3Q3DA

Crystal structure of bmrr bound to puromycin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna/antibiotic
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q3dA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q3dA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q3dA03
1DIPA 4AYZA 1JYHA 4R22B 4B0YA 4R4LA 4AYZB 3T97B 3E0HA 1BOWA 1Q08A 4WLSA 2ZHGA 4J2NA 5KATA 3Q2YA 4WLWA 3QAOA 3UCSA 3Q3DA 5KAXA 5D90A 3G9RA 2HVAA 5E01A 2OQQA 1JBGA 2GOVA 5GQQA 1Q05A 3Q5RA 4R4MA 2VZ4A 3Q1MA 1R8DA 2J5UA 1D5YA 3D70A 1Q09A 5I41B 4R24B 2JMLA 1Q07A 4R4EA 2KCUA 3IAOA 5KAVA 1Q0AA 5KCBA 3GP4A 3GPVA 1EXIA 1EXJA 2BOWA 1R8EA 5I44A 4A1MA 5KAUA 3R8KA 3B49A 1Q06A 3D71A 3D6YA 3Q5SA 2DG6A 2ZHHA 3Q5PA 3GK6A 3D6ZA 3HH0A 5D8CA 5KAWA 3R8JA 3LURA
chains in the Genus database with same CATH superfamily
2FYNC 4WY4A 3CX5I 2O01H 1L0LJ 2C9NY 3QAOA 1TU3F 1RE3A 3M0AA 3FGAD 4JBZA 3AE2C 3NFQA 1T3UA 1J2JB 1QX8A 1ZXGA 5BVZA 5APYA 1IFJA 4K3AA 2O01N 4L74A 1JY2N 2M5AB 4EIJA 3L72J 3H25A 2H43A 3A0BH 3Q5RA 1D5YA 5KLVE 3I5CA 1N73C 4DCZA 3PTZA 2KP8A 2M3BA 2A06E 3H1LJ 3V2NA 2R32A 5CMZA 2LR2A 2K37A 2FYZA 1OZHA 3G4SP 3HD7B 1JY2O 1GL2B 1T2KD 5KAVA 3B71A 3AEAC 1VQ7P 1IO4A 5KLIB 3ITKA 2KLVA 4AYZA 1LP1A 3EZFA 1N7SD 4Y99C 5KAXA 5B66E 1AJYA 3L74E 2PGDA 2B9BA 2IYOA 2RN0A 2W6AA 3B5NA 1MZ9A 2E75C 2FKWB 3H1HJ 3VMXA 1GZLA 2GUSA 2HR3A 3N7NA 1HH0A 5AW9B 1J1EB 2YO3A 1BCCJ 3AE7C 3L73G 2PAJA 3CCEP 1KILB 1LTJC 2KNCA 2O3JA 3RL0g 3G3ZA 1G2CB 5APSA 5CCHA 2W27A 5KLVK 1YI2P 4W7ZA 1VQKP 1ZW0A 2B89A 2K1AA 2K9JA 3D71A 1LTTC 4PD4I 1K8AQ 1FU1A 3CL3D 1KMIZ 3BRVB 3NMDA 2D2CB 1CSBA 1M90Q 1NH4A 2IFNA 4N78D 1EZVD 4U3FE 1NVOA 1RHZB 1ZRTD 5AW7B 1D7MA 2NPSB 1PPJG 2N9YB 1EDJA 4PV1D 2WSCJ 4GKGA 3CC4P 5AW8B 2KCUA 3KDPB 1OFCX 1NTMJ 1KQGB 1RF1C 4C7NA 3HUSB 5CBOA 3Q5PA 5AVYB 1IFMA 4AYZB 1LP1B 1SQPE 1X22A 4JYCA 1PP9J 2KB7P 3U1CA 5CCGA 1CZQA 3VMAA 5KLVD 1J1DB 1YJWP 4ASVA 3RK2D 3B5NB 4D6TE 5CJ0A 3S1KA 1S5LE 2YXQB 1YQ4C 2QJPB 2A06G 3M06A 1NTKJ 1LTSC 3M9BA 1YITP 1VF5D 3PP5A 1H0TA 3VTPC 2E43A 2IBZI 2KNCB 1SQVJ 1A02F 1FJKA 1DH3A 3GPVA 3V4QA 2PRRA 3CCRP 2K9JB 4C46A 2IBZG 3R8JA 3L35A 1LTAC 4B0YA 1HGVA 2AEFA 3L74D 1JOCA 3KZIH 5AVVB 5I41B 1HF9A 4DZOA 1BE3G 3L74G 4UB8H 1FZCA 3L75G 5GTHH 4W80A 2WZ7A 1SQPK 1KFMA 3TGUD 5D90A 1ZN5A 2OTKE 1Q05A 2AXCA 2FFDA 4H0LC 1SQBE 2PFXA 1OMIA 1G1IA 2Q9IA 4A1MA 2W6JH 4C7NB 1LJ2A 4H13B 4HB1A 3HTKB 1YTZI 1PFIA 1W5CE 2Y9YA 1QEXA 2E74C 4DT0A 4R24B 3L72E 2QJYC 3M9HA 3O6QB 5AVZB 1FZGA 3EZ7A 4U3FD 1M7LA 4EDFA 1VQ9P 4WY4C 1FDMA 1WMKA 2E75D 4L75A 3H1LE 1E79H 2OYIC 3WUVA 3F5HA 1OVVA 2P58A 2ITAA 1PZQA 5APTA 2MKVA 4R22B 1BGYE 4QMAA 1SQPD 1U7MA 1VL2A 1IFPA 1VQOP 1MKMA 2BEQD 2KZJA 3C9IA 2K9YA 2P2UA 4D6TD 3CWBE 4IL6E 2OARA 3IR9A 2DG6A 1FZCB 3AE5C 1Y47A 3H1HE 1PGJA 3L70E 2QJKC 4BXLA 3B8EB 2OYOA 3L4FA 2FFDB 3CCMP 2O1JA 1SQQE 3KYQA 1L0NG 2NRGA 2YO2A 4NPFX 3CX5E 2WPRA 2BCCE 2KI7B 2LXCB 2E5YA 3BRTB 2WITA 3U1AA 2KS1A 3NTNA 1DX7A 1S3JA 1Q7YQ 2N9BA 3MUDC 1Q86Q 5APXA 2NZ2A 2ZVOB 1VQLP 1SQBD 2W83C 1S5LX 3VN0A 1DEEG 3IAOA 4IFFA 3A5TA 3CMEP 1L0LG 3RBZA 2C0WA 1LTBC 4H44B 3L72D 1SQQK 5AW5B 3P32A 1FJPA 3L72G 2QEXP 1SQXE 5BU5A 2M5AA 1YBKA 2ZHGA 3BCCJ 4WLWA 3KPEA 2IEFA 3IFMA 2AXTH 4GOEA 1VQMP 5CJ4A 2J5UA 1W2EA 3H1LG 4CPGA 2GUVA 2VRSA 1G1JA 4ZNCA 1NTZJ 2C9LY 1NJIQ 2JO1A 3B49A 1SQVE 5APUA 4H0LD 2G8YA 2XZRA 3L73E 1BGYD 1X9VA 3EQ2A 3HD7A 3MIWA 3HE4A 1BGYG 2GOVA 3H1JJ 1KYOI 3GP4A 1SS1A 3CWBD 2GM4A 3LIDA 3V6IA 3CXHH 2E74D 1UIXA 1E5WA 2JDIH 4U7JA 3SSUA 1LT1A 4GOFA 2KS1B 1JYHA 3L70D 3CCSP 2Q3IA 1Q82Q 4EYYQ 4PD4E 5CHXA 3H1HG 4YXWH 2E76C 4WY4D 1S1CX 1SQQD 1NO4A 2ZT9B 3AE4C 5KJ7A 5BU8B 3P7KA 1PPJE 3GHGA 1BCCG 1SQXK 2XNDH 5KKZB 3EFGA 1URQC 1M1JC 2N1TA 3FXEA 1EQ7A 2WMMA 3H1IE 1KILA 3CX5D 1G2CA 1LNQA 2BCCD 4RESB 1FZEA 5CBNA 2FYUE 2OTJP 1LT9C 2JKVA 1SQVK 4HH2A 2BCCG 2YMYA 1L4AA 5B5EE 3V2RA 4I7ZC 3RGUA 1AQTA 2Y0CA 3JCUE 1N86A 4IL6X 5AW3B 3L71J 4YPCA 2YIUC 1EC5A 2ZXEB 3H1KJ 1GW4A 1H88A 1XTGB 1W2BO 1SFCC 2A45I 2NPSA 1NTMG 3II6A 3HE4B 1NWQA 2QE7H 2QIWA 1NHLA 2IBZE 2WSSH 1JMBA 1SVFA 3HUSA 1RF0C 1YTZT 4XA4A 5K5GB 1SQXD 1PP9G 2HFED 3CCJP 1M56D 2DW3A 1RY3A 1SQXG 3G9RA 3O8ZA 1VQ5P 1BE3E 2MJZA 3EWKA 3RK3B 1Q0AA 4IOIH 3L75E 2ZYDA 1CW5A 2FYUK 1FAVA 1NTKG 3AEBC 3CMAP 3L73D 2M0BA 4N6JA 1Q90D 3GHGB 5APQA 2POHA 3VP9A 1SQVG 2N1TB 2Z5HA 1NYHA 1LWUC 2QVAA 1NU1J 1IK9A 2R5DA 2R3SA 1GK6A 1OVUA 2W6BA 1N7SA 1IJDB 1YHQP 2HLOA 1KQLA 1T6AA 2ZAEB 1EDKA 1JY3P 1L4AB 1RE4A 1RH5B 2CK3H 4PD4D 2OG0A 4XFJA 1LTGC 4HYTB 2OYHA 1N8RQ 4C7RA 1JUNA 2SPZA 2BEZF 2WPSA 3A0BE 1FBMA 2YKPA 1PPJD 4RKUJ 1Z56A 1YJ9P 1MV8A 5H2FH 2XV5A 3PJSK 2WSFH 3H1ID 4M3LA 1QVGO 4I1LA 5AW2B 2JP3A 4NPEA 2WVRA 2AEMA 3GG2A 3H1IG 3SFDC 3RL0C 2BOWA 1NGMB 2FYUD 3R4YA 2E42A 4GT1A 1VQ8P 4OH8B 2CPBA 1OX3A 2FYUG 1QL2A 2I1JA 3E0HA 3HTKA 1IK7A 3LW5J 1X79B 3EZ6A 1EXIA 3O6QA 2A06D 4MN4C 1DEBA 1N2DC 2E76D 1KN7A 3LURA 1QL1A 2LKMA 4J2NA 1KB9H 1L2PA 5APVA 4WBAA 3AE9C 2VZ4A 4XE5B 3BVHA 2QA4P 2Q1KA 2IBZD 1URQD 1P84H 1L0NE 1N7SB 3CXHI 1IFNA 3OAKA 1PL5A 2I8DA 1S72P 3IF4A 1DD3A 1A02J 3K5BA 1RQVA 1BE3D 4R4MA 1Q81Q 2OYHB 1K9MQ 3L75D 2YKQA 1KYOH 1PIXA 1HWTC 1Q2NA 3S9OA 1JY2P 3HD7C 1YIJP 2UWJE 1FC2C 2QSIA 1GL2C 1FDOA 1SFCD 3AE6C 4TT3H 1L0LE 1R5SA 1JEKA 2W90A 5KLIC 2YMKA 2ZHHA 2FY8A 1OW6A 4OGQD 2Q6QA 1JBGA 2HODA 4UB6H 3AEGC 1S4XA 1N73A 5AVTB 1L0NK 2R44A 1JMMA 1ZV8A 1MFTA 4PV1B 1J1EC 4YTPC 2O1KA 1RE3C 5TISH 1KILC 3Q2YA 2WQYC 1KB9E 3FXDA 2WSCH 1JCDA 3GLMA 1Y8AA 3KXDA 2XKMA 3U59A 2JJLA 1P84E 1KC8Q 3MGNA 1FOSE 5KLVJ 4GODA 1IZNB 2QM7A 2A45H 2C0XA 2D2CC 3RK2B 3KQGA 3LW5H 1CI6B 5KCBA 1L0LK 1RH6A 3BATA 3KZIE 3VP8A 4A7PA 3HRNA 1VF5B 1KYOE 4UB8E 2NPSC 3C8VA 5GTHE 2H7HA 4AYCA 3TDKA 2FYNB 1BSHA 1VQ4P 3H6PA 1NTZG 1LTJA 3WUUA 1GW3A 4I2LC 4ZMDA 5KTBA 1L0ND 1BCCE 1KILE 2FXOA 4ZKUA 3L74J 2XNXA 1GTWA 5D8CA 2Y9ZA 1Y9BA 1FDIA 3RL0D 1J1DC 1H8AA 2HODB 3B5NC 2IYPA 1JB0J 1N73B 3SWKA 3TGUJ 2QJPC 1ZLLA 5AVUB 3D6YA 3I55P 1LTIC 3TK1A 1YYCA 5KAIH 1HJBA 1S2EA 5CCHC 2HVAA 5TISE 3VOPA 2J58A 1HUCA 5E79H 3WMM0 2QRXA 2YNYA 2K88A 1IC2A 1L0LD 3C1LA 1ZMEC 4Z1MH 3NXSA 1MFZA 1OIPA 1RF1A 1NTME 3UIAA 2KLUA 4OVNF 4U3FJ 2M3EA 4Y99B 5DJUB 2H88C 3E1IA 1PP9E 1QGKB 2E75B 2LXBA 2P10A 3GK6A 2KIKA 1OW7A 1KB9I 3CI9A 3H1LD 3CD6P 3TYYA 3L71G 2OTLP 1PGPA 4WWIA 1QVFO 1N7LA 1LTJB 3HD7D 4R4EA 4BWNA 1NTKE 1P84I 1SQPJ 1LX8A 3A0HH 1GL2D 4H13C 2P67A 4O9BA 4D6TJ 5CCGC 2OGUA 4B86A 1JY3O 3WUTA 1VPCA 2FXPA 2WT7A 2E5TA 4EI2A 1KYOD 3L36A 1S9KE 4NPDA 1NTMK 3A7OA 3H1HD 4JF7A 2Z4EA 4YXDC 1EDIA 2WPVB 2Q7CA 1FZBA 3F89A 1FZFA 2HPCA 5KAIE 3W68A 5KAFH 1K73Q 1BCCD 1BSNA 1R8EA 1KILD 2L91A 3IN6A 1RF1B 2ZFCA 3E1RA 1FE6A 2AEJA 4LLHA 5AW6B 4KJMA 1OW8A 2RH0A 3GF3A 1NTKK 1AVYA 5AVRB 4RJTA 3CC7P 1ZR4A 1FZCC 2D2CD 3R8KA 1M8OB 3M0DA 3RBXA 1SQBJ 2YXRB 1ZRTE 3CCUP 3VMZA 3AE1C 3UCSA 4I6MC 3VMYA 2FFDC 2KSEA 4IFDK 4BRYA 2OYIA 1GDTA 2NPSD 2B87A 2AXTE 3OW2O 4EOTA 1IFDA 3A0HE 3E7KA 1NTMD 1KQSO 3S4RA 3EZ2A 2R3CA 1HVVA 3GW6A 2Y0DA 1Q09A 1AA0A 2JMLA 2KXPB 2WT7B 1GU5A 1PP9D 1FOSF 2A45G 4DOJA 4OGQC 2PP6A 2WPQA 3B5ND 2KVVA 4N3YB 3CXHE 2QM8A 1GMJA 3MZWB 5AVSB 4ZKPA 2XU6A 3MTUE 3Q1MA 2HPCB 1NTKD 4JQ0D 3SFEC 1BGYJ 4H0LB 5KAFE 5CCHD 1PGOA 1SQVD 2FXMA 4H44C 1VQPP 3CWBJ 1WT6A 3EFFK 4RO0A 1S5LH 2E74B 3D70A 5DJTB 3SWYA 3L70J 1LGHB 2B88A 2QJYB 1RQUA 4OWFA 1S9KD 3GF7A 2JEEA 4WY4B 2V7QJ 1JM0A 1SQQJ 2BASA 3TGUE 1NAFA 3MUDA 5E01A 1SLQA 4BRYB 2OYIB 3OJAB 2B87B 1EXJA 2KUBA 2W8ZA 3I56P 5KAUA 4GIFA 3AEDC 2RMZA 2BCCJ 1DD4A 2WSEJ 5L8RJ 4H13D 3A2AA 1PGQA 2WWWA 1EZVI 3JSVC 3W67A 5CCGD 3TSIA 1OVRA 1USEA 2KYVA 5AW0B 3D6ZA 1DIPA 1GD2E 4TLFA 3CCLP 1EZVG 1Q08A 2IFMA 3CC2P 2QJKB 1JTHA 1JNMA 1H89A 3M9QA 4W7YA 3BCCE 2ZT9C 1K04A 3V2QA 3ABVC 3PH0A 5KKZC 1AQ5A 1R5LA 4PJ0H 4Y28J 5AW1B 2GA1A 2CPSA 1NTZE 2JWAA 3JC22 4DJGA 1SQXJ 1EDLA 3MD0A 3SWFA 3USSA 3GMAA 1KTMA 5KLVG 1Q06A 1K05A 3H1JE 3CXHD 4R4LA 3FWLA 2IZ0A 1U57A 3AE8C 5EFWB 1KZUB 3L73J 3CLQA 1GU4A 1HTLC 1CI6A 3TF5A 5I44A 3MP7B 4LHFA 1OWAA 3P8MC 5GTIH 2HYNA 1AVOA 3H32A 1VDFA 4K35A 2HG5D 5C39A 1URQA 1M1JA 3G71P 3HE5A 5H2FE 1X8YA 2KOGA 3AEEC 4IL6H 2IDBA 1LT9A 1NOHA 1M57D 1NKZB 2K3RA 2ZVNB 3T97A 3PLNA 1NTZK 1ZP0C 2WTYA 3KHUA 2V7QH 2QG4A 3ZDMA 4ASWA 1JTHB 3RK3C 2FBWC 3TGUG 4WB4A 3BASA 1T8ZA 5KJ7C 3H1IJ 3GHGC 3AE3C 5KAWA 3L71E 2N1TC 2JWDA 1NKNA 4PJ0E 3CX5H 1SFCA 2L5GB 2FYUJ 3A3YB 2WSEH 2OQQA 2Q5UA 3H1KE 1JCCA 2Z5IA 4H44D 3FX0A 1BDDA 1HGZA 3M0DC 1L4AC 1FZAA 1RF0A 4U3FG 3P8CE 5KATA 1H0TB 1SP4A 1QLED 1M1KQ 2E76B 3AEFC 3BCCD 5AVQB 3Q5SA 4IFMA 3RK3E 3BCCG 1XTCC 2I1KA 3H32B 1NTZD 1BOWA 1Y6UA 4JPZB 5GTIE 1URQB 1M1JB 3HE5B 1SQPG 1LWUA 1SQBK 2KZIA 3AECC 1FS0E 3N4XA 3TNUA 3HUSC 1NU1E 3MHVA 4D6TG 1LT9B 1BE3J 3H1JD 2IPPA 3T97B 1IFIA 1KV4A 3VYIA 4WLSA 3L75J 4I7ZB 3H1JG 1USDA 4AQRD 1UIIA 5AVXB 1R8DA 4HJGH 2RKLA 3LIEA 5M1BA 3CCVP 4UB6E 1KD1Q 2YIUB 1GK4A 2O01J 2KSJA 1T2KC 4LGDE 1X0TA 2G3AA 4DCKA 2ZT9D 1SFCB 1PM6A 2ZXXA 1T3JA 3EZ9A 5APWA 3WU2H 5AVWB 1Q07A 1KQFB 1N7SC 1KORA 2ZYAA 3QWOC 2M8RA 3R2PA 2ZJSE 4OGQB 3CCQP 4PD4H 1RE4C 1ZR2A 4AUWA 4L73A 4GDOA 2OYHC 1BDCA 1PV3A 2ZYGA 1SQBG 1NAYA 1NU1K 2Q3EA 4LC1A 1JO5A 3L71D 1HBWA 5AW4B 1JY3N 3L37A 1AFOA 3H1KD 1VQ6P 1KB9D 1LWUB 1YQ3C 3H1KG 5B5EH 3TNUB 3CPWO 4L76A 1P84D 3HH0A 1OXZA 2P7JA 3P8CD 3PHLA 1YJNP 3JCUH 1MUUA 1VQNP 5TJHA 1AV1A 3B4SA 4PV1C 4KT0J 3RK3D 3V2PA 4JYBA 2Y0EA 2H89C 1HJ0A 3FWNA 3OA7A 2P1JA 1L0NJ 1ZOYC 3Q3DA 5KJ7D 3V4WA 5GQQA 2IX7C 1GL2A 4WVZA 2N1TD 3WU2E 1NU1D 5E79E 3RL0B 3CWBG 3G6EP 3QH9A 5B66H 2KK7A 1NU1G 3RK2C 4KHXA 2JR8A 2J59M 2H8PD 3PRJA 3L70G 1L4AD 4HKZH 3V5BA 1WRGA 2V4HA 1KFNA 2YKOA 1VF5C 2XDJA 2R5BA 3M91A 1U7JA 4N78E 1EZVE 1SQQG 2IZ1A 2WSFJ
chains in the Genus database with same CATH topology
1JYHA 2FYNC 1FDIA 1WMKA 3E0HA 1DD4A 3EZ2A 2E75D 2WSEJ 1BOWA 1IK7A 1Y6UA 3QAOA 1TU3F 1VF5D 3AE7C 3LW5J 5L8RJ 1OW6A 4OGQD 3G9RA 2NZ2A 3FGAD 3RL0g 1JBGA 4H13D 2E76C 3AEEC 1S5LX 3AE2C 3AEGC 1Q09A 3EWKA 1YQ3C 2JMLA 3IAOA 1S1CX 1Q0AA 2FXPA 3GPVA 3AECC 3EZ6A 1EXIA 1JB0J 3O6QA 2IDBA 2QJPC 3AEBC 2ZT9B 3D71A 3D6YA 3AE4C 4OGQC 2E76D 3D6ZA 3HH0A 4PV1B 1Q90D 3R8JA 4YTPC 3LURA 2KVVA 2MKVA 1DIPA 4R22B 4B0YA 3T97B 4H44B 1Q08A 4WLSA 4J2NA 1GMJA 3Q2YA 1VL2A 1ZP0C 2WQYC 4I7ZB 1NYHA 4YXDC 1KMIZ 2WPVB 2HVAA 3H25A 1MKMA 2BEQD 3Q5RA 2D2CB 2VZ4A 3Q1MA 1R8DA 3AE9C 2K9YA 3RK3E 1D5YA 2FBWC 5I41B 4DCZA 5M1BA 3SFEC 4H0LB 1HF9A 3GLMA 1R8EA 2ZT9C 1K04A 1ZMEC 3ABVC 4Z1MH 4PV1C 5KKZC 4KT0J 3IN6A 2DG6A 3AE3C 4H44C 2O01J 5KAWA 3AE5C 4Y28J 1PL5A 4I7ZC 2G3AA 2H89C 2ZHGA 1HJ0A 2QJKC 4WLWA 2ZT9D 2IEFA 1DD3A 1ZOYC 3Q3DA 2D2CC 5D90A 2OG0A 4PV1D 1RQVA 4XFJA 1PM6A 2OQQA 2WSCJ 5GQQA 3EZ9A 1Q05A 4R4MA 2J5UA 1OW8A 3D70A 2E74B 4H0LC 2H88C 4H44D 4IL6X 1Q07A 1OMIA 3GF3A 2KCUA 5KAVA 1KQFB 3B71A 5KCBA 3GMAA 2BEZF 1KORA 1RH6A 1PIXA 2YIUC 1KQGB 1KTMA 4A1MA 2E75B 2D2CD 2JO1A 3R8KA 1RQUA 3B49A 1Q06A 3AEAC 3S9OA 1VF5B 2P10A 3Q5PA 1K05A 3GK6A 4OGQB 4H0LD 2G8YA 4RKUJ 3GF7A 4AYZA 1ZRTE 3EZFA 3C8VA 4H13B 4R4LA 4AYZB 2V7QJ 1OW7A 5KATA 4GDOA 3AE1C 3UCSA 5KAXA 1U57A 2E74C 2QSIA 3AE8C 5E01A 1AJYA 2GOVA 1PV3A 2JP3A 4R24B 4R4EA 1FDOA 2E76B 3AEFC 3GP4A 2E75C 3SFDC 3AE6C 2QIWA 2QJYC 1EXJA 4TT3H 2BOWA 1NGMB 5I44A 1LX8A 3R4YA 1VF5C 1KILE 3EZ7A 5KLIC 5KAUA 2E74D 1UIXA 3Q5SA 2YMKA 3AEDC 2ZHHA 4H13C 2WSFJ 4U7JA 4LHFA 5D8CA 1YQ4C 1Y9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DIP A;  4AYZ A;  1JYH A;  4R22 B;  4B0Y A;  4R4L A;  4AYZ B;  3T97 B;  3E0H A;  1BOW A;  1Q08 A;  4WLS A;  2ZHG A;  4J2N A;  5KAT A;  3Q2Y A;  4WLW A;  3QAO A;  3UCS A;  3Q3D A;  5KAX A;  5D90 A;  3G9R A;  2HVA A;  5E01 A;  2OQQ A;  1JBG A;  2GOV A;  5GQQ A;  1Q05 A;  3Q5R A;  4R4M A;  2VZ4 A;  3Q1M A;  1R8D A;  2J5U A;  1D5Y A;  3D70 A;  1Q09 A;  5I41 B;  4R24 B;  2JML A;  1Q07 A;  4R4E A;  2KCU A;  3IAO A;  5KAV A;  1Q0A A;  5KCB A;  3GP4 A;  3GPV A;  1EXI A;  1EXJ A;  2BOW A;  1R8E A;  5I44 A;  4A1M A;  5KAU A;  3R8K A;  3B49 A;  1Q06 A;  3D71 A;  3D6Y A;  3Q5S A;  2DG6 A;  2ZHH A;  3Q5P A;  3GK6 A;  3D6Z A;  3HH0 A;  5D8C A;  5KAW A;  3R8J A;  3LUR A; 
#chains in the Genus database with same CATH topology
 2FYN C;  4WY4 A;  3CX5 I;  2O01 H;  1L0L J;  2C9N Y;  3QAO A;  1TU3 F;  1RE3 A;  3M0A A;  3FGA D;  4JBZ A;  3AE2 C;  3NFQ A;  1T3U A;  1J2J B;  1QX8 A;  1ZXG A;  5BVZ A;  5APY A;  1IFJ A;  4K3A A;  2O01 N;  4L74 A;  1JY2 N;  2M5A B;  4EIJ A;  3L72 J;  3H25 A;  2H43 A;  3A0B H;  3Q5R A;  1D5Y A;  5KLV E;  3I5C A;  1N73 C;  4DCZ A;  3PTZ A;  2KP8 A;  2M3B A;  2A06 E;  3H1L J;  3V2N A;  2R32 A;  5CMZ A;  2LR2 A;  2K37 A;  2FYZ A;  1OZH A;  3G4S P;  3HD7 B;  1JY2 O;  1GL2 B;  1T2K D;  5KAV A;  3B71 A;  3AEA C;  1VQ7 P;  1IO4 A;  5KLI B;  3ITK A;  2KLV A;  4AYZ A;  1LP1 A;  3EZF A;  1N7S D;  4Y99 C;  5KAX A;  5B66 E;  1AJY A;  3L74 E;  2PGD A;  2B9B A;  2IYO A;  2RN0 A;  2W6A A;  3B5N A;  1MZ9 A;  2E75 C;  2FKW B;  3H1H J;  3VMX A;  1GZL A;  2GUS A;  2HR3 A;  3N7N A;  1HH0 A;  5AW9 B;  1J1E B;  2YO3 A;  1BCC J;  3AE7 C;  3L73 G;  2PAJ A;  3CCE P;  1KIL B;  1LTJ C;  2KNC A;  2O3J A;  3RL0 g;  3G3Z A;  1G2C B;  5APS A;  5CCH A;  2W27 A;  5KLV K;  1YI2 P;  4W7Z A;  1VQK P;  1ZW0 A;  2B89 A;  2K1A A;  2K9J A;  3D71 A;  1LTT C;  4PD4 I;  1K8A Q;  1FU1 A;  3CL3 D;  1KMI Z;  3BRV B;  3NMD A;  2D2C B;  1CSB A;  1M90 Q;  1NH4 A;  2IFN A;  4N78 D;  1EZV D;  4U3F E;  1NVO A;  1RHZ B;  1ZRT D;  5AW7 B;  1D7M A;  2NPS B;  1PPJ G;  2N9Y B;  1EDJ A;  4PV1 D;  2WSC J;  4GKG A;  3CC4 P;  5AW8 B;  2KCU A;  3KDP B;  1OFC X;  1NTM J;  1KQG B;  1RF1 C;  4C7N A;  3HUS B;  5CBO A;  3Q5P A;  5AVY B;  1IFM A;  4AYZ B;  1LP1 B;  1SQP E;  1X22 A;  4JYC A;  1PP9 J;  2KB7 P;  3U1C A;  5CCG A;  1CZQ A;  3VMA A;  5KLV D;  1J1D B;  1YJW P;  4ASV A;  3RK2 D;  3B5N B;  4D6T E;  5CJ0 A;  3S1K A;  1S5L E;  2YXQ B;  1YQ4 C;  2QJP B;  2A06 G;  3M06 A;  1NTK J;  1LTS C;  3M9B A;  1YIT P;  1VF5 D;  3PP5 A;  1H0T A;  3VTP C;  2E43 A;  2IBZ I;  2KNC B;  1SQV J;  1A02 F;  1FJK A;  1DH3 A;  3GPV A;  3V4Q A;  2PRR A;  3CCR P;  2K9J B;  4C46 A;  2IBZ G;  3R8J A;  3L35 A;  1LTA C;  4B0Y A;  1HGV A;  2AEF A;  3L74 D;  1JOC A;  3KZI H;  5AVV B;  5I41 B;  1HF9 A;  4DZO A;  1BE3 G;  3L74 G;  4UB8 H;  1FZC A;  3L75 G;  5GTH H;  4W80 A;  2WZ7 A;  1SQP K;  1KFM A;  3TGU D;  5D90 A;  1ZN5 A;  2OTK E;  1Q05 A;  2AXC A;  2FFD A;  4H0L C;  1SQB E;  2PFX A;  1OMI A;  1G1I A;  2Q9I A;  4A1M A;  2W6J H;  4C7N B;  1LJ2 A;  4H13 B;  4HB1 A;  3HTK B;  1YTZ I;  1PFI A;  1W5C E;  2Y9Y A;  1QEX A;  2E74 C;  4DT0 A;  4R24 B;  3L72 E;  2QJY C;  3M9H A;  3O6Q B;  5AVZ B;  1FZG A;  3EZ7 A;  4U3F D;  1M7L A;  4EDF A;  1VQ9 P;  4WY4 C;  1FDM A;  1WMK A;  2E75 D;  4L75 A;  3H1L E;  1E79 H;  2OYI C;  3WUV A;  3F5H A;  1OVV A;  2P58 A;  2ITA A;  1PZQ A;  5APT A;  2MKV A;  4R22 B;  1BGY E;  4QMA A;  1SQP D;  1U7M A;  1VL2 A;  1IFP A;  1VQO P;  1MKM A;  2BEQ D;  2KZJ A;  3C9I A;  2K9Y A;  2P2U A;  4D6T D;  3CWB E;  4IL6 E;  2OAR A;  3IR9 A;  2DG6 A;  1FZC B;  3AE5 C;  1Y47 A;  3H1H E;  1PGJ A;  3L70 E;  2QJK C;  4BXL A;  3B8E B;  2OYO A;  3L4F A;  2FFD B;  3CCM P;  2O1J A;  1SQQ E;  3KYQ A;  1L0N G;  2NRG A;  2YO2 A;  4NPF X;  3CX5 E;  2WPR A;  2BCC E;  2KI7 B;  2LXC B;  2E5Y A;  3BRT B;  2WIT A;  3U1A A;  2KS1 A;  3NTN A;  1DX7 A;  1S3J A;  1Q7Y Q;  2N9B A;  3MUD C;  1Q86 Q;  5APX A;  2NZ2 A;  2ZVO B;  1VQL P;  1SQB D;  2W83 C;  1S5L X;  3VN0 A;  1DEE G;  3IAO A;  4IFF A;  3A5T A;  3CME P;  1L0L G;  3RBZ A;  2C0W A;  1LTB C;  4H44 B;  3L72 D;  1SQQ K;  5AW5 B;  3P32 A;  1FJP A;  3L72 G;  2QEX P;  1SQX E;  5BU5 A;  2M5A A;  1YBK A;  2ZHG A;  3BCC J;  4WLW A;  3KPE A;  2IEF A;  3IFM A;  2AXT H;  4GOE A;  1VQM P;  5CJ4 A;  2J5U A;  1W2E A;  3H1L G;  4CPG A;  2GUV A;  2VRS A;  1G1J A;  4ZNC A;  1NTZ J;  2C9L Y;  1NJI Q;  2JO1 A;  3B49 A;  1SQV E;  5APU A;  4H0L D;  2G8Y A;  2XZR A;  3L73 E;  1BGY D;  1X9V A;  3EQ2 A;  3HD7 A;  3MIW A;  3HE4 A;  1BGY G;  2GOV A;  3H1J J;  1KYO I;  3GP4 A;  1SS1 A;  3CWB D;  2GM4 A;  3LID A;  3V6I A;  3CXH H;  2E74 D;  1UIX A;  1E5W A;  2JDI H;  4U7J A;  3SSU A;  1LT1 A;  4GOF A;  2KS1 B;  1JYH A;  3L70 D;  3CCS P;  2Q3I A;  1Q82 Q;  4EYY Q;  4PD4 E;  5CHX A;  3H1H G;  4YXW H;  2E76 C;  4WY4 D;  1S1C X;  1SQQ D;  1NO4 A;  2ZT9 B;  3AE4 C;  5KJ7 A;  5BU8 B;  3P7K A;  1PPJ E;  3GHG A;  1BCC G;  1SQX K;  2XND H;  5KKZ B;  3EFG A;  1URQ C;  1M1J C;  2N1T A;  3FXE A;  1EQ7 A;  2WMM A;  3H1I E;  1KIL A;  3CX5 D;  1G2C A;  1LNQ A;  2BCC D;  4RES B;  1FZE A;  5CBN A;  2FYU E;  2OTJ P;  1LT9 C;  2JKV A;  1SQV K;  4HH2 A;  2BCC G;  2YMY A;  1L4A A;  5B5E E;  3V2R A;  4I7Z C;  3RGU A;  1AQT A;  2Y0C A;  3JCU E;  1N86 A;  4IL6 X;  5AW3 B;  3L71 J;  4YPC A;  2YIU C;  1EC5 A;  2ZXE B;  3H1K J;  1GW4 A;  1H88 A;  1XTG B;  1W2B O;  1SFC C;  2A45 I;  2NPS A;  1NTM G;  3II6 A;  3HE4 B;  1NWQ A;  2QE7 H;  2QIW A;  1NHL A;  2IBZ E;  2WSS H;  1JMB A;  1SVF A;  3HUS A;  1RF0 C;  1YTZ T;  4XA4 A;  5K5G B;  1SQX D;  1PP9 G;  2HFE D;  3CCJ P;  1M56 D;  2DW3 A;  1RY3 A;  1SQX G;  3G9R A;  3O8Z A;  1VQ5 P;  1BE3 E;  2MJZ A;  3EWK A;  3RK3 B;  1Q0A A;  4IOI H;  3L75 E;  2ZYD A;  1CW5 A;  2FYU K;  1FAV A;  1NTK G;  3AEB C;  3CMA P;  3L73 D;  2M0B A;  4N6J A;  1Q90 D;  3GHG B;  5APQ A;  2POH A;  3VP9 A;  1SQV G;  2N1T B;  2Z5H A;  1NYH A;  1LWU C;  2QVA A;  1NU1 J;  1IK9 A;  2R5D A;  2R3S A;  1GK6 A;  1OVU A;  2W6B A;  1N7S A;  1IJD B;  1YHQ P;  2HLO A;  1KQL A;  1T6A A;  2ZAE B;  1EDK A;  1JY3 P;  1L4A B;  1RE4 A;  1RH5 B;  2CK3 H;  4PD4 D;  2OG0 A;  4XFJ A;  1LTG C;  4HYT B;  2OYH A;  1N8R Q;  4C7R A;  1JUN A;  2SPZ A;  2BEZ F;  2WPS A;  3A0B E;  1FBM A;  2YKP A;  1PPJ D;  4RKU J;  1Z56 A;  1YJ9 P;  1MV8 A;  5H2F H;  2XV5 A;  3PJS K;  2WSF H;  3H1I D;  4M3L A;  1QVG O;  4I1L A;  5AW2 B;  2JP3 A;  4NPE A;  2WVR A;  2AEM A;  3GG2 A;  3H1I G;  3SFD C;  3RL0 C;  2BOW A;  1NGM B;  2FYU D;  3R4Y A;  2E42 A;  4GT1 A;  1VQ8 P;  4OH8 B;  2CPB A;  1OX3 A;  2FYU G;  1QL2 A;  2I1J A;  3E0H A;  3HTK A;  1IK7 A;  3LW5 J;  1X79 B;  3EZ6 A;  1EXI A;  3O6Q A;  2A06 D;  4MN4 C;  1DEB A;  1N2D C;  2E76 D;  1KN7 A;  3LUR A;  1QL1 A;  2LKM A;  4J2N A;  1KB9 H;  1L2P A;  5APV A;  4WBA A;  3AE9 C;  2VZ4 A;  4XE5 B;  3BVH A;  2QA4 P;  2Q1K A;  2IBZ D;  1URQ D;  1P84 H;  1L0N E;  1N7S B;  3CXH I;  1IFN A;  3OAK A;  1PL5 A;  2I8D A;  1S72 P;  3IF4 A;  1DD3 A;  1A02 J;  3K5B A;  1RQV A;  1BE3 D;  4R4M A;  1Q81 Q;  2OYH B;  1K9M Q;  3L75 D;  2YKQ A;  1KYO H;  1PIX A;  1HWT C;  1Q2N A;  3S9O A;  1JY2 P;  3HD7 C;  1YIJ P;  2UWJ E;  1FC2 C;  2QSI A;  1GL2 C;  1FDO A;  1SFC D;  3AE6 C;  4TT3 H;  1L0L E;  1R5S A;  1JEK A;  2W90 A;  5KLI C;  2YMK A;  2ZHH A;  2FY8 A;  1OW6 A;  4OGQ D;  2Q6Q A;  1JBG A;  2HOD A;  4UB6 H;  3AEG C;  1S4X A;  1N73 A;  5AVT B;  1L0N K;  2R44 A;  1JMM A;  1ZV8 A;  1MFT A;  4PV1 B;  1J1E C;  4YTP C;  2O1K A;  1RE3 C;  5TIS H;  1KIL C;  3Q2Y A;  2WQY C;  1KB9 E;  3FXD A;  2WSC H;  1JCD A;  3GLM A;  1Y8A A;  3KXD A;  2XKM A;  3U59 A;  2JJL A;  1P84 E;  1KC8 Q;  3MGN A;  1FOS E;  5KLV J;  4GOD A;  1IZN B;  2QM7 A;  2A45 H;  2C0X A;  2D2C C;  3RK2 B;  3KQG A;  3LW5 H;  1CI6 B;  5KCB A;  1L0L K;  1RH6 A;  3BAT A;  3KZI E;  3VP8 A;  4A7P A;  3HRN A;  1VF5 B;  1KYO E;  4UB8 E;  2NPS C;  3C8V A;  5GTH E;  2H7H A;  4AYC A;  3TDK A;  2FYN B;  1BSH A;  1VQ4 P;  3H6P A;  1NTZ G;  1LTJ A;  3WUU A;  1GW3 A;  4I2L C;  4ZMD A;  5KTB A;  1L0N D;  1BCC E;  1KIL E;  2FXO A;  4ZKU A;  3L74 J;  2XNX A;  1GTW A;  5D8C A;  2Y9Z A;  1Y9B A;  1FDI A;  3RL0 D;  1J1D C;  1H8A A;  2HOD B;  3B5N C;  2IYP A;  1JB0 J;  1N73 B;  3SWK A;  3TGU J;  2QJP C;  1ZLL A;  5AVU B;  3D6Y A;  3I55 P;  1LTI C;  3TK1 A;  1YYC A;  5KAI H;  1HJB A;  1S2E A;  5CCH C;  2HVA A;  5TIS E;  3VOP A;  2J58 A;  1HUC A;  5E79 H;  3WMM 0;  2QRX A;  2YNY A;  2K88 A;  1IC2 A;  1L0L D;  3C1L A;  1ZME C;  4Z1M H;  3NXS A;  1MFZ A;  1OIP A;  1RF1 A;  1NTM E;  3UIA A;  2KLU A;  4OVN F;  4U3F J;  2M3E A;  4Y99 B;  5DJU B;  2H88 C;  3E1I A;  1PP9 E;  1QGK B;  2E75 B;  2LXB A;  2P10 A;  3GK6 A;  2KIK A;  1OW7 A;  1KB9 I;  3CI9 A;  3H1L D;  3CD6 P;  3TYY A;  3L71 G;  2OTL P;  1PGP A;  4WWI A;  1QVF O;  1N7L A;  1LTJ B;  3HD7 D;  4R4E A;  4BWN A;  1NTK E;  1P84 I;  1SQP J;  1LX8 A;  3A0H H;  1GL2 D;  4H13 C;  2P67 A;  4O9B A;  4D6T J;  5CCG C;  2OGU A;  4B86 A;  1JY3 O;  3WUT A;  1VPC A;  2FXP A;  2WT7 A;  2E5T A;  4EI2 A;  1KYO D;  3L36 A;  1S9K E;  4NPD A;  1NTM K;  3A7O A;  3H1H D;  4JF7 A;  2Z4E A;  4YXD C;  1EDI A;  2WPV B;  2Q7C A;  1FZB A;  3F89 A;  1FZF A;  2HPC A;  5KAI E;  3W68 A;  5KAF H;  1K73 Q;  1BCC D;  1BSN A;  1R8E A;  1KIL D;  2L91 A;  3IN6 A;  1RF1 B;  2ZFC A;  3E1R A;  1FE6 A;  2AEJ A;  4LLH A;  5AW6 B;  4KJM A;  1OW8 A;  2RH0 A;  3GF3 A;  1NTK K;  1AVY A;  5AVR B;  4RJT A;  3CC7 P;  1ZR4 A;  1FZC C;  2D2C D;  3R8K A;  1M8O B;  3M0D A;  3RBX A;  1SQB J;  2YXR B;  1ZRT E;  3CCU P;  3VMZ A;  3AE1 C;  3UCS A;  4I6M C;  3VMY A;  2FFD C;  2KSE A;  4IFD K;  4BRY A;  2OYI A;  1GDT A;  2NPS D;  2B87 A;  2AXT E;  3OW2 O;  4EOT A;  1IFD A;  3A0H E;  3E7K A;  1NTM D;  1KQS O;  3S4R A;  3EZ2 A;  2R3C A;  1HVV A;  3GW6 A;  2Y0D A;  1Q09 A;  1AA0 A;  2JML A;  2KXP B;  2WT7 B;  1GU5 A;  1PP9 D;  1FOS F;  2A45 G;  4DOJ A;  4OGQ C;  2PP6 A;  2WPQ A;  3B5N D;  2KVV A;  4N3Y B;  3CXH E;  2QM8 A;  1GMJ A;  3MZW B;  5AVS B;  4ZKP A;  2XU6 A;  3MTU E;  3Q1M A;  2HPC B;  1NTK D;  4JQ0 D;  3SFE C;  1BGY J;  4H0L B;  5KAF E;  5CCH D;  1PGO A;  1SQV D;  2FXM A;  4H44 C;  1VQP P;  3CWB J;  1WT6 A;  3EFF K;  4RO0 A;  1S5L H;  2E74 B;  3D70 A;  5DJT B;  3SWY A;  3L70 J;  1LGH B;  2B88 A;  2QJY B;  1RQU A;  4OWF A;  1S9K D;  3GF7 A;  2JEE A;  4WY4 B;  2V7Q J;  1JM0 A;  1SQQ J;  2BAS A;  3TGU E;  1NAF A;  3MUD A;  5E01 A;  1SLQ A;  4BRY B;  2OYI B;  3OJA B;  2B87 B;  1EXJ A;  2KUB A;  2W8Z A;  3I56 P;  5KAU A;  4GIF A;  3AED C;  2RMZ A;  2BCC J;  1DD4 A;  2WSE J;  5L8R J;  4H13 D;  3A2A A;  1PGQ A;  2WWW A;  1EZV I;  3JSV C;  3W67 A;  5CCG D;  3TSI A;  1OVR A;  1USE A;  2KYV A;  5AW0 B;  3D6Z A;  1DIP A;  1GD2 E;  4TLF A;  3CCL P;  1EZV G;  1Q08 A;  2IFM A;  3CC2 P;  2QJK B;  1JTH A;  1JNM A;  1H89 A;  3M9Q A;  4W7Y A;  3BCC E;  2ZT9 C;  1K04 A;  3V2Q A;  3ABV C;  3PH0 A;  5KKZ C;  1AQ5 A;  1R5L A;  4PJ0 H;  4Y28 J;  5AW1 B;  2GA1 A;  2CPS A;  1NTZ E;  2JWA A;  3JC2 2;  4DJG A;  1SQX J;  1EDL A;  3MD0 A;  3SWF A;  3USS A;  3GMA A;  1KTM A;  5KLV G;  1Q06 A;  1K05 A;  3H1J E;  3CXH D;  4R4L A;  3FWL A;  2IZ0 A;  1U57 A;  3AE8 C;  5EFW B;  1KZU B;  3L73 J;  3CLQ A;  1GU4 A;  1HTL C;  1CI6 A;  3TF5 A;  5I44 A;  3MP7 B;  4LHF A;  1OWA A;  3P8M C;  5GTI H;  2HYN A;  1AVO A;  3H32 A;  1VDF A;  4K35 A;  2HG5 D;  5C39 A;  1URQ A;  1M1J A;  3G71 P;  3HE5 A;  5H2F E;  1X8Y A;  2KOG A;  3AEE C;  4IL6 H;  2IDB A;  1LT9 A;  1NOH A;  1M57 D;  1NKZ B;  2K3R A;  2ZVN B;  3T97 A;  3PLN A;  1NTZ K;  1ZP0 C;  2WTY A;  3KHU A;  2V7Q H;  2QG4 A;  3ZDM A;  4ASW A;  1JTH B;  3RK3 C;  2FBW C;  3TGU G;  4WB4 A;  3BAS A;  1T8Z A;  5KJ7 C;  3H1I J;  3GHG C;  3AE3 C;  5KAW A;  3L71 E;  2N1T C;  2JWD A;  1NKN A;  4PJ0 E;  3CX5 H;  1SFC A;  2L5G B;  2FYU J;  3A3Y B;  2WSE H;  2OQQ A;  2Q5U A;  3H1K E;  1JCC A;  2Z5I A;  4H44 D;  3FX0 A;  1BDD A;  1HGZ A;  3M0D C;  1L4A C;  1FZA A;  1RF0 A;  4U3F G;  3P8C E;  5KAT A;  1H0T B;  1SP4 A;  1QLE D;  1M1K Q;  2E76 B;  3AEF C;  3BCC D;  5AVQ B;  3Q5S A;  4IFM A;  3RK3 E;  3BCC G;  1XTC C;  2I1K A;  3H32 B;  1NTZ D;  1BOW A;  1Y6U A;  4JPZ B;  5GTI E;  1URQ B;  1M1J B;  3HE5 B;  1SQP G;  1LWU A;  1SQB K;  2KZI A;  3AEC C;  1FS0 E;  3N4X A;  3TNU A;  3HUS C;  1NU1 E;  3MHV A;  4D6T G;  1LT9 B;  1BE3 J;  3H1J D;  2IPP A;  3T97 B;  1IFI A;  1KV4 A;  3VYI A;  4WLS A;  3L75 J;  4I7Z B;  3H1J G;  1USD A;  4AQR D;  1UII A;  5AVX B;  1R8D A;  4HJG H;  2RKL A;  3LIE A;  5M1B A;  3CCV P;  4UB6 E;  1KD1 Q;  2YIU B;  1GK4 A;  2O01 J;  2KSJ A;  1T2K C;  4LGD E;  1X0T A;  2G3A A;  4DCK A;  2ZT9 D;  1SFC B;  1PM6 A;  2ZXX A;  1T3J A;  3EZ9 A;  5APW A;  3WU2 H;  5AVW B;  1Q07 A;  1KQF B;  1N7S C;  1KOR A;  2ZYA A;  3QWO C;  2M8R A;  3R2P A;  2ZJS E;  4OGQ B;  3CCQ P;  4PD4 H;  1RE4 C;  1ZR2 A;  4AUW A;  4L73 A;  4GDO A;  2OYH C;  1BDC A;  1PV3 A;  2ZYG A;  1SQB G;  1NAY A;  1NU1 K;  2Q3E A;  4LC1 A;  1JO5 A;  3L71 D;  1HBW A;  5AW4 B;  1JY3 N;  3L37 A;  1AFO A;  3H1K D;  1VQ6 P;  1KB9 D;  1LWU B;  1YQ3 C;  3H1K G;  5B5E H;  3TNU B;  3CPW O;  4L76 A;  1P84 D;  3HH0 A;  1OXZ A;  2P7J A;  3P8C D;  3PHL A;  1YJN P;  3JCU H;  1MUU A;  1VQN P;  5TJH A;  1AV1 A;  3B4S A;  4PV1 C;  4KT0 J;  3RK3 D;  3V2P A;  4JYB A;  2Y0E A;  2H89 C;  1HJ0 A;  3FWN A;  3OA7 A;  2P1J A;  1L0N J;  1ZOY C;  3Q3D A;  5KJ7 D;  3V4W A;  5GQQ A;  2IX7 C;  1GL2 A;  4WVZ A;  2N1T D;  3WU2 E;  1NU1 D;  5E79 E;  3RL0 B;  3CWB G;  3G6E P;  3QH9 A;  5B66 H;  2KK7 A;  1NU1 G;  3RK2 C;  4KHX A;  2JR8 A;  2J59 M;  2H8P D;  3PRJ A;  3L70 G;  1L4A D;  4HKZ H;  3V5B A;  1WRG A;  2V4H A;  1KFN A;  2YKO A;  1VF5 C;  2XDJ A;  2R5B A;  3M91 A;  1U7J A;  4N78 E;  1EZV E;  1SQQ G;  2IZ1 A;  2WSF J; 
#chains in the Genus database with same CATH homology
 1JYH A;  2FYN C;  1FDI A;  1WMK A;  3E0H A;  1DD4 A;  3EZ2 A;  2E75 D;  2WSE J;  1BOW A;  1IK7 A;  1Y6U A;  3QAO A;  1TU3 F;  1VF5 D;  3AE7 C;  3LW5 J;  5L8R J;  1OW6 A;  4OGQ D;  3G9R A;  2NZ2 A;  3FGA D;  3RL0 g;  1JBG A;  4H13 D;  2E76 C;  3AEE C;  1S5L X;  3AE2 C;  3AEG C;  1Q09 A;  3EWK A;  1YQ3 C;  2JML A;  3IAO A;  1S1C X;  1Q0A A;  2FXP A;  3GPV A;  3AEC C;  3EZ6 A;  1EXI A;  1JB0 J;  3O6Q A;  2IDB A;  2QJP C;  3AEB C;  2ZT9 B;  3D71 A;  3D6Y A;  3AE4 C;  4OGQ C;  2E76 D;  3D6Z A;  3HH0 A;  4PV1 B;  1Q90 D;  3R8J A;  4YTP C;  3LUR A;  2KVV A;  2MKV A;  1DIP A;  4R22 B;  4B0Y A;  3T97 B;  4H44 B;  1Q08 A;  4WLS A;  4J2N A;  1GMJ A;  3Q2Y A;  1VL2 A;  1ZP0 C;  2WQY C;  4I7Z B;  1NYH A;  4YXD C;  1KMI Z;  2WPV B;  2HVA A;  3H25 A;  1MKM A;  2BEQ D;  3Q5R A;  2D2C B;  2VZ4 A;  3Q1M A;  1R8D A;  3AE9 C;  2K9Y A;  3RK3 E;  1D5Y A;  2FBW C;  5I41 B;  4DCZ A;  5M1B A;  3SFE C;  4H0L B;  1HF9 A;  3GLM A;  1R8E A;  2ZT9 C;  1K04 A;  1ZME C;  3ABV C;  4Z1M H;  4PV1 C;  5KKZ C;  4KT0 J;  3IN6 A;  2DG6 A;  3AE3 C;  4H44 C;  2O01 J;  5KAW A;  3AE5 C;  4Y28 J;  1PL5 A;  4I7Z C;  2G3A A;  2H89 C;  2ZHG A;  1HJ0 A;  2QJK C;  4WLW A;  2ZT9 D;  2IEF A;  1DD3 A;  1ZOY C;  3Q3D A;  2D2C C;  5D90 A;  2OG0 A;  4PV1 D;  1RQV A;  4XFJ A;  1PM6 A;  2OQQ A;  2WSC J;  5GQQ A;  3EZ9 A;  1Q05 A;  4R4M A;  2J5U A;  1OW8 A;  3D70 A;  2E74 B;  4H0L C;  2H88 C;  4H44 D;  4IL6 X;  1Q07 A;  1OMI A;  3GF3 A;  2KCU A;  5KAV A;  1KQF B;  3B71 A;  5KCB A;  3GMA A;  2BEZ F;  1KOR A;  1RH6 A;  1PIX A;  2YIU C;  1KQG B;  1KTM A;  4A1M A;  2E75 B;  2D2C D;  2JO1 A;  3R8K A;  1RQU A;  3B49 A;  1Q06 A;  3AEA C;  3S9O A;  1VF5 B;  2P10 A;  3Q5P A;  1K05 A;  3GK6 A;  4OGQ B;  4H0L D;  2G8Y A;  4RKU J;  3GF7 A;  4AYZ A;  1ZRT E;  3EZF A;  3C8V A;  4H13 B;  4R4L A;  4AYZ B;  2V7Q J;  1OW7 A;  5KAT A;  4GDO A;  3AE1 C;  3UCS A;  5KAX A;  1U57 A;  2E74 C;  2QSI A;  3AE8 C;  5E01 A;  1AJY A;  2GOV A;  1PV3 A;  2JP3 A;  4R24 B;  4R4E A;  1FDO A;  2E76 B;  3AEF C;  3GP4 A;  2E75 C;  3SFD C;  3AE6 C;  2QIW A;  2QJY C;  1EXJ A;  4TT3 H;  2BOW A;  1NGM B;  5I44 A;  1LX8 A;  3R4Y A;  1VF5 C;  1KIL E;  3EZ7 A;  5KLI C;  5KAU A;  2E74 D;  1UIX A;  3Q5S A;  2YMK A;  3AED C;  2ZHH A;  4H13 C;  2WSF J;  4U7J A;  4LHF A;  5D8C A;  1YQ4 C;  1Y9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...