA 3EWKA 3VYIA 1U57A 5B5EH 3H1HJ 1N7SA 5GTHE 1NTME 1KYOH 1YTZT 4AYCA 1KV4A 3L72D 3L71G 4Y28J 1BCCJ 3L73G 3C8VA 1RQVA 3Q2YA 1T3JA 3MUDC 4JYBA 3KDPB 2FYNC 4EYYQ 1NTMD 3M9QA 1JCCA 2P67A 1QLED 4U7JA 2FBWC 1NTMG 1MFZA 2QA4P 1Q81Q 1U7JA 1PP9D 4ASVA 4D6TG 3Q5PA 4I2LC 1J1EC 2FYUE 3GHGC 2GA1A 1MZ9A 1SQVJ 1GK4A 1ZMEC 5L8RJ 3W67A 1L0LD 2B87B 1N7LA 1LTGC 5B66E 2WTYA 5I44A 1OVRA 1EDKA 2KSEA 4PJ0E 2C9NY 5AVZB 2LXCB 2W90A 1SQPD 2FKWB 2K9JA 1BCCG 4U3FJ 5CJ0A 2Z4EA 2ZHGA 2IDBA 1T3UA 1URQA 1JEKA 2KK7A 2WQYC 2Q1KA 1BGYD 5AVXB 3GHGA 2YO3A 1Q86Q 1ZV8A 1IFDA 2OGUA 5KLVG 1KTMA 3CXHE 4AQRD 4JF7A 2XNDH 3MGNA 3NTNA 3KYQA 1ZLLA 1QEXA 1KB9I 2KYVA 5CCGC 1OXZA 3MZWB 2FFDA 1H0TB 2E5TA 5APYA 2YKQA 1H8AA 3MUDA 1GTWA 2OTJP 3HTKA 2KNCB 5TISE 3E1IA 1R5LA 2BCCG 4J2NA 2QSIA 4DCZA 1RF1A 2P2UA 2ZAEB 1L0LE 3CX5D 3USSA 3HD7C 1SQQK 1Q05A 1X22A 3G3ZA 1Y6UA 1KILE 4WLWA 1SQXD 2R3CA 2OYIB 3I56P 3KXDA 4BXLA 2BCCE 3EQ2A 2HFED 3V2RA 3L75E 3H1KJ 5BVZA 3RK3D 1EDLA 2M3BA 3FXDA 2YO2A 3PLNA 3U1CA 3L73J 4H44C 2A45I 2R32A 4PD4D 1LGHB 2C0WA 1X8YA 5CCHD 3A5TA 2N1TA 1YI2P 3PJSK 2WPVB 1K04A 3A3YB 4K35A 3SWKA 1G2CB 1N8RQ 4WY4B 1E79H 3PTZA 2WZ7A 2E76B 2IZ0A 2KOGA 1VDFA 3V6IA 3RL0D 3U59A 1L0NG 1GMJA 1VQOP 3TGUJ 3TNUB 1HJ0A 3CCSP 3L72E 5AW8B 3IAOA 2WSFH 1X9VA 1DIPA 3IF4A 3H32A 3Q5SA 3VP9A 4R22B 2IFNA 2Q3EA 3H1JG 1JOCA 1VQ8P 3KHUA 4PV1D 4OVNF 2WSFJ 3AE2C 2JMLA 1GU5A 3UCSA 1GL2A 2PRRA 4EOTA 2NPSB 1KYOD 1VL2A 1QX8A 2K1AA 2IBZD 4EIJA 1GZLA 1Q0AA 5AVSB 4TLFA 3CC4P 2KLVA 5H2FE 2R3SA 4O9BA 1S5LX 1OX3A 1KFNA 3G71P 1N7SD 1KQGB 3B71A 2N9BA 1PM6A 3IN6A 1KILB 4PD4E 2ZHHA 4DCKA 1WRGA 4AYZA 3HD7B 2PGDA 3FXEA 4R24B 5KAFH 2YNYA 2D2CB 1AQTA 3HUSB 3L70D 1ZW0A 4WY4A 3H1HE 1GK6A 3EZ6A 3L74D 1PIXA 1PGQA 1NTZJ 2QJPB 4IFMA 5AW1B 2QIWA 3AEGC 3P8CD 3GHGB 2FYNB 3PP5A 3G6EP 3CCRP 1G1JA 5CHXA 4XA4A 4I7ZC 1EZVI 2LR2A 5KJ7D 2R44A 3KZIH 3H1IE 1USDA 4JBZA 3GF7A 3SWYA 1HVVA 1RH5B 3H1LG 3LW5J 3LIDA 4UB8E 2WVRA 5KLVE 3RK3C 3AE5C 4JYCA 1NVOA 4H44B 1SQVE 3BCCE 3H1LD 3AE6C 3VMXA 4A7PA 5CCHC 1ZR2A 2QM7A 3PRJA 1XTCC 1YJWP 1RY3A 4Z1MH 1EZVD 2H43A 2JO1A 4AYZB 2CK3H 2ZT9D 1EXIA 1Q07A 3M9BA 1FJKA 2M5AB 1NU1D 3AE7C 4WB4A 1Y47A 2YKPA 3NXSA 3BCCG 4TT3H 3VMAA 2FFDC 1AA0A 2E76D 1M8OB 4NPFX 4WWIA 2J59M 1P84I 1VQNP 3B5NA 1EXJA 3V5BA 3VMYA 5E01A 2ZYDA 4D6TJ 2FYUD 1Q09A 4NPDA 1SQVK 1SS1A 1NTZD 1QL1A 1ZOYC 1ZRTD 1VQ7P 3HUSA 2Q6QA 3BRTB 2P10A 3CC2P 4PD4H 1JY2P 1ZR4A 1BE3D 4ZKUA 3RK2D 5KAFE 1SFCA 2KZJA 1KC8Q 2ZFCA 3HTKB 1VF5C 3V2NA 4XE5B 5C39A 2JWAA 2FFDB 2AXCA 3OAKA 1OW8A 3SWFA 4M3LA 4GDOA 4DJGA 5KLIB 1NHLA 2Y9YA 1L4AC 3CX5E 5AVRB 4HKZH 1NGMB 2E75C 5E79E 4KHXA 2WWWA 4GKGA 1LT9A 2FYZA 4K3AA 1LTSC 1AVOA 1VQLP 3Q5RA 3R2PA 4YXWH 2PFXA 2KNCA 2QJKC 1NTKG 5APVA 2ZT9C 1LTJB 1Y8AA 4MN4C 1IFIA 1T8ZA 1NTMK 1GU4A 5AW2B 2KSJA 1AJYA 1N7SB 2WSSH 5D8CA 3A2AA 3TNUA 1NTKD 4OH8B 3CCMP 3F89A 3N4XA 1NKZB 3BATA 1URQC 5CBNA 1SQQD 4W7YA 3B49A 3L72J 1N7SC 5CJ4A 2YIUB 1JY2N 3VTPC 1L2PA 1KZUB 3L71J 1VQ9P 2BCCJ 3L75J 1T2KD 1CZQA 3H1JJ 4L76A 2B9BA 3L71D 2DW3A 3L72G 5KKZB 2JWDA 4LHFA 4PV1C 2RH0A 2ITAA 3M0DC 5AW9B 3R8JA 5DJUB 3A0HE 3AEDC 5KLIC 2ZYAA 1KQLA 1CW5A 3HUSC 2M8RA 2IZ1A 2J58A 1FZGA 3K5BA 5AW6B 2YKOA 3CCJP 1BGYE 3L4FA 2POHA 1IZNB 2QJYB 3CWBE 1USEA 4WY4D 3RL0g 1FOSF 1S72P 1VQKP 4H0LB 5KAIE 1LT9C 1SFCB 3V4QA 2E74B 3G4SP 3U1AA 2ZT9B 3FX0A 4IL6X 1DX7A 1KB9D 3ITKA 2GOVA 1NU1K 1L0NJ 5E79H 2OTLP 3H1HD 1Z56A 1M1JA 2OYHA 1S3JA 2NPSA 1PP9E 1YBKA 3GF3A 2A06G 1FBMA 1KFMA 4JPZB 1BCCD 1S2EA 4IL6H 1LWUC 5K5GB 4N6JA 5EFWB 1OWAA 1PPJE 2ZYGA 3PHLA 2BASA 4B86A 5AW5B 1JY3N 1SQXG 3O8ZA 3E7KA 1HTLC 1Q08A 2K9JB 1KILD 2Y9ZA 1VQ5P 3BVHA 2OG0A 3II6A 1Q90D 1RE3C 1BSNA 2K3RA 1L4AA 1YHQP 5APQA 1BDDA 1FZEA 3CCUP 1J1DC 3GPVA 1G2CA 2XKMA 3HH0A 2JKVA 4ZKPA 5KCBA 3LW5H 1IFPA 3BCCD 4C7NA 3L36A 5KAUA 2OQQA 4EI2A 1XTGB 2I1KA 1IFJA 1IC2A 2N1TB 3R8KA 1S5LH 1D5YA 2ZVOB 3KZIE 2KS1B 4UB6E 1OVVA 1RF0C 1PPJG 1ZP0C 5KATA 4UB8H 5AVUB 2IEFA 3HD7D 2RKLA 3ZDMA 3T97B 2E76C 5CCHA 2YXRB 1RE4A 1P84E 1G1IA 2HPCB 3TK1A 1SQQJ 2A45G 5AVWB 1EC5A 1L4AD 4Y99B 3CCQP 5KLVJ 1L0ND 1L0NK 3CXHI 2W83C 2JJLA 2QRXA 1DH3A 2E5YA 1RE4C 5AVYB 2BCCD 1YQ3C 3NMDA 1H89A 2IYOA 3WUVA 2UWJE 1PPJD 2K9YA 1LTBC 2OTKE 2FY8A 1FZAA 1W5CE 4DT0A 1VF5D 1DD3A 2A06D 4U3FG 3RL0B 1A02J 2XDJA 1KYOE 2M3EA 1PL5A 1J1DB 2VRSA 2Y0EA 4BWNA 2MJZA 5APXA 1RQUA 2G3AA 3AE3C 1OZHA 4H13C 3GG2A 3D71A 3WUTA 3BCCJ 2Y0DA 4I1LA 1PGJA 1IFNA 1NOHA 2XZRA 4ZMDA 1SVFA 2NZ2A 1GW3A 1H0TA 3RBZA 1FAVA 2BEQD 1T2KC 1NTKJ 1JB0J 1SQBD 4B0YA 4N3YB 3PH0A 3L37A 4RJTA 2IBZG 1SFCD 3CCEP 1VQ4P 1MUUA 1KQFB 1EQ7A 1SQBJ 3B4SA 1LTTC 5B66H 3CX5H 1R8EA 4GOFA 4WY4C 1LWUA 3RL0C 5KTBA 2P1JA 1YITP 3CL3D 1NWQA 3WU2H 1Q7YQ 1KD1Q 1DD4A 1JY3P 3H1IJ 4D6TE 4LGDE 2HVAA 2CPBA 1TU3F 4CPGA 2D2CD 2J5UA 3SFEC 4C7RA 3EFGA 3H6PA 4R4LA 4C46A 2BEZF 3FWLA 1FS0E 2O01H 2XNXA 3JCUE 2E74C 1M1JB 2OYHB 3P8CE 1S1CX 5KAIH 3CXHH 2ZXXA 1SFCC 3TGUG 1SQPG 1VF5B 3L73D 3FWNA 4AUWA 1OVUA 1FDMA 1EZVG 2LKMA 3MHVA 1NAFA 1YTZI 3M91A 1VQPP 2FXPA 1S9KE 1OMIA 1ZN5A 4OGQC 2O1KA 3E1RA 3CWBD 3RBXA 1LT9B 1FZCB 5AW3B 4H0LD 1JMMA 4YXDC 4RKUJ 1OW7A 1N86A 2PAJA 4YPCA 1KYOI 1EZVE 1LP1B 3EZ7A 3GP4A 3CXHD 2WPRA 1BGYG 1L0NE 3Q1MA 1R8DA 3L71E 2NPSC 1DEEG 3A0HH 1FDIA 1N73A 1KILA 2IFMA 2KLUA 1MV8A 3AE1C 2OYOA 4HB1A 1RH6A 1KMIZ 3OA7A 1L0LG 2FYUK 2RN0A 2A06E 3GK6A 1N73B 1KORA
chains in the Genus database with same CATH topology
5KAXA 3UCSA 2OG0A 2E74C 1VF5D 3FGAD 1Q05A 1S1CX 4LHFA 1Q90D 4H44B 1Y6UA 3RK3E 1DD3A 1VL2A 3Q3DA 3AE6C 1OW8A 2G8YA 1KILE 2H88C 4PV1C 4WLWA 5L8RJ 1VF5B 3LURA 3EZFA 3R8JA 4GDOA 1K05A 2YIUC 3G9RA 3AEDC 1NYHA 5KLIC 4Z1MH 3GPVA 5I44A 1Q0AA 2E74D 3GMAA 1PL5A 1NGMB 2E75B 3HH0A 2JO1A 3AEBC 4AYZB 4H0LC 1PV3A 1RQUA 2E75C 2JP3A 3O6QA 2BOWA 2G3AA 2ZT9D 3E0HA 5KCBA 5M1BA 3D70A 3AECC 5KAWA 1EXIA 1Q07A 1OW6A 4XFJA 4H44C 3AE3C 5KAUA 2OQQA 3GLMA 1S5LX 4H13C 3D71A 3AE7C 2V7QJ 2FXPA 1HF9A 1JYHA 1OMIA 3AEEC 2KCUA 2ZHGA 3EZ2A 4OGQC 1MKMA 2IDBA 4YTPC 3H25A 1KQGB 3Q5RA 1FDOA 2MKVA 3RL0g 4YXDC 4TT3H 3R8KA 2WQYC 5KKZC 1D5YA 3B71A 3EZ9A 3ABVC 1PM6A 2H89C 3AE8C 4H0LB 3IN6A 2NZ2A 2QJKC 2ZHHA 2E76D 4H0LD 4AYZA 2E75D 4R24B 2ZT9C 2E74B 4WLSA 5D90A 4OGQD 4H13B 1LX8A 3QAOA 2BEQD 1Y9BA 1ZP0C 2WPVB 2ZT9B 1K04A 4RKUJ 3S9OA 1OW7A 5KATA 3EWKA 2IEFA 4R4MA 4IL6X 1KTMA 1U57A 2D2CB 3D6YA 1JB0J 3EZ7A 1AJYA 3T97B 5GQQA 4B0YA 3GP4A 2D2CC 5D8CA 2E76C 2GOVA 3EZ6A 4R4EA 1UIXA 2E76B 1EXJA 1PIXA 1ZRTE 4Y28J 3Q1MA 2DG6A 1R8DA 1ZMEC 1YQ4C 5E01A 1KQFB 1JBGA 1Q09A 1GMJA 3GF3A 2QJPC 2QIWA 1Q06A 3AEGC 3R4YA 4H13D 1FDIA 3C8VA 1RQVA 2O01J 3Q2YA 1ZOYC 1HJ0A 2FYNC 3AEAC 1R8EA 3B49A 3IAOA 5KAVA 3D6ZA 2WSEJ 1IK7A 1DIPA 2P10A 4I7ZB 4H44D 2WSCJ 3Q5SA 4I7ZC 4U7JA 3AE1C 3AEFC 2VZ4A 1WMKA 2FBWC 4R22B 1RH6A 1DD4A 1KMIZ 3AE4C 4J2NA 1YQ3C 4PV1B 2QJYC 1TU3F 2QSIA 2HVAA 3GF7A 3AE9C 2KVVA 4DCZA 1VF5C 3SFDC 2K9YA 5I41B 3LW5J 2D2CD 1Q08A 2J5UA 3SFEC 4PV1D 4R4LA 4A1MA 4KT0J 3GK6A 2WSFJ 3AE2C 2BEZF 3Q5PA 2JMLA 1BOWA 3AE5C 4OGQB 2YMKA 1KORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4M A;  1DIP A;  5KAX A;  5KCB A;  5KAU A;  2OQQ A;  3D6Y A;  3UCS A;  3D71 A;  3D70 A;  3T97 B;  5GQQ A;  4B0Y A;  3GP4 A;  1Q05 A;  3Q5S A;  1JYH A;  5D8C A;  2GOV A;  4R4E A;  2KCU A;  2ZHG A;  2VZ4 A;  3Q3D A;  4R22 B;  4WLW A;  1EXJ A;  5KAV A;  3LUR A;  3R8J A;  3Q5R A;  3R8K A;  3Q1M A;  2DG6 A;  1R8D A;  4J2N A;  1D5Y A;  3G9R A;  5E01 A;  2HVA A;  1JBG A;  1Q09 A;  1Q06 A;  3GPV A;  2ZHH A;  5I41 B;  5I44 A;  1Q0A A;  5KAW A;  2J5U A;  1Q08 A;  3HH0 A;  4R4L A;  4A1M A;  3Q2Y A;  4AYZ A;  4AYZ B;  3GK6 A;  4R24 B;  1BOW A;  4WLS A;  2JML A;  5D90 A;  3Q5P A;  1R8E A;  2BOW A;  3IAO A;  3QAO A;  3B49 A;  3E0H A;  3D6Z A;  5KAT A;  1EXI A;  1Q07 A; 
#chains in the Genus database with same CATH topology
 1GL2 C;  1S5L E;  3H1L J;  3NFQ A;  1LTJ C;  3N7N A;  1Q82 Q;  2WT7 A;  3SFD C;  3L75 D;  3WUU A;  2HPC A;  4W7Z A;  3BAS A;  1MFT A;  4IOI H;  2O3J A;  3H1H G;  3L70 E;  3W68 A;  1HWT C;  3GMA A;  1J2J B;  2JDI H;  5KAW A;  1FU1 A;  1W2E A;  2W6J H;  3H32 B;  2WSC H;  4Y99 C;  1PFI A;  2WMM A;  3HE5 B;  3HRN A;  3L70 G;  3S9O A;  3MIW A;  1JY3 O;  3D6Y A;  2Z5H A;  1BGY J;  1VQ6 P;  1A02 F;  1QVF O;  1EDI A;  2CPS A;  1JBG A;  2QJP C;  2QVA A;  3R4Y A;  4H13 D;  1NTZ K;  1NTZ G;  1BSH A;  3I5C A;  1HUC A;  2Q3I A;  3CLQ A;  5APS A;  3VP8 A;  1GW4 A;  3F5H A;  3SSU A;  4C7N B;  3CMA P;  2WIT A;  5AW4 B;  1PP9 J;  1NU1 E;  3C9I A;  3TYY A;  3P32 A;  3HE4 B;  1K8A Q;  2KB7 P;  3H1J E;  5KJ7 A;  2NRG A;  1JTH A;  5APT A;  1N2D C;  2KI7 B;  3S1K A;  3A0B H;  4I6M C;  1YJ9 P;  1SQV D;  3VN0 A;  4JQ0 D;  3G9R A;  1PGO A;  3L74 G;  2A45 H;  1PGP A;  3O6Q A;  2QJK B;  3E0H A;  1D7M A;  4W80 A;  5M1B A;  1OW6 A;  3P7K A;  3GLM A;  3V2Q A;  1YJN P;  3OW2 O;  3V4W A;  1SP4 A;  3CWB J;  2IX7 C;  3EZ2 A;  5KKZ C;  3TF5 A;  3MP7 B;  2KZI A;  1SQQ E;  2ZXE B;  1LT1 A;  3O6Q B;  2N1T C;  2C0X A;  1SLQ A;  4R4E A;  1UIX A;  3A7O A;  1VPC A;  1NTM J;  2WPQ A;  1IJD B;  3OJA B;  2WT7 B;  4GIF A;  1BE3 J;  5H2F H;  3L74 J;  1E5W A;  2WSE J;  2KIK A;  2WSC J;  3IFM A;  3H1I D;  2O1J A;  2KS1 A;  4PD4 I;  2V7Q H;  5KLV D;  1WT6 A;  2KVV A;  1IFM A;  1JM0 A;  4A1M A;  1KQS O;  1M90 Q;  2P58 A;  3KQG A;  1H88 A;  1M1J C;  2OYH C;  3Q3D A;  2H88 C;  1QGK B;  3P8M C;  2I8D A;  1SQX J;  1W2B O;  2E74 D;  2E75 B;  3AEB C;  2BOW A;  5APW A;  2B88 A;  4L75 A;  4U3F D;  3CC7 P;  2FXO A;  4IFF A;  1NAY A;  5GTI E;  3MTU E;  4DOJ A;  1URQ B;  2FXM A;  1SQP E;  3A0B E;  1KIL C;  2H89 C;  1BCC E;  5AVQ B;  1HJB A;  2Q5U A;  4OGQ D;  1RF0 A;  3QAO A;  1Y9B A;  3WMM 0;  1L4A B;  3CCL P;  2IBZ E;  2B87 A;  3JCU H;  2QM8 A;  1GL2 B;  1JO5 A;  1ZRT E;  3M0A A;  5AVV B;  2DG6 A;  1YQ4 C;  1GD2 E;  1M57 D;  1Q06 A;  2K37 A;  2W27 A;  2IBZ I;  2N9Y B;  3AEA C;  3T97 A;  1IK7 A;  4HH2 A;  4I7Z B;  4H44 D;  2FYU J;  4BRY A;  3AEF C;  5BU8 B;  2E43 A;  3CCV P;  4LLH A;  1KN7 A;  2QJY C;  2W6A A;  3H1I G;  2M0B A;  1PZQ A;  1JNM A;  1K73 Q;  2R5B A;  1L0L J;  1RE3 A;  2KUB A;  3B8E B;  5KAX A;  5GTH H;  5TJH A;  1HGV A;  3JSV C;  1PP9 G;  2Q7C A;  4HYT B;  2GUV A;  2QE7 H;  2JEE A;  3EZF A;  1X0T A;  3M9H A;  2YIU C;  1NYH A;  1AVY A;  2Y0C A;  1S4X A;  1FZB A;  4RO0 A;  2C9L Y;  1RHZ B;  3V2P A;  2JP3 A;  4WVZ A;  3D70 A;  4NPE A;  4XFJ A;  5AW0 B;  4KJM A;  3S4R A;  3L75 G;  3IR9 A;  1FE6 A;  2V7Q J;  4BRY B;  1HF9 A;  1RF1 B;  2L91 A;  1MKM A;  1NU1 G;  1LWU B;  3L35 A;  1FDO A;  4L73 A;  5KLV K;  3ABV C;  4ASW A;  2L5G B;  2WSE H;  2R5D A;  1YIJ P;  2GM4 A;  2OYI A;  3VOP A;  1NTK E;  1CI6 B;  2HOD A;  2HYN A;  5APU A;  3TGU D;  4U3F E;  1BE3 G;  1T6A A;  1FZC C;  4DZO A;  3CD6 P;  1NO4 A;  2H7H A;  2IYP A;  4ZNC A;  1KB9 E;  1SQB E;  4PJ0 H;  2O01 J;  4HJG H;  1FZF A;  2FYU G;  2V4H A;  2AXT H;  1FC2 C;  4D6T D;  1NKN A;  1DEB A;  1FJP A;  2H8P D;  4OWF A;  2VZ4 A;  4GOD A;  1ZXG A;  3B5N C;  2KXP B;  4PV1 B;  1SQQ G;  3LIE A;  5CBO A;  2K88 A;  1JCD A;  4KT0 J;  3M06 A;  4GT1 A;  1J1E B;  2LXB A;  3RK2 C;  2YXQ B;  2KP8 A;  3B5N B;  3H1J D;  1LP1 A;  3CPW O;  3H1K G;  3QWO C;  2N1T D;  3TSI A;  1U7M A;  3JC2 2;  2W8Z A;  4IL6 E;  5AW7 B;  2IPP A;  3HD7 A;  1M7L A;  2QG4 A;  2Z5I A;  2KCU A;  1OFC X;  1RF1 C;  1S9K D;  2M5A A;  2JR8 A;  3AE8 C;  3L70 J;  4RES B;  3H1K E;  2E75 D;  3RGU A;  5D90 A;  5KJ7 C;  4H13 B;  1LX8 A;  3L73 E;  4R4M A;  5GQQ A;  2AEM A;  2D2C C;  2B89 A;  1CSB A;  1NTZ E;  3VMZ A;  1JTH B;  1CI6 A;  2HOD B;  4LC1 A;  1M1K Q;  2HG5 D;  3HE4 A;  2XV5 A;  3I55 P;  1WMK A;  2W6B A;  2OAR A;  3AE4 C;  2YMY A;  3AE9 C;  2E42 A;  3RK3 B;  5GTI H;  4UB6 H;  1SQB K;  2XU6 A;  2YMK A;  1N73 C;  3H1L E;  2O01 N;  4WBA A;  3FGA D;  2G8Y A;  3TDK A;  5CCG D;  1K05 A;  1BDC A;  3GW6 A;  1NU1 J;  5B5E E;  1LJ2 A;  2PP6 A;  2QEX P;  1PV3 A;  5TIS H;  2Q9I A;  2ZJS E;  1IO4 A;  3BRV B;  3H1K D;  1AQ5 A;  4N78 D;  1SQV G;  1AV1 A;  3MD0 A;  1HBW A;  1LTA C;  3AEE C;  1Q2N A;  2RMZ A;  3H25 A;  2MKV A;  3CWB G;  3EZ9 A;  3C1L A;  4L74 A;  2AEJ A;  3RK2 B;  1JY2 O;  3EFF K;  5CCG A;  5BU5 A;  4IFD K;  1SQB G;  1HH0 A;  1YYC A;  1P84 D;  4GOE A;  2OYI C;  3M0D A;  5CMZ A;  5DJT B;  1GL2 D;  1GDT A;  1LNQ A;  1VQM P;  3TGU E;  1QVG O;  5KAV A;  3D6Z A;  2HR3 A;  2I1J A;  1L0L K;  2NPS D;  2ZVN B;  1BE3 E;  1R5S A;  1SQX E;  5I41 B;  3L74 E;  1BOW A;  4OGQ B;  3QH9 A;  5AVT B;  1M56 D;  3CI9 A;  1P84 H;  1AFO A;  3RK3 E;  1URQ D;  1SQX K;  3LUR A;  1QL2 A;  1SQP J;  1FOS E;  3CX5 I;  1NH4 A;  1NJI Q;  1UII A;  1JMB A;  2AEF A;  4H0L C;  1X79 B;  2HLO A;  3KPE A;  4QMA A;  3AEC C;  1LTJ A;  2GUS A;  1EDJ A;  3B5N D;  1KB9 H;  2SPZ A;  3HE5 A;  1JYH A;  1HGZ A;  1LTI C;  1OIP A;  1FZC A;  1NTK K;  1IK9 A;  1SQP K;  1K9M Q;  4YTP C;  4EDF A;  3WU2 E;  2WPS A;  4N78 E;  3CME P;  2AXT E;  2P7J A;  1JUN A;  3UIA A;  4WLS A;  3EWK A;  3VYI A;  1U57 A;  5B5E H;  3H1H J;  1N7S A;  5GTH E;  1NTM E;  1KYO H;  1YTZ T;  4AYC A;  1KV4 A;  3L72 D;  3L71 G;  4Y28 J;  1BCC J;  3L73 G;  3C8V A;  1RQV A;  3Q2Y A;  1T3J A;  3MUD C;  4JYB A;  3KDP B;  2FYN C;  4EYY Q;  1NTM D;  3M9Q A;  1JCC A;  2P67 A;  1QLE D;  4U7J A;  2FBW C;  1NTM G;  1MFZ A;  2QA4 P;  1Q81 Q;  1U7J A;  1PP9 D;  4ASV A;  4D6T G;  3Q5P A;  4I2L C;  1J1E C;  2FYU E;  3GHG C;  2GA1 A;  1MZ9 A;  1SQV J;  1GK4 A;  1ZME C;  5L8R J;  3W67 A;  1L0L D;  2B87 B;  1N7L A;  1LTG C;  5B66 E;  2WTY A;  5I44 A;  1OVR A;  1EDK A;  2KSE A;  4PJ0 E;  2C9N Y;  5AVZ B;  2LXC B;  2W90 A;  1SQP D;  2FKW B;  2K9J A;  1BCC G;  4U3F J;  5CJ0 A;  2Z4E A;  2ZHG A;  2IDB A;  1T3U A;  1URQ A;  1JEK A;  2KK7 A;  2WQY C;  2Q1K A;  1BGY D;  5AVX B;  3GHG A;  2YO3 A;  1Q86 Q;  1ZV8 A;  1IFD A;  2OGU A;  5KLV G;  1KTM A;  3CXH E;  4AQR D;  4JF7 A;  2XND H;  3MGN A;  3NTN A;  3KYQ A;  1ZLL A;  1QEX A;  1KB9 I;  2KYV A;  5CCG C;  1OXZ A;  3MZW B;  2FFD A;  1H0T B;  2E5T A;  5APY A;  2YKQ A;  1H8A A;  3MUD A;  1GTW A;  2OTJ P;  3HTK A;  2KNC B;  5TIS E;  3E1I A;  1R5L A;  2BCC G;  4J2N A;  2QSI A;  4DCZ A;  1RF1 A;  2P2U A;  2ZAE B;  1L0L E;  3CX5 D;  3USS A;  3HD7 C;  1SQQ K;  1Q05 A;  1X22 A;  3G3Z A;  1Y6U A;  1KIL E;  4WLW A;  1SQX D;  2R3C A;  2OYI B;  3I56 P;  3KXD A;  4BXL A;  2BCC E;  3EQ2 A;  2HFE D;  3V2R A;  3L75 E;  3H1K J;  5BVZ A;  3RK3 D;  1EDL A;  2M3B A;  3FXD A;  2YO2 A;  3PLN A;  3U1C A;  3L73 J;  4H44 C;  2A45 I;  2R32 A;  4PD4 D;  1LGH B;  2C0W A;  1X8Y A;  5CCH D;  3A5T A;  2N1T A;  1YI2 P;  3PJS K;  2WPV B;  1K04 A;  3A3Y B;  4K35 A;  3SWK A;  1G2C B;  1N8R Q;  4WY4 B;  1E79 H;  3PTZ A;  2WZ7 A;  2E76 B;  2IZ0 A;  2KOG A;  1VDF A;  3V6I A;  3RL0 D;  3U59 A;  1L0N G;  1GMJ A;  1VQO P;  3TGU J;  3TNU B;  1HJ0 A;  3CCS P;  3L72 E;  5AW8 B;  3IAO A;  2WSF H;  1X9V A;  1DIP A;  3IF4 A;  3H32 A;  3Q5S A;  3VP9 A;  4R22 B;  2IFN A;  2Q3E A;  3H1J G;  1JOC A;  1VQ8 P;  3KHU A;  4PV1 D;  4OVN F;  2WSF J;  3AE2 C;  2JML A;  1GU5 A;  3UCS A;  1GL2 A;  2PRR A;  4EOT A;  2NPS B;  1KYO D;  1VL2 A;  1QX8 A;  2K1A A;  2IBZ D;  4EIJ A;  1GZL A;  1Q0A A;  5AVS B;  4TLF A;  3CC4 P;  2KLV A;  5H2F E;  2R3S A;  4O9B A;  1S5L X;  1OX3 A;  1KFN A;  3G71 P;  1N7S D;  1KQG B;  3B71 A;  2N9B A;  1PM6 A;  3IN6 A;  1KIL B;  4PD4 E;  2ZHH A;  4DCK A;  1WRG A;  4AYZ A;  3HD7 B;  2PGD A;  3FXE A;  4R24 B;  5KAF H;  2YNY A;  2D2C B;  1AQT A;  3HUS B;  3L70 D;  1ZW0 A;  4WY4 A;  3H1H E;  1GK6 A;  3EZ6 A;  3L74 D;  1PIX A;  1PGQ A;  1NTZ J;  2QJP B;  4IFM A;  5AW1 B;  2QIW A;  3AEG C;  3P8C D;  3GHG B;  2FYN B;  3PP5 A;  3G6E P;  3CCR P;  1G1J A;  5CHX A;  4XA4 A;  4I7Z C;  1EZV I;  2LR2 A;  5KJ7 D;  2R44 A;  3KZI H;  3H1I E;  1USD A;  4JBZ A;  3GF7 A;  3SWY A;  1HVV A;  1RH5 B;  3H1L G;  3LW5 J;  3LID A;  4UB8 E;  2WVR A;  5KLV E;  3RK3 C;  3AE5 C;  4JYC A;  1NVO A;  4H44 B;  1SQV E;  3BCC E;  3H1L D;  3AE6 C;  3VMX A;  4A7P A;  5CCH C;  1ZR2 A;  2QM7 A;  3PRJ A;  1XTC C;  1YJW P;  1RY3 A;  4Z1M H;  1EZV D;  2H43 A;  2JO1 A;  4AYZ B;  2CK3 H;  2ZT9 D;  1EXI A;  1Q07 A;  3M9B A;  1FJK A;  2M5A B;  1NU1 D;  3AE7 C;  4WB4 A;  1Y47 A;  2YKP A;  3NXS A;  3BCC G;  4TT3 H;  3VMA A;  2FFD C;  1AA0 A;  2E76 D;  1M8O B;  4NPF X;  4WWI A;  2J59 M;  1P84 I;  1VQN P;  3B5N A;  1EXJ A;  3V5B A;  3VMY A;  5E01 A;  2ZYD A;  4D6T J;  2FYU D;  1Q09 A;  4NPD A;  1SQV K;  1SS1 A;  1NTZ D;  1QL1 A;  1ZOY C;  1ZRT D;  1VQ7 P;  3HUS A;  2Q6Q A;  3BRT B;  2P10 A;  3CC2 P;  4PD4 H;  1JY2 P;  1ZR4 A;  1BE3 D;  4ZKU A;  3RK2 D;  5KAF E;  1SFC A;  2KZJ A;  1KC8 Q;  2ZFC A;  3HTK B;  1VF5 C;  3V2N A;  4XE5 B;  5C39 A;  2JWA A;  2FFD B;  2AXC A;  3OAK A;  1OW8 A;  3SWF A;  4M3L A;  4GDO A;  4DJG A;  5KLI B;  1NHL A;  2Y9Y A;  1L4A C;  3CX5 E;  5AVR B;  4HKZ H;  1NGM B;  2E75 C;  5E79 E;  4KHX A;  2WWW A;  4GKG A;  1LT9 A;  2FYZ A;  4K3A A;  1LTS C;  1AVO A;  1VQL P;  3Q5R A;  3R2P A;  4YXW H;  2PFX A;  2KNC A;  2QJK C;  1NTK G;  5APV A;  2ZT9 C;  1LTJ B;  1Y8A A;  4MN4 C;  1IFI A;  1T8Z A;  1NTM K;  1GU4 A;  5AW2 B;  2KSJ A;  1AJY A;  1N7S B;  2WSS H;  5D8C A;  3A2A A;  3TNU A;  1NTK D;  4OH8 B;  3CCM P;  3F89 A;  3N4X A;  1NKZ B;  3BAT A;  1URQ C;  5CBN A;  1SQQ D;  4W7Y A;  3B49 A;  3L72 J;  1N7S C;  5CJ4 A;  2YIU B;  1JY2 N;  3VTP C;  1L2P A;  1KZU B;  3L71 J;  1VQ9 P;  2BCC J;  3L75 J;  1T2K D;  1CZQ A;  3H1J J;  4L76 A;  2B9B A;  3L71 D;  2DW3 A;  3L72 G;  5KKZ B;  2JWD A;  4LHF A;  4PV1 C;  2RH0 A;  2ITA A;  3M0D C;  5AW9 B;  3R8J A;  5DJU B;  3A0H E;  3AED C;  5KLI C;  2ZYA A;  1KQL A;  1CW5 A;  3HUS C;  2M8R A;  2IZ1 A;  2J58 A;  1FZG A;  3K5B A;  5AW6 B;  2YKO A;  3CCJ P;  1BGY E;  3L4F A;  2POH A;  1IZN B;  2QJY B;  3CWB E;  1USE A;  4WY4 D;  3RL0 g;  1FOS F;  1S72 P;  1VQK P;  4H0L B;  5KAI E;  1LT9 C;  1SFC B;  3V4Q A;  2E74 B;  3G4S P;  3U1A A;  2ZT9 B;  3FX0 A;  4IL6 X;  1DX7 A;  1KB9 D;  3ITK A;  2GOV A;  1NU1 K;  1L0N J;  5E79 H;  2OTL P;  3H1H D;  1Z56 A;  1M1J A;  2OYH A;  1S3J A;  2NPS A;  1PP9 E;  1YBK A;  3GF3 A;  2A06 G;  1FBM A;  1KFM A;  4JPZ B;  1BCC D;  1S2E A;  4IL6 H;  1LWU C;  5K5G B;  4N6J A;  5EFW B;  1OWA A;  1PPJ E;  2ZYG A;  3PHL A;  2BAS A;  4B86 A;  5AW5 B;  1JY3 N;  1SQX G;  3O8Z A;  3E7K A;  1HTL C;  1Q08 A;  2K9J B;  1KIL D;  2Y9Z A;  1VQ5 P;  3BVH A;  2OG0 A;  3II6 A;  1Q90 D;  1RE3 C;  1BSN A;  2K3R A;  1L4A A;  1YHQ P;  5APQ A;  1BDD A;  1FZE A;  3CCU P;  1J1D C;  3GPV A;  1G2C A;  2XKM A;  3HH0 A;  2JKV A;  4ZKP A;  5KCB A;  3LW5 H;  1IFP A;  3BCC D;  4C7N A;  3L36 A;  5KAU A;  2OQQ A;  4EI2 A;  1XTG B;  2I1K A;  1IFJ A;  1IC2 A;  2N1T B;  3R8K A;  1S5L H;  1D5Y A;  2ZVO B;  3KZI E;  2KS1 B;  4UB6 E;  1OVV A;  1RF0 C;  1PPJ G;  1ZP0 C;  5KAT A;  4UB8 H;  5AVU B;  2IEF A;  3HD7 D;  2RKL A;  3ZDM A;  3T97 B;  2E76 C;  5CCH A;  2YXR B;  1RE4 A;  1P84 E;  1G1I A;  2HPC B;  3TK1 A;  1SQQ J;  2A45 G;  5AVW B;  1EC5 A;  1L4A D;  4Y99 B;  3CCQ P;  5KLV J;  1L0N D;  1L0N K;  3CXH I;  2W83 C;  2JJL A;  2QRX A;  1DH3 A;  2E5Y A;  1RE4 C;  5AVY B;  2BCC D;  1YQ3 C;  3NMD A;  1H89 A;  2IYO A;  3WUV A;  2UWJ E;  1PPJ D;  2K9Y A;  1LTB C;  2OTK E;  2FY8 A;  1FZA A;  1W5C E;  4DT0 A;  1VF5 D;  1DD3 A;  2A06 D;  4U3F G;  3RL0 B;  1A02 J;  2XDJ A;  1KYO E;  2M3E A;  1PL5 A;  1J1D B;  2VRS A;  2Y0E A;  4BWN A;  2MJZ A;  5APX A;  1RQU A;  2G3A A;  3AE3 C;  1OZH A;  4H13 C;  3GG2 A;  3D71 A;  3WUT A;  3BCC J;  2Y0D A;  4I1L A;  1PGJ A;  1IFN A;  1NOH A;  2XZR A;  4ZMD A;  1SVF A;  2NZ2 A;  1GW3 A;  1H0T A;  3RBZ A;  1FAV A;  2BEQ D;  1T2K C;  1NTK J;  1JB0 J;  1SQB D;  4B0Y A;  4N3Y B;  3PH0 A;  3L37 A;  4RJT A;  2IBZ G;  1SFC D;  3CCE P;  1VQ4 P;  1MUU A;  1KQF B;  1EQ7 A;  1SQB J;  3B4S A;  1LTT C;  5B66 H;  3CX5 H;  1R8E A;  4GOF A;  4WY4 C;  1LWU A;  3RL0 C;  5KTB A;  2P1J A;  1YIT P;  3CL3 D;  1NWQ A;  3WU2 H;  1Q7Y Q;  1KD1 Q;  1DD4 A;  1JY3 P;  3H1I J;  4D6T E;  4LGD E;  2HVA A;  2CPB A;  1TU3 F;  4CPG A;  2D2C D;  2J5U A;  3SFE C;  4C7R A;  3EFG A;  3H6P A;  4R4L A;  4C46 A;  2BEZ F;  3FWL A;  1FS0 E;  2O01 H;  2XNX A;  3JCU E;  2E74 C;  1M1J B;  2OYH B;  3P8C E;  1S1C X;  5KAI H;  3CXH H;  2ZXX A;  1SFC C;  3TGU G;  1SQP G;  1VF5 B;  3L73 D;  3FWN A;  4AUW A;  1OVU A;  1FDM A;  1EZV G;  2LKM A;  3MHV A;  1NAF A;  1YTZ I;  3M91 A;  1VQP P;  2FXP A;  1S9K E;  1OMI A;  1ZN5 A;  4OGQ C;  2O1K A;  3E1R A;  3CWB D;  3RBX A;  1LT9 B;  1FZC B;  5AW3 B;  4H0L D;  1JMM A;  4YXD C;  4RKU J;  1OW7 A;  1N86 A;  2PAJ A;  4YPC A;  1KYO I;  1EZV E;  1LP1 B;  3EZ7 A;  3GP4 A;  3CXH D;  2WPR A;  1BGY G;  1L0N E;  3Q1M A;  1R8D A;  3L71 E;  2NPS C;  1DEE G;  3A0H H;  1FDI A;  1N73 A;  1KIL A;  2IFM A;  2KLU A;  1MV8 A;  3AE1 C;  2OYO A;  4HB1 A;  1RH6 A;  1KMI Z;  3OA7 A;  1L0L G;  2FYU K;  2RN0 A;  2A06 E;  3GK6 A;  1N73 B;  1KOR A; 
#chains in the Genus database with same CATH homology
 5KAX A;  3UCS A;  2OG0 A;  2E74 C;  1VF5 D;  3FGA D;  1Q05 A;  1S1C X;  4LHF A;  1Q90 D;  4H44 B;  1Y6U A;  3RK3 E;  1DD3 A;  1VL2 A;  3Q3D A;  3AE6 C;  1OW8 A;  2G8Y A;  1KIL E;  2H88 C;  4PV1 C;  4WLW A;  5L8R J;  1VF5 B;  3LUR A;  3EZF A;  3R8J A;  4GDO A;  1K05 A;  2YIU C;  3G9R A;  3AED C;  1NYH A;  5KLI C;  4Z1M H;  3GPV A;  5I44 A;  1Q0A A;  2E74 D;  3GMA A;  1PL5 A;  1NGM B;  2E75 B;  3HH0 A;  2JO1 A;  3AEB C;  4AYZ B;  4H0L C;  1PV3 A;  1RQU A;  2E75 C;  2JP3 A;  3O6Q A;  2BOW A;  2G3A A;  2ZT9 D;  3E0H A;  5KCB A;  5M1B A;  3D70 A;  3AEC C;  5KAW A;  1EXI A;  1Q07 A;  1OW6 A;  4XFJ A;  4H44 C;  3AE3 C;  5KAU A;  2OQQ A;  3GLM A;  1S5L X;  4H13 C;  3D71 A;  3AE7 C;  2V7Q J;  2FXP A;  1HF9 A;  1JYH A;  1OMI A;  3AEE C;  2KCU A;  2ZHG A;  3EZ2 A;  4OGQ C;  1MKM A;  2IDB A;  4YTP C;  3H25 A;  1KQG B;  3Q5R A;  1FDO A;  2MKV A;  3RL0 g;  4YXD C;  4TT3 H;  3R8K A;  2WQY C;  5KKZ C;  1D5Y A;  3B71 A;  3EZ9 A;  3ABV C;  1PM6 A;  2H89 C;  3AE8 C;  4H0L B;  3IN6 A;  2NZ2 A;  2QJK C;  2ZHH A;  2E76 D;  4H0L D;  4AYZ A;  2E75 D;  4R24 B;  2ZT9 C;  2E74 B;  4WLS A;  5D90 A;  4OGQ D;  4H13 B;  1LX8 A;  3QAO A;  2BEQ D;  1Y9B A;  1ZP0 C;  2WPV B;  2ZT9 B;  1K04 A;  4RKU J;  3S9O A;  1OW7 A;  5KAT A;  3EWK A;  2IEF A;  4R4M A;  4IL6 X;  1KTM A;  1U57 A;  2D2C B;  3D6Y A;  1JB0 J;  3EZ7 A;  1AJY A;  3T97 B;  5GQQ A;  4B0Y A;  3GP4 A;  2D2C C;  5D8C A;  2E76 C;  2GOV A;  3EZ6 A;  4R4E A;  1UIX A;  2E76 B;  1EXJ A;  1PIX A;  1ZRT E;  4Y28 J;  3Q1M A;  2DG6 A;  1R8D A;  1ZME C;  1YQ4 C;  5E01 A;  1KQF B;  1JBG A;  1Q09 A;  1GMJ A;  3GF3 A;  2QJP C;  2QIW A;  1Q06 A;  3AEG C;  3R4Y A;  4H13 D;  1FDI A;  3C8V A;  1RQV A;  2O01 J;  3Q2Y A;  1ZOY C;  1HJ0 A;  2FYN C;  3AEA C;  1R8E A;  3B49 A;  3IAO A;  5KAV A;  3D6Z A;  2WSE J;  1IK7 A;  1DIP A;  2P10 A;  4I7Z B;  4H44 D;  2WSC J;  3Q5S A;  4I7Z C;  4U7J A;  3AE1 C;  3AEF C;  2VZ4 A;  1WMK A;  2FBW C;  4R22 B;  1RH6 A;  1DD4 A;  1KMI Z;  3AE4 C;  4J2N A;  1YQ3 C;  4PV1 B;  2QJY C;  1TU3 F;  2QSI A;  2HVA A;  3GF7 A;  3AE9 C;  2KVV A;  4DCZ A;  1VF5 C;  3SFD C;  2K9Y A;  5I41 B;  3LW5 J;  2D2C D;  1Q08 A;  2J5U A;  3SFE C;  4PV1 D;  4R4L A;  4A1M A;  4KT0 J;  3GK6 A;  2WSF J;  3AE2 C;  2BEZ F;  3Q5P A;  2JML A;  1BOW A;  3AE5 C;  4OGQ B;  2YMK A;  1KOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...