3Q3DA

Crystal structure of bmrr bound to puromycin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna/antibiotic
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q3dA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q3dA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q3dA03
1Q05A 3D71A 4R4EA 3R8KA 3HH0A 5KAXA 4WLWA 5KCBA 4R22B 3R8JA 3Q5RA 3GK6A 3GP4A 3IAOA 2GOVA 5I41B 1R8EA 2KCUA 3GPVA 1BOWA 3Q3DA 5D90A 2OQQA 3QAOA 1EXIA 1Q07A 1JYHA 2DG6A 3UCSA 5I44A 1Q09A 2ZHGA 2ZHHA 3D6YA 3G9RA 4A1MA 1D5YA 3LURA 3D70A 5GQQA 4AYZB 1R8DA 5KAVA 4R4MA 1Q08A 3Q1MA 1Q0AA 3E0HA 3T97B 2JMLA 2HVAA 1JBGA 4R4LA 5KATA 2BOWA 1Q06A 4WLSA 3Q5PA 2J5UA 4R24B 3Q2YA 1DIPA 4AYZA 3D6ZA 4J2NA 2VZ4A 1EXJA 4B0YA 5D8CA 5E01A 5KAUA 5KAWA 3B49A 3Q5SA
chains in the Genus database with same CATH superfamily
1H8AA 5M1BA 2KS1B 3O6QB 3AECC 4HYTB 3TGUJ 2WSEJ 3L71J 2OTJP 4JQ0D 5KAIH 3HUSC 2K9JA 1OXZA 1MV8A 3M0DA 1R5LA 2NZ2A 3RK2B 2C9NY 1NTKE 1M1JB 3B4SA 4AQRD 2PGDA 1J1EB 3D71A 1PPJD 1FS0E 1M1KQ 1G2CB 4WWIA 3KZIH 3QAOA 3CX5I 2KNCA 1CI6A 1D5YA 1GK6A 3E0HA 4WY4B 1ZXGA 5L8RJ 1SLQA 4GIFA 3CX5D 1NH4A 1ZP0C 4W80A 3P8CD 2WPQA 1NTMK 3WMM0 2V7QH 1JY2P 3RK3C 1M1JC 4ASVA 1EXJA 2M5AA 5AW6B 1LTJC 4UB8E 2KYVA 2ZVOB 1LTJA 3A0HE 1T6AA 1HUCA 5AVSB 4NPEA 1L0LD 2HODB 2ZHHA 1MFZA 1EC5A 1U7JA 2QM7A 1LT9A 4PD4H 1VQPP 2P7JA 2M0BA 3OAKA 1HJBA 2IYOA 2KVVA 3TF5A 2FY8A 3QWOC 3VN0A 1YTZI 3M0DC 2YMYA 4XE5B 5KLVD 3SWKA 1FC2C 1OVVA 2ZT9B 2ITAA 3PTZA 1N7SC 3FWLA 1Q0AA 4WY4A 5CBOA 1PPJG 1JO5A 2JO1A 5AVXB 3GG2A 3H6PA 2AEJA 2LKMA 3V5BA 2BCCJ 2E5YA 1KZUB 5CBNA 5APUA 3L72J 3L4FA 4Y99B 2KXPB 1SQPG 3H1HJ 1JM0A 4AUWA 2K1AA 1PGJA 3VMAA 1KTMA 1UIIA 1YQ4C 2FFDB 1FE6A 4GDOA 3B49A 3BCCD 1K05A 1SQQG 1JOCA 4K3AA 1SQPK 3PJSK 2MJZA 3CMEP 3C1LA 3H1KJ 1VQKP 3CI9A 4GODA 1VQMP 5TJHA 3I5CA 5D8CA 4B86A 4GOFA 3BCCE 1JCDA 3H1ID 4HH2A 1SS1A 1NTZG 1NAFA 2FYUG 3Q2YA 1LT9B 4RJTA 1PP9J 5AW2B 5B5EE 3H1JG 4BRYB 4UB6E 3H1JE 1SQQD 1N7SB 3HD7B 3BATA 1H88A 1KC8Q 2R44A 3CC4P 4I7ZC 2KZIA 2OYIA 1AVYA 2O1KA 3PHLA 5AVYB 5I41B 3H1LE 3L35A 5B5EH 3IF4A 1SQPJ 5APYA 3CC7P 3EFFK 5BU8B 2QIWA 3CCQP 1BDDA 2KNCB 5TISH 3HH0A 3L36A 1SQQE 2C0XA 4I6MC 1BGYE 1EDKA 2A06E 1NTZK 1H89A 3EZ7A 1Y47A 1LTSC 1KN7A 3VP8A 3CCUP 1LNQA 1ZRTD 3M9HA 2QJYC 3AEDC 2YKQA 2YKOA 4NPFX 1KILE 1SVFA 4L75A 2FYUD 2KSEA 4I1LA 3KHUA 4N6JA 1OWAA 4A1MA 4OGQC 2E43A 4U3FJ 3SWFA 1N2DC 1IO4A 4RESB 1GL2D 3RL0D 3ABVC 3H1KE 2KIKA 3S9OA 2B89A 3A2AA 1N86A 4U7JA 3HUSB 3RBXA 3SWYA 2KI7B 3E1IA 3FX0A 1VQ8P 1OFCX 1BE3E 5BU5A 1BE3D 1PIXA 1M1JA 2R5DA 4C7NA 3GP4A 2A45G 3VYIA 3G3ZA 2CPSA 3FXEA 2O3JA 1VL2A 1KD1Q 3LURA 4PV1C 2IYPA 1Q7YQ 1VQ7P 2OYIB 1NTKD 2QG4A 2ZVNB 2Q3IA 1LTBC 3EZ6A 5D90A 1EDIA 2QA4P 3TNUA 2OYHC 3H1LJ 1J1DC 1PGOA 2Q5UA 1RF0C 2W27A 1DEEG 1AVOA 2JWAA 1KQSO 3JSVC 1URQC 3KXDA 3Q1MA 2E75C 4ZKPA 1KB9E 4WLSA 1T3JA 3MZWB 1A02F 1Q05A 1H0TA 5AVWB 1NGMB 1RF1C 1HGZA 4WB4A 1SQBJ 1SQVD 2N1TD 1DX7A 3MGNA 2GUSA 1NOHA 1K9MQ 3AEGC 1QVGO 5DJUB 3CXHD 3FXDA 3TNUB 2V7QJ 1NO4A 5AVUB 4JYCA 5KKZC 1IFIA 1DH3A 4Y99C 1L0ND 5AVTB 3GHGA 2E74D 3AEAC 1G1IA 1KILA 2W83C 5AVVB 3RK2C 2FKWB 3H25A 2ZT9D 1KQLA 2LXBA 3IN6A 3L75J 1FJPA 1SQVJ 2RMZA 3L72E 1YYCA 3U1AA 3H1KD 1NTKJ 4BWNA 1SQXJ 5KATA 3U59A 2A45H 3MP7B 2L5GB 3TK1A 2OYOA 1HF9A 1M57D 1URQA 2IDBA 3WUTA 3E7KA 2GOVA 3Q3DA 2P1JA 4HJGH 3HE5B 3L74E 1A02J 5GQQA 1BCCD 4OWFA 1NWQA 1ZRTE 1KFNA 1J2JB 2BCCE 1SQVK 1VDFA 2E74C 1VF5B 1JMMA 1X22A 1P84I 2YKPA 1PGPA 3K5BA 5K5GB 3CCRP 2E75B 2AXTE 2IEFA 2W6AA 2CK3H 2Z5HA 1SQXK 2POHA 2ZT9C 2O01J 3JC22 1VQNP 1R8DA 1NHLA 1N73C 1BGYG 5KLVK 1FDMA 4RO0A 4C7NB 1OMIA 1SFCB 1E5WA 2E76D 2WZ7A 1L0NJ 2G3AA 2P67A 2KP8A 3VP9A 4IFFA 3H1HG 2OYIC 3M9QA 3A0HH 1FZCA 1JB0J 4IL6X 5APSA 1JY2N 2WMMA 5KLIC 1URQB 3WUUA 3F89A 2KOGA 1CI6B 1KILB 5H2FE 3TGUE 3SFDC 5AW4B 4EIJA 1HWTC 3R2PA 2IZ1A 4R24B 1J1DB 2Q9IA 4U3FG 1SQXG 1GW3A 2G8YA 1FZCC 1X9VA 4YXDC 4TLFA 1BCCG 5APXA 5TISE 2WSFH 3MTUE 4LC1A 2O1JA 3CX5H 3B5NB 1RF1B 1YBKA 2VZ4A 5E79E 2LR2A 3WU2E 2SPZA 2XNXA 3FWNA 3H32A 4JYBA 4DZOA 2ZXEB 3R8JA 1SQBD 2OARA 3AEBC 2R5BA 3CXHI 1EQ7A 2IPPA 2QJKB 1EZVE 1XTGB 1MKMA 3ITKA 1OVRA 2IBZE 3WU2H 1NU1D 1JY3N 1JMBA 1AV1A 1LTAC 1N7SA 1KFMA 1FOSE 1L4AD 1NTZD 1JBGA 4YPCA 2WWWA 1N7SD 1FU1A 1IJDB 2D2CC 2IZ0A 3B5NC 4YXWH 3FGAD 3B5NA 3V2RA 2KS1A 1BOWA 1SQBG 2HODA 3RK2D 2YIUB 1GU4A 1VQ9P 3H1HE 1SQBE 3CCVP 4EDFA 4H13B 3NFQA 1PP9G 1CZQA 4J2NA 3M91A 2M5AB 3MUDC 3L73D 3P32A 3N4XA 5DJTB 2OYHA 1HBWA 1GK4A 1IK9A 3CWBD 3L70G 2HR3A 2B88A 1KYOH 2AXTH 1GD2E 2YNYA 1NTME 3AE2C 3O8ZA 4JPZB 4QMAA 2J58A 2B87A 4UB8H 1S5LH 1PPJE 2W90A 1OX3A 1KYOI 1NTMJ 1RE4C 2UWJE 1ZW0A 4OH8B 5AVQB 5B66E 3B8EB 1KB9H 5KAXA 2XV5A 1M56D 1AA0A 4YTPC 3TYYA 3H1JJ 2NPSB 2M3BA 3G6EP 3B71A 3HTKB 1PZQA 1P84E 5B66H 2IBZD 3P8MC 3V2NA 4C7RA 3I56P 4WY4D 1LX8A 2NRGA 4H44D 2QJPC 3M0AA 1S5LX 4D6TD 1LT1A 4R4LA 1Q06A 1PFIA 3V6IA 4B0YA 4R4MA 3LW5J 3MUDA 1NTKK 3L74D 1NKZB 1H0TB 4H0LC 5C39A 3CXHH 3A5TA 1S9KE 1ZN5A 3EZ2A 1N73A 1LTJB 1JY3P 2H7HA 1BSHA 1FDOA 1KMIZ 1IK7A 1NU1K 2E74B 2RN0A 2PP6A 4EI2A 3H1KG 1LT9C 3GK6A 3IAOA 5AW3B 5KTBA 2K9YA 2KSJA 4I2LC 2J59M 1USDA 2PFXA 2Z4EA 2KUBA 3EWKA 1RE4A 1L0LJ 1VF5D 3PRJA 3GHGB 3HD7C 1NAYA 4D6TG 2WITA 2HFED 3BRVB 5EFWB 3GW6A 5KLVG 3OW2O 2GM4A 1KILC 5KJ7A 1OW8A 2R3SA 1ZR4A 2YO2A 5KLVJ 1IFDA 3BASA 2FXOA 3L71E 1X8YA 1SFCD 3A0BH 2AEFA 2RH0A 3AE3C 1G1JA 2E76B 5AVRB 1U57A 2YXQB 1JTHA 2JWDA 3QH9A 1U7MA 1FZCB 1L0NK 3C8VA 3T97A 1Q81Q 3G9RA 2ZYAA 2O01H 1GL2B 3RL0B 3U1CA 3D70A 3LIEA 1ZR2A 3V4WA 2QJKC 4OGQD 3L72D 2QE7H 3D6ZA 2Y9ZA 2NPSD 3KDPB 2XDJA 4IFMA 2HPCA 5KKZB 3VMXA 4NPDA 5KLIB 2IBZI 3GPVA 2ZYGA 4JBZA 3VOPA 1FOSF 2QSIA 4KHXA 3CLQA 1RF0A 3EQ2A 2FFDA 1S5LE 5AW5B 1EDLA 2YO3A 2BEQD 2XNDH 4WVZA 5KJ7D 3VTPC 2WQYC 1NTZJ 1GL2A 1JY2O 4DCZA 2JR8A 1JYHA 1FZGA 2ZXXA 3T97B 1SQVE 1HH0A 1Y9BA 1N73B 5CCGD 3F5HA 1T3UA 1QLED 4HB1A 1VQ4P 3PP5A 5CJ0A 1PP9E 1SQXE 4EOTA 2KCUA 5GTIH 5KAIE 1Q09A 2OTKE 5APWA 3CCMP 1JUNA 1VQ5P 1S4XA 1KV4A 1RH5B 1L0LE 3G71P 1T2KC 1L0LG 1JEKA 1QVFO 4M3LA 2A45I 2HLOA 3KQGA 1FDIA 2B9BA 5CCGA 1YQ3C 5GTIE 2QM8A 1KORA 2E5TA 1IC2A 1SQPE 2HG5D 1GL2C 3RL0C 4L73A 5CCHC 2HPCB 2KZJA 1JY3O 3AE8C 3AE7C 1HVVA 2WSFJ 1KB9D 1PM6A 3HUSA 3R4YA 2FYUK 1OIPA 1E79H 5AW7B 1KB9I 5CMZA 2B87B 3TGUD 3N7NA 1EZVG 2XU6A 2BASA 1T8ZA 4PD4E 2H89C 1PP9D 1GDTA 1NKNA 3KYQA 4GKGA 3I55P 1LWUC 3L73G 3O6QA 1OW6A 2H88C 3AE4C 3SSUA 3A0BE 4PJ0E 2JEEA 2M8RA 3CWBG 1Q07A 1RY3A 5I44A 3AEFC 3CC2P 2KB7P 2K88A 1EDJA 2J5UA 2HYNA 2K9JB 1YI2P 4OGQB 1KILD 3Q5SA 1KQFB 3W67A 3R8KA 1FJKA 3HRNA 4DT0A 3VMZA 3CD6P 2N9YB 4N3YB 2QJYB 4ZNCA 1YTZT 1EZVD 3KPEA 3P7KA 1RE3A 1SQXD 3ZDMA 1L4AC 1SQQK 1HJ0A 2FBWC 1QL1A 3OJAB 4L74A 4I7ZB 3JCUE 5GTHH 2QJPB 2D2CD 1WRGA 3A3YB 1NVOA 1SP4A 2OQQA 1M7LA 1NYHA 1CSBA 5BVZA 4LLHA 1NU1G 3EFGA 3TDKA 1LP1B 1BDCA 1LTIC 2JMLA 3MIWA 5KAFH 2IBZG 3L70J 4DJGA 4W7ZA 2RKLA 4H13D 4BXLA 3RK3B 4RKUJ 3USSA 3KZIE 3IR9A 5APTA 1IFPA 2ZAEB 1W2EA 1VQ6P 5CCHA 2K3RA 1Q90D 2Z5IA 2R32A 1MUUA 2M3EA 1L4AB 4IL6E 1JNMA 3GMAA 1K04A 2FXPA 1L0NG 3CWBJ 5KAFE 5AW0B 2BCCD 3CPWO 2WPRA 1LTTC 3V4QA 1Q08A 1ZLLA 1LP1A 1YITP 1YJ9P 1BGYJ 1AJYA 2N9BA 2GA1A 5E01A 3VMYA 1KQGB 1LGHB 2Q3EA 3WUVA 2WSSH 3MD0A 1M90Q 4CPGA 2WT7B 2Q6QA 1QGKB 3L75E 4IOIH 1DD4A 2QRXA 1LWUA 1N8RQ 1N7LA 2WT7A 5KAVA 2YMKA 2WSCH 4H13C 1FZBA 3L72G 1Q2NA 1QL2A 2OYHB 1PL5A 5APVA 1X0TA 3Q5RA 4D6TE 2NPSA 2CPBA 1BE3G 3AE6C 3SFEC 1GTWA 1RE3C 1KYOE 4MN4C 3RK3E 4AYZA 5CHXA 4BRYA 4KT0J 1BCCE 3RL0g 4HKZH 3GLMA 4R4EA 1S3JA 2JJLA 3H1IE 4PV1B 1NTKG 3M9BA 4AYCA 1EXIA 1S9KD 3EZ9A 2W6JH 1DIPA 2H43A 3HE5A 5KAUA 1GU5A 3E1RA 2BEZF 3RGUA 1GZLA 2OG0A 4PD4D 1QEXA 2Q7CA 1S1CX 3L74G 2WPVB 2OGUA 2ZYDA 4LGDE 3P8CE 2P58A 2E76C 3CWBE 3LW5H 2OTLP 1M8OB 3CX5E 2O01N 1YIJP 1K8AQ 3HD7A 2QVAA 1NTMD 2JDIH 1P84H 4H44B 4IFDK 2I8DA 1ZV8A 1L4AA 1IZNB 4PV1D 2WTYA 3H32B 2N1TB 2PRRA 1FZAA 1RF1A 2H8PD 1SQPD 1AFOA 2WSEH 3V2QA 5CJ4A 1USEA 1ZMEC 1AQ5A 4GT1A 5KCBA 1IFNA 1GW4A 2FYUJ 3CXHE 3H1HD 2Y0CA 1GMJA 1AQTA 4EYYQ 3D6YA 5AW9B 1NTZE 4KJMA 2FFDC 3CMAP 2W8ZA 1JCCA 3NMDA 4H44C 1OVUA 2ZFCA 1OW7A 5AW1B 2Q1KA 2Y0DA 1BCCJ 1RH6A 4UB6H 1IFMA 1WT6A 3TGUG 4H0LD 3GF3A 3BRTB 1FBMA 4U3FD 1MZ9A 3NXSA 1JTHB 1L2PA 2P2UA 3H1IG 3G4SP 4R22B 4WBAA 1DEBA 2FYZA 1DD3A 1RQVA 1FZFA 3UCSA 2KK7A 2N1TA 4OVNF 2YIUC 3H1IJ 2L91A 1LTGC 1VF5C 4A7PA 3TSIA 2Y0EA 3L74J 2C9LY 2Y9YA 5H2FH 2R3CA 2ZHGA 4PJ0H 4TT3H 4PD4I 2IX7C 2I1JA 2HVAA 1NU1E 1SFCC 1L0LK 3CL3D 3CCSP 3LIDA 1VQOP 1Y8AA 1BGYD 1LJ2A 1D7MA 1QX8A 2JKVA 1RQUA 2E42A 2KLVA 3EZFA 4ZKUA 2DW3A 1BE3J 2LXCB 3L73E 1YHQP 3L75G 5E79H 1SFCA 2IFMA 3CCLP 1HGVA 5KAWA 3MHVA 3H1LD 1FZEA 2NPSC 3AEEC 1W2BO 3NTNA 1R8EA 4JF7A 1URQD 2ZJSE 3GF7A 2V4HA 2XZRA 5CCHD 1YJWP 1X79B 3RK3D 2FYUE 2FYNB 3GHGC 2N1TC 4DCKA 2A06D 1WMKA 1XTCC 4GOEA 3AE5C 4N78E 2GUVA 3CCJP 3OA7A 1KYOD 4L76A 1J1EC 1Y6UA 2I1KA 2D2CB 4AYZB 2C0WA 3L70E 3BCCG 1IFJA 3C9IA 3L75D 1SQBK 2YXRB 1BSNA 3II6A 2QEXP 3AE1C 3M06A 1G2CA 5KJ7C 3PH0A 1W5CE 4IL6H 2WPSA 2IFNA 3L71D 1K73Q 3CCEP 1RHZB 1LWUB 4WY4C 2XKMA 3HE4A 2AEMA 2FYNC 1NU1J 1PGQA 4DOJA 2FXMA 4K35A 2BCCG 2KLUA 3UIAA 3HTKA 1TU3F 1HTLC 2DG6A 3PLNA 3V2PA 1ZOYC 4Y28J 2JP3A 5AVZB 1Q86Q 5APQA 1P84D 3H1LG 4N78D 3H1JD 3IFMA 3HD7D 5CCGC 4ASWA 1UIXA 2PAJA 3W68A 2K37A 3AE9C 2WVRA 1CW5A 1FAVA 1SQVG 1YJNP 1SQQJ 3BVHA 4D6TJ 2W6BA 2A06G 1L0NE 4XA4A 3A7OA 3BCCJ 2WSCJ 3L73J 4W7YA 5AW8B 3HE4B 2MKVA 2VRSA 1MFTA 1T2KD 1VQLP 1S72P 4Z1MH 4ZMDA 1Q82Q 4O9BA 2P10A 2BOWA 2AXCA 3Q5PA 3L37A 3L70D 1Z56A 1PV3A 3S4RA 3RBZA 5KLVE 1VPCA 1R5SA 4H0LB 4U3FE 4WLWA 1S2EA 1NTMG 1NJIQ 3S1KA 4XFJA 4C46A 2E75D 3L71G 3JCUH 5GTHE 4LHFA 3B5ND 1EZVI 1OZHA
chains in the Genus database with same CATH topology
5M1BA 3AEDC 1ZMEC 1KILE 3AECC 2G8YA 1PL5A 2FYNC 1RQUA 4I7ZB 5KCBA 2WSEJ 3Q5RA 2D2CD 2IDBA 2GOVA 3AE6C 3SFEC 4YXDC 3GPVA 3EZFA 3Q3DA 2OQQA 4H0LC 1TU3F 2DG6A 1GMJA 1NYHA 2QSIA 2ZT9B 4A1MA 3D6YA 1ZOYC 4OGQC 4Y28J 2JP3A 5GQQA 3AE8C 3AE7C 3RK3E 4R4MA 3Q1MA 2E75C 1Q0AA 3EZ2A 2NZ2A 2JMLA 1ZRTE 2WSFJ 4H44C 4WLSA 4AYZA 3Q2YA 1FDOA 1KMIZ 4KT0J 2BEQD 1IK7A 2VZ4A 1PM6A 3RL0g 3R4YA 2E74B 2JO1A 3AE2C 5KAWA 3GLMA 1Q05A 3D71A 2E74C 4R4EA 1OW7A 1VF5B 1NGMB 1UIXA 3ABVC 3AEEC 3R8JA 2WQYC 4PV1B 3GK6A 3IAOA 4H13D 3S9OA 1R8EA 2E75B 2K9YA 1RH6A 2IEFA 3AE9C 3QAOA 3AEBC 4DCZA 1EXIA 4RKUJ 3GF7A 1JYHA 1D5YA 4U7JA 2ZT9C 2O01J 3EZ9A 1VF5D 3AEGC 3EWKA 2H89C 4H0LD 1R8DA 3GF3A 3E0HA 3T97B 1DIPA 1Y9BA 2V7QJ 4I7ZC 5KKZC 2WSCJ 5L8RJ 3O6QA 1Q90D 5KAUA 1OW6A 2H88C 1PIXA 1ZP0C 2BEZF 1MKMA 3AE4C 1OMIA 5KAXA 1WMKA 2MKVA 4R22B 3GMAA 1K04A 3GP4A 3AE5C 2FXPA 5I41B 2OG0A 2KCUA 2E74D 1OW8A 1DD3A 2E76D 4Z1MH 1Q07A 1S1CX 1RQVA 3UCSA 5I44A 1Q09A 1Y6UA 2G3AA 3AEFC 2YIUC 1VL2A 1KTMA 2WPVB 2P10A 3AEAC 4YTPC 3LURA 4PV1C 2D2CB 4AYZB 1YQ4C 1Q08A 1JBGA 1VF5C 2E76C 2BOWA 2J5UA 3LW5J 3Q5PA 3H25A 2ZT9D 2QIWA 3AE3C 1EXJA 3B71A 2E76B 1PV3A 1JB0J 4OGQB 1AJYA 4IL6X 5E01A 4GDOA 3IN6A 3Q5SA 2D2CC 1U57A 1K05A 1KQGB 4H0LB 1KQFB 3B49A 3R8KA 4H44B 3HH0A 5KLIC 4WLWA 3FGAD 3C8VA 3AE1C 3EZ6A 1BOWA 5D90A 4XFJA 4PV1D 1DD4A 2E75D 2ZHGA 3G9RA 2ZHHA 4TT3H 1LX8A 4H44D 3SFDC 3EZ7A 3D70A 1FDIA 2QJPC 5KAVA 1S5LX 2HVAA 2QJKC 4R4LA 4OGQD 5KATA 1Q06A 4R24B 3D6ZA 1YQ3C 2YMKA 4H13B 4J2NA 4LHFA 2QJYC 4B0YA 2KVVA 5D8CA 1HJ0A 4H13C 1KORA 2FBWC 1HF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q05 A;  3D71 A;  4R4E A;  3R8K A;  3HH0 A;  5KAX A;  4WLW A;  5KCB A;  4R22 B;  3R8J A;  3Q5R A;  3GK6 A;  3GP4 A;  3IAO A;  2GOV A;  5I41 B;  1R8E A;  2KCU A;  3GPV A;  1BOW A;  3Q3D A;  5D90 A;  2OQQ A;  3QAO A;  1EXI A;  1Q07 A;  1JYH A;  2DG6 A;  3UCS A;  5I44 A;  1Q09 A;  2ZHG A;  2ZHH A;  3D6Y A;  3G9R A;  4A1M A;  1D5Y A;  3LUR A;  3D70 A;  5GQQ A;  4AYZ B;  1R8D A;  5KAV A;  4R4M A;  1Q08 A;  3Q1M A;  1Q0A A;  3E0H A;  3T97 B;  2JML A;  2HVA A;  1JBG A;  4R4L A;  5KAT A;  2BOW A;  1Q06 A;  4WLS A;  3Q5P A;  2J5U A;  4R24 B;  3Q2Y A;  1DIP A;  4AYZ A;  3D6Z A;  4J2N A;  2VZ4 A;  1EXJ A;  4B0Y A;  5D8C A;  5E01 A;  5KAU A;  5KAW A;  3B49 A;  3Q5S A; 
#chains in the Genus database with same CATH topology
 1H8A A;  5M1B A;  2KS1 B;  3O6Q B;  3AEC C;  4HYT B;  3TGU J;  2WSE J;  3L71 J;  2OTJ P;  4JQ0 D;  5KAI H;  3HUS C;  2K9J A;  1OXZ A;  1MV8 A;  3M0D A;  1R5L A;  2NZ2 A;  3RK2 B;  2C9N Y;  1NTK E;  1M1J B;  3B4S A;  4AQR D;  2PGD A;  1J1E B;  3D71 A;  1PPJ D;  1FS0 E;  1M1K Q;  1G2C B;  4WWI A;  3KZI H;  3QAO A;  3CX5 I;  2KNC A;  1CI6 A;  1D5Y A;  1GK6 A;  3E0H A;  4WY4 B;  1ZXG A;  5L8R J;  1SLQ A;  4GIF A;  3CX5 D;  1NH4 A;  1ZP0 C;  4W80 A;  3P8C D;  2WPQ A;  1NTM K;  3WMM 0;  2V7Q H;  1JY2 P;  3RK3 C;  1M1J C;  4ASV A;  1EXJ A;  2M5A A;  5AW6 B;  1LTJ C;  4UB8 E;  2KYV A;  2ZVO B;  1LTJ A;  3A0H E;  1T6A A;  1HUC A;  5AVS B;  4NPE A;  1L0L D;  2HOD B;  2ZHH A;  1MFZ A;  1EC5 A;  1U7J A;  2QM7 A;  1LT9 A;  4PD4 H;  1VQP P;  2P7J A;  2M0B A;  3OAK A;  1HJB A;  2IYO A;  2KVV A;  3TF5 A;  2FY8 A;  3QWO C;  3VN0 A;  1YTZ I;  3M0D C;  2YMY A;  4XE5 B;  5KLV D;  3SWK A;  1FC2 C;  1OVV A;  2ZT9 B;  2ITA A;  3PTZ A;  1N7S C;  3FWL A;  1Q0A A;  4WY4 A;  5CBO A;  1PPJ G;  1JO5 A;  2JO1 A;  5AVX B;  3GG2 A;  3H6P A;  2AEJ A;  2LKM A;  3V5B A;  2BCC J;  2E5Y A;  1KZU B;  5CBN A;  5APU A;  3L72 J;  3L4F A;  4Y99 B;  2KXP B;  1SQP G;  3H1H J;  1JM0 A;  4AUW A;  2K1A A;  1PGJ A;  3VMA A;  1KTM A;  1UII A;  1YQ4 C;  2FFD B;  1FE6 A;  4GDO A;  3B49 A;  3BCC D;  1K05 A;  1SQQ G;  1JOC A;  4K3A A;  1SQP K;  3PJS K;  2MJZ A;  3CME P;  3C1L A;  3H1K J;  1VQK P;  3CI9 A;  4GOD A;  1VQM P;  5TJH A;  3I5C A;  5D8C A;  4B86 A;  4GOF A;  3BCC E;  1JCD A;  3H1I D;  4HH2 A;  1SS1 A;  1NTZ G;  1NAF A;  2FYU G;  3Q2Y A;  1LT9 B;  4RJT A;  1PP9 J;  5AW2 B;  5B5E E;  3H1J G;  4BRY B;  4UB6 E;  3H1J E;  1SQQ D;  1N7S B;  3HD7 B;  3BAT A;  1H88 A;  1KC8 Q;  2R44 A;  3CC4 P;  4I7Z C;  2KZI A;  2OYI A;  1AVY A;  2O1K A;  3PHL A;  5AVY B;  5I41 B;  3H1L E;  3L35 A;  5B5E H;  3IF4 A;  1SQP J;  5APY A;  3CC7 P;  3EFF K;  5BU8 B;  2QIW A;  3CCQ P;  1BDD A;  2KNC B;  5TIS H;  3HH0 A;  3L36 A;  1SQQ E;  2C0X A;  4I6M C;  1BGY E;  1EDK A;  2A06 E;  1NTZ K;  1H89 A;  3EZ7 A;  1Y47 A;  1LTS C;  1KN7 A;  3VP8 A;  3CCU P;  1LNQ A;  1ZRT D;  3M9H A;  2QJY C;  3AED C;  2YKQ A;  2YKO A;  4NPF X;  1KIL E;  1SVF A;  4L75 A;  2FYU D;  2KSE A;  4I1L A;  3KHU A;  4N6J A;  1OWA A;  4A1M A;  4OGQ C;  2E43 A;  4U3F J;  3SWF A;  1N2D C;  1IO4 A;  4RES B;  1GL2 D;  3RL0 D;  3ABV C;  3H1K E;  2KIK A;  3S9O A;  2B89 A;  3A2A A;  1N86 A;  4U7J A;  3HUS B;  3RBX A;  3SWY A;  2KI7 B;  3E1I A;  3FX0 A;  1VQ8 P;  1OFC X;  1BE3 E;  5BU5 A;  1BE3 D;  1PIX A;  1M1J A;  2R5D A;  4C7N A;  3GP4 A;  2A45 G;  3VYI A;  3G3Z A;  2CPS A;  3FXE A;  2O3J A;  1VL2 A;  1KD1 Q;  3LUR A;  4PV1 C;  2IYP A;  1Q7Y Q;  1VQ7 P;  2OYI B;  1NTK D;  2QG4 A;  2ZVN B;  2Q3I A;  1LTB C;  3EZ6 A;  5D90 A;  1EDI A;  2QA4 P;  3TNU A;  2OYH C;  3H1L J;  1J1D C;  1PGO A;  2Q5U A;  1RF0 C;  2W27 A;  1DEE G;  1AVO A;  2JWA A;  1KQS O;  3JSV C;  1URQ C;  3KXD A;  3Q1M A;  2E75 C;  4ZKP A;  1KB9 E;  4WLS A;  1T3J A;  3MZW B;  1A02 F;  1Q05 A;  1H0T A;  5AVW B;  1NGM B;  1RF1 C;  1HGZ A;  4WB4 A;  1SQB J;  1SQV D;  2N1T D;  1DX7 A;  3MGN A;  2GUS A;  1NOH A;  1K9M Q;  3AEG C;  1QVG O;  5DJU B;  3CXH D;  3FXD A;  3TNU B;  2V7Q J;  1NO4 A;  5AVU B;  4JYC A;  5KKZ C;  1IFI A;  1DH3 A;  4Y99 C;  1L0N D;  5AVT B;  3GHG A;  2E74 D;  3AEA C;  1G1I A;  1KIL A;  2W83 C;  5AVV B;  3RK2 C;  2FKW B;  3H25 A;  2ZT9 D;  1KQL A;  2LXB A;  3IN6 A;  3L75 J;  1FJP A;  1SQV J;  2RMZ A;  3L72 E;  1YYC A;  3U1A A;  3H1K D;  1NTK J;  4BWN A;  1SQX J;  5KAT A;  3U59 A;  2A45 H;  3MP7 B;  2L5G B;  3TK1 A;  2OYO A;  1HF9 A;  1M57 D;  1URQ A;  2IDB A;  3WUT A;  3E7K A;  2GOV A;  3Q3D A;  2P1J A;  4HJG H;  3HE5 B;  3L74 E;  1A02 J;  5GQQ A;  1BCC D;  4OWF A;  1NWQ A;  1ZRT E;  1KFN A;  1J2J B;  2BCC E;  1SQV K;  1VDF A;  2E74 C;  1VF5 B;  1JMM A;  1X22 A;  1P84 I;  2YKP A;  1PGP A;  3K5B A;  5K5G B;  3CCR P;  2E75 B;  2AXT E;  2IEF A;  2W6A A;  2CK3 H;  2Z5H A;  1SQX K;  2POH A;  2ZT9 C;  2O01 J;  3JC2 2;  1VQN P;  1R8D A;  1NHL A;  1N73 C;  1BGY G;  5KLV K;  1FDM A;  4RO0 A;  4C7N B;  1OMI A;  1SFC B;  1E5W A;  2E76 D;  2WZ7 A;  1L0N J;  2G3A A;  2P67 A;  2KP8 A;  3VP9 A;  4IFF A;  3H1H G;  2OYI C;  3M9Q A;  3A0H H;  1FZC A;  1JB0 J;  4IL6 X;  5APS A;  1JY2 N;  2WMM A;  5KLI C;  1URQ B;  3WUU A;  3F89 A;  2KOG A;  1CI6 B;  1KIL B;  5H2F E;  3TGU E;  3SFD C;  5AW4 B;  4EIJ A;  1HWT C;  3R2P A;  2IZ1 A;  4R24 B;  1J1D B;  2Q9I A;  4U3F G;  1SQX G;  1GW3 A;  2G8Y A;  1FZC C;  1X9V A;  4YXD C;  4TLF A;  1BCC G;  5APX A;  5TIS E;  2WSF H;  3MTU E;  4LC1 A;  2O1J A;  3CX5 H;  3B5N B;  1RF1 B;  1YBK A;  2VZ4 A;  5E79 E;  2LR2 A;  3WU2 E;  2SPZ A;  2XNX A;  3FWN A;  3H32 A;  4JYB A;  4DZO A;  2ZXE B;  3R8J A;  1SQB D;  2OAR A;  3AEB C;  2R5B A;  3CXH I;  1EQ7 A;  2IPP A;  2QJK B;  1EZV E;  1XTG B;  1MKM A;  3ITK A;  1OVR A;  2IBZ E;  3WU2 H;  1NU1 D;  1JY3 N;  1JMB A;  1AV1 A;  1LTA C;  1N7S A;  1KFM A;  1FOS E;  1L4A D;  1NTZ D;  1JBG A;  4YPC A;  2WWW A;  1N7S D;  1FU1 A;  1IJD B;  2D2C C;  2IZ0 A;  3B5N C;  4YXW H;  3FGA D;  3B5N A;  3V2R A;  2KS1 A;  1BOW A;  1SQB G;  2HOD A;  3RK2 D;  2YIU B;  1GU4 A;  1VQ9 P;  3H1H E;  1SQB E;  3CCV P;  4EDF A;  4H13 B;  3NFQ A;  1PP9 G;  1CZQ A;  4J2N A;  3M91 A;  2M5A B;  3MUD C;  3L73 D;  3P32 A;  3N4X A;  5DJT B;  2OYH A;  1HBW A;  1GK4 A;  1IK9 A;  3CWB D;  3L70 G;  2HR3 A;  2B88 A;  1KYO H;  2AXT H;  1GD2 E;  2YNY A;  1NTM E;  3AE2 C;  3O8Z A;  4JPZ B;  4QMA A;  2J58 A;  2B87 A;  4UB8 H;  1S5L H;  1PPJ E;  2W90 A;  1OX3 A;  1KYO I;  1NTM J;  1RE4 C;  2UWJ E;  1ZW0 A;  4OH8 B;  5AVQ B;  5B66 E;  3B8E B;  1KB9 H;  5KAX A;  2XV5 A;  1M56 D;  1AA0 A;  4YTP C;  3TYY A;  3H1J J;  2NPS B;  2M3B A;  3G6E P;  3B71 A;  3HTK B;  1PZQ A;  1P84 E;  5B66 H;  2IBZ D;  3P8M C;  3V2N A;  4C7R A;  3I56 P;  4WY4 D;  1LX8 A;  2NRG A;  4H44 D;  2QJP C;  3M0A A;  1S5L X;  4D6T D;  1LT1 A;  4R4L A;  1Q06 A;  1PFI A;  3V6I A;  4B0Y A;  4R4M A;  3LW5 J;  3MUD A;  1NTK K;  3L74 D;  1NKZ B;  1H0T B;  4H0L C;  5C39 A;  3CXH H;  3A5T A;  1S9K E;  1ZN5 A;  3EZ2 A;  1N73 A;  1LTJ B;  1JY3 P;  2H7H A;  1BSH A;  1FDO A;  1KMI Z;  1IK7 A;  1NU1 K;  2E74 B;  2RN0 A;  2PP6 A;  4EI2 A;  3H1K G;  1LT9 C;  3GK6 A;  3IAO A;  5AW3 B;  5KTB A;  2K9Y A;  2KSJ A;  4I2L C;  2J59 M;  1USD A;  2PFX A;  2Z4E A;  2KUB A;  3EWK A;  1RE4 A;  1L0L J;  1VF5 D;  3PRJ A;  3GHG B;  3HD7 C;  1NAY A;  4D6T G;  2WIT A;  2HFE D;  3BRV B;  5EFW B;  3GW6 A;  5KLV G;  3OW2 O;  2GM4 A;  1KIL C;  5KJ7 A;  1OW8 A;  2R3S A;  1ZR4 A;  2YO2 A;  5KLV J;  1IFD A;  3BAS A;  2FXO A;  3L71 E;  1X8Y A;  1SFC D;  3A0B H;  2AEF A;  2RH0 A;  3AE3 C;  1G1J A;  2E76 B;  5AVR B;  1U57 A;  2YXQ B;  1JTH A;  2JWD A;  3QH9 A;  1U7M A;  1FZC B;  1L0N K;  3C8V A;  3T97 A;  1Q81 Q;  3G9R A;  2ZYA A;  2O01 H;  1GL2 B;  3RL0 B;  3U1C A;  3D70 A;  3LIE A;  1ZR2 A;  3V4W A;  2QJK C;  4OGQ D;  3L72 D;  2QE7 H;  3D6Z A;  2Y9Z A;  2NPS D;  3KDP B;  2XDJ A;  4IFM A;  2HPC A;  5KKZ B;  3VMX A;  4NPD A;  5KLI B;  2IBZ I;  3GPV A;  2ZYG A;  4JBZ A;  3VOP A;  1FOS F;  2QSI A;  4KHX A;  3CLQ A;  1RF0 A;  3EQ2 A;  2FFD A;  1S5L E;  5AW5 B;  1EDL A;  2YO3 A;  2BEQ D;  2XND H;  4WVZ A;  5KJ7 D;  3VTP C;  2WQY C;  1NTZ J;  1GL2 A;  1JY2 O;  4DCZ A;  2JR8 A;  1JYH A;  1FZG A;  2ZXX A;  3T97 B;  1SQV E;  1HH0 A;  1Y9B A;  1N73 B;  5CCG D;  3F5H A;  1T3U A;  1QLE D;  4HB1 A;  1VQ4 P;  3PP5 A;  5CJ0 A;  1PP9 E;  1SQX E;  4EOT A;  2KCU A;  5GTI H;  5KAI E;  1Q09 A;  2OTK E;  5APW A;  3CCM P;  1JUN A;  1VQ5 P;  1S4X A;  1KV4 A;  1RH5 B;  1L0L E;  3G71 P;  1T2K C;  1L0L G;  1JEK A;  1QVF O;  4M3L A;  2A45 I;  2HLO A;  3KQG A;  1FDI A;  2B9B A;  5CCG A;  1YQ3 C;  5GTI E;  2QM8 A;  1KOR A;  2E5T A;  1IC2 A;  1SQP E;  2HG5 D;  1GL2 C;  3RL0 C;  4L73 A;  5CCH C;  2HPC B;  2KZJ A;  1JY3 O;  3AE8 C;  3AE7 C;  1HVV A;  2WSF J;  1KB9 D;  1PM6 A;  3HUS A;  3R4Y A;  2FYU K;  1OIP A;  1E79 H;  5AW7 B;  1KB9 I;  5CMZ A;  2B87 B;  3TGU D;  3N7N A;  1EZV G;  2XU6 A;  2BAS A;  1T8Z A;  4PD4 E;  2H89 C;  1PP9 D;  1GDT A;  1NKN A;  3KYQ A;  4GKG A;  3I55 P;  1LWU C;  3L73 G;  3O6Q A;  1OW6 A;  2H88 C;  3AE4 C;  3SSU A;  3A0B E;  4PJ0 E;  2JEE A;  2M8R A;  3CWB G;  1Q07 A;  1RY3 A;  5I44 A;  3AEF C;  3CC2 P;  2KB7 P;  2K88 A;  1EDJ A;  2J5U A;  2HYN A;  2K9J B;  1YI2 P;  4OGQ B;  1KIL D;  3Q5S A;  1KQF B;  3W67 A;  3R8K A;  1FJK A;  3HRN A;  4DT0 A;  3VMZ A;  3CD6 P;  2N9Y B;  4N3Y B;  2QJY B;  4ZNC A;  1YTZ T;  1EZV D;  3KPE A;  3P7K A;  1RE3 A;  1SQX D;  3ZDM A;  1L4A C;  1SQQ K;  1HJ0 A;  2FBW C;  1QL1 A;  3OJA B;  4L74 A;  4I7Z B;  3JCU E;  5GTH H;  2QJP B;  2D2C D;  1WRG A;  3A3Y B;  1NVO A;  1SP4 A;  2OQQ A;  1M7L A;  1NYH A;  1CSB A;  5BVZ A;  4LLH A;  1NU1 G;  3EFG A;  3TDK A;  1LP1 B;  1BDC A;  1LTI C;  2JML A;  3MIW A;  5KAF H;  2IBZ G;  3L70 J;  4DJG A;  4W7Z A;  2RKL A;  4H13 D;  4BXL A;  3RK3 B;  4RKU J;  3USS A;  3KZI E;  3IR9 A;  5APT A;  1IFP A;  2ZAE B;  1W2E A;  1VQ6 P;  5CCH A;  2K3R A;  1Q90 D;  2Z5I A;  2R32 A;  1MUU A;  2M3E A;  1L4A B;  4IL6 E;  1JNM A;  3GMA A;  1K04 A;  2FXP A;  1L0N G;  3CWB J;  5KAF E;  5AW0 B;  2BCC D;  3CPW O;  2WPR A;  1LTT C;  3V4Q A;  1Q08 A;  1ZLL A;  1LP1 A;  1YIT P;  1YJ9 P;  1BGY J;  1AJY A;  2N9B A;  2GA1 A;  5E01 A;  3VMY A;  1KQG B;  1LGH B;  2Q3E A;  3WUV A;  2WSS H;  3MD0 A;  1M90 Q;  4CPG A;  2WT7 B;  2Q6Q A;  1QGK B;  3L75 E;  4IOI H;  1DD4 A;  2QRX A;  1LWU A;  1N8R Q;  1N7L A;  2WT7 A;  5KAV A;  2YMK A;  2WSC H;  4H13 C;  1FZB A;  3L72 G;  1Q2N A;  1QL2 A;  2OYH B;  1PL5 A;  5APV A;  1X0T A;  3Q5R A;  4D6T E;  2NPS A;  2CPB A;  1BE3 G;  3AE6 C;  3SFE C;  1GTW A;  1RE3 C;  1KYO E;  4MN4 C;  3RK3 E;  4AYZ A;  5CHX A;  4BRY A;  4KT0 J;  1BCC E;  3RL0 g;  4HKZ H;  3GLM A;  4R4E A;  1S3J A;  2JJL A;  3H1I E;  4PV1 B;  1NTK G;  3M9B A;  4AYC A;  1EXI A;  1S9K D;  3EZ9 A;  2W6J H;  1DIP A;  2H43 A;  3HE5 A;  5KAU A;  1GU5 A;  3E1R A;  2BEZ F;  3RGU A;  1GZL A;  2OG0 A;  4PD4 D;  1QEX A;  2Q7C A;  1S1C X;  3L74 G;  2WPV B;  2OGU A;  2ZYD A;  4LGD E;  3P8C E;  2P58 A;  2E76 C;  3CWB E;  3LW5 H;  2OTL P;  1M8O B;  3CX5 E;  2O01 N;  1YIJ P;  1K8A Q;  3HD7 A;  2QVA A;  1NTM D;  2JDI H;  1P84 H;  4H44 B;  4IFD K;  2I8D A;  1ZV8 A;  1L4A A;  1IZN B;  4PV1 D;  2WTY A;  3H32 B;  2N1T B;  2PRR A;  1FZA A;  1RF1 A;  2H8P D;  1SQP D;  1AFO A;  2WSE H;  3V2Q A;  5CJ4 A;  1USE A;  1ZME C;  1AQ5 A;  4GT1 A;  5KCB A;  1IFN A;  1GW4 A;  2FYU J;  3CXH E;  3H1H D;  2Y0C A;  1GMJ A;  1AQT A;  4EYY Q;  3D6Y A;  5AW9 B;  1NTZ E;  4KJM A;  2FFD C;  3CMA P;  2W8Z A;  1JCC A;  3NMD A;  4H44 C;  1OVU A;  2ZFC A;  1OW7 A;  5AW1 B;  2Q1K A;  2Y0D A;  1BCC J;  1RH6 A;  4UB6 H;  1IFM A;  1WT6 A;  3TGU G;  4H0L D;  3GF3 A;  3BRT B;  1FBM A;  4U3F D;  1MZ9 A;  3NXS A;  1JTH B;  1L2P A;  2P2U A;  3H1I G;  3G4S P;  4R22 B;  4WBA A;  1DEB A;  2FYZ A;  1DD3 A;  1RQV A;  1FZF A;  3UCS A;  2KK7 A;  2N1T A;  4OVN F;  2YIU C;  3H1I J;  2L91 A;  1LTG C;  1VF5 C;  4A7P A;  3TSI A;  2Y0E A;  3L74 J;  2C9L Y;  2Y9Y A;  5H2F H;  2R3C A;  2ZHG A;  4PJ0 H;  4TT3 H;  4PD4 I;  2IX7 C;  2I1J A;  2HVA A;  1NU1 E;  1SFC C;  1L0L K;  3CL3 D;  3CCS P;  3LID A;  1VQO P;  1Y8A A;  1BGY D;  1LJ2 A;  1D7M A;  1QX8 A;  2JKV A;  1RQU A;  2E42 A;  2KLV A;  3EZF A;  4ZKU A;  2DW3 A;  1BE3 J;  2LXC B;  3L73 E;  1YHQ P;  3L75 G;  5E79 H;  1SFC A;  2IFM A;  3CCL P;  1HGV A;  5KAW A;  3MHV A;  3H1L D;  1FZE A;  2NPS C;  3AEE C;  1W2B O;  3NTN A;  1R8E A;  4JF7 A;  1URQ D;  2ZJS E;  3GF7 A;  2V4H A;  2XZR A;  5CCH D;  1YJW P;  1X79 B;  3RK3 D;  2FYU E;  2FYN B;  3GHG C;  2N1T C;  4DCK A;  2A06 D;  1WMK A;  1XTC C;  4GOE A;  3AE5 C;  4N78 E;  2GUV A;  3CCJ P;  3OA7 A;  1KYO D;  4L76 A;  1J1E C;  1Y6U A;  2I1K A;  2D2C B;  4AYZ B;  2C0W A;  3L70 E;  3BCC G;  1IFJ A;  3C9I A;  3L75 D;  1SQB K;  2YXR B;  1BSN A;  3II6 A;  2QEX P;  3AE1 C;  3M06 A;  1G2C A;  5KJ7 C;  3PH0 A;  1W5C E;  4IL6 H;  2WPS A;  2IFN A;  3L71 D;  1K73 Q;  3CCE P;  1RHZ B;  1LWU B;  4WY4 C;  2XKM A;  3HE4 A;  2AEM A;  2FYN C;  1NU1 J;  1PGQ A;  4DOJ A;  2FXM A;  4K35 A;  2BCC G;  2KLU A;  3UIA A;  3HTK A;  1TU3 F;  1HTL C;  2DG6 A;  3PLN A;  3V2P A;  1ZOY C;  4Y28 J;  2JP3 A;  5AVZ B;  1Q86 Q;  5APQ A;  1P84 D;  3H1L G;  4N78 D;  3H1J D;  3IFM A;  3HD7 D;  5CCG C;  4ASW A;  1UIX A;  2PAJ A;  3W68 A;  2K37 A;  3AE9 C;  2WVR A;  1CW5 A;  1FAV A;  1SQV G;  1YJN P;  1SQQ J;  3BVH A;  4D6T J;  2W6B A;  2A06 G;  1L0N E;  4XA4 A;  3A7O A;  3BCC J;  2WSC J;  3L73 J;  4W7Y A;  5AW8 B;  3HE4 B;  2MKV A;  2VRS A;  1MFT A;  1T2K D;  1VQL P;  1S72 P;  4Z1M H;  4ZMD A;  1Q82 Q;  4O9B A;  2P10 A;  2BOW A;  2AXC A;  3Q5P A;  3L37 A;  3L70 D;  1Z56 A;  1PV3 A;  3S4R A;  3RBZ A;  5KLV E;  1VPC A;  1R5S A;  4H0L B;  4U3F E;  4WLW A;  1S2E A;  1NTM G;  1NJI Q;  3S1K A;  4XFJ A;  4C46 A;  2E75 D;  3L71 G;  3JCU H;  5GTH E;  4LHF A;  3B5N D;  1EZV I;  1OZH A; 
#chains in the Genus database with same CATH homology
 5M1B A;  3AED C;  1ZME C;  1KIL E;  3AEC C;  2G8Y A;  1PL5 A;  2FYN C;  1RQU A;  4I7Z B;  5KCB A;  2WSE J;  3Q5R A;  2D2C D;  2IDB A;  2GOV A;  3AE6 C;  3SFE C;  4YXD C;  3GPV A;  3EZF A;  3Q3D A;  2OQQ A;  4H0L C;  1TU3 F;  2DG6 A;  1GMJ A;  1NYH A;  2QSI A;  2ZT9 B;  4A1M A;  3D6Y A;  1ZOY C;  4OGQ C;  4Y28 J;  2JP3 A;  5GQQ A;  3AE8 C;  3AE7 C;  3RK3 E;  4R4M A;  3Q1M A;  2E75 C;  1Q0A A;  3EZ2 A;  2NZ2 A;  2JML A;  1ZRT E;  2WSF J;  4H44 C;  4WLS A;  4AYZ A;  3Q2Y A;  1FDO A;  1KMI Z;  4KT0 J;  2BEQ D;  1IK7 A;  2VZ4 A;  1PM6 A;  3RL0 g;  3R4Y A;  2E74 B;  2JO1 A;  3AE2 C;  5KAW A;  3GLM A;  1Q05 A;  3D71 A;  2E74 C;  4R4E A;  1OW7 A;  1VF5 B;  1NGM B;  1UIX A;  3ABV C;  3AEE C;  3R8J A;  2WQY C;  4PV1 B;  3GK6 A;  3IAO A;  4H13 D;  3S9O A;  1R8E A;  2E75 B;  2K9Y A;  1RH6 A;  2IEF A;  3AE9 C;  3QAO A;  3AEB C;  4DCZ A;  1EXI A;  4RKU J;  3GF7 A;  1JYH A;  1D5Y A;  4U7J A;  2ZT9 C;  2O01 J;  3EZ9 A;  1VF5 D;  3AEG C;  3EWK A;  2H89 C;  4H0L D;  1R8D A;  3GF3 A;  3E0H A;  3T97 B;  1DIP A;  1Y9B A;  2V7Q J;  4I7Z C;  5KKZ C;  2WSC J;  5L8R J;  3O6Q A;  1Q90 D;  5KAU A;  1OW6 A;  2H88 C;  1PIX A;  1ZP0 C;  2BEZ F;  1MKM A;  3AE4 C;  1OMI A;  5KAX A;  1WMK A;  2MKV A;  4R22 B;  3GMA A;  1K04 A;  3GP4 A;  3AE5 C;  2FXP A;  5I41 B;  2OG0 A;  2KCU A;  2E74 D;  1OW8 A;  1DD3 A;  2E76 D;  4Z1M H;  1Q07 A;  1S1C X;  1RQV A;  3UCS A;  5I44 A;  1Q09 A;  1Y6U A;  2G3A A;  3AEF C;  2YIU C;  1VL2 A;  1KTM A;  2WPV B;  2P10 A;  3AEA C;  4YTP C;  3LUR A;  4PV1 C;  2D2C B;  4AYZ B;  1YQ4 C;  1Q08 A;  1JBG A;  1VF5 C;  2E76 C;  2BOW A;  2J5U A;  3LW5 J;  3Q5P A;  3H25 A;  2ZT9 D;  2QIW A;  3AE3 C;  1EXJ A;  3B71 A;  2E76 B;  1PV3 A;  1JB0 J;  4OGQ B;  1AJY A;  4IL6 X;  5E01 A;  4GDO A;  3IN6 A;  3Q5S A;  2D2C C;  1U57 A;  1K05 A;  1KQG B;  4H0L B;  1KQF B;  3B49 A;  3R8K A;  4H44 B;  3HH0 A;  5KLI C;  4WLW A;  3FGA D;  3C8V A;  3AE1 C;  3EZ6 A;  1BOW A;  5D90 A;  4XFJ A;  4PV1 D;  1DD4 A;  2E75 D;  2ZHG A;  3G9R A;  2ZHH A;  4TT3 H;  1LX8 A;  4H44 D;  3SFD C;  3EZ7 A;  3D70 A;  1FDI A;  2QJP C;  5KAV A;  1S5L X;  2HVA A;  2QJK C;  4R4L A;  4OGQ D;  5KAT A;  1Q06 A;  4R24 B;  3D6Z A;  1YQ3 C;  2YMK A;  4H13 B;  4J2N A;  4LHF A;  2QJY C;  4B0Y A;  2KVV A;  5D8C A;  1HJ0 A;  4H13 C;  1KOR A;  2FBW C;  1HF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...