3Q3DA

Crystal structure of bmrr bound to puromycin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
b'KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna/antibiotic
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q3dA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q3dA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q3dA03
2GOVA 3GP4A 4J2NA 3GPVA 1BOWA 3HH0A 3R8KA 4WLWA 1JBGA 3Q2YA 1EXIA 3GK6A 3B49A 2ZHHA 2BOWA 3Q1MA 1Q06A 5E01A 3D71A 3Q3DA 1Q09A 5I44A 3D6ZA 4WLSA 2JMLA 3G9RA 4AYZB 1DIPA 4R4EA 1Q08A 2ZHGA 1R8DA 1Q05A 3IAOA 5GQQA 2J5UA 3QAOA 3D6YA 4R22B 2OQQA 2DG6A 5KAWA 4R24B 3R8JA 2VZ4A 3Q5PA 3D70A 5D8CA 4R4MA 5KAXA 1JYHA 4B0YA 3LURA 5D90A 1Q0AA 3UCSA 1R8EA 3Q5SA 1EXJA 3T97B 2HVAA 2KCUA 5KAUA 5KATA 5KCBA 3E0HA 5I41B 4A1MA 5KAVA 1D5YA 4R4LA 4AYZA 3Q5RA 1Q07A
chains in the Genus database with same CATH superfamily
1RF1C 3CCJP 2NPSB 2BCCE 2OARA 3L70J 1LTSC 2WITA 1G1JA 4TLFA 1NO4A 2YNYA 1SQQG 1PV3A 4XE5B 3C9IA 3U1CA 3TNUA 4A1MA 4M3LA 3I56P 2WT7B 4LC1A 1R5SA 3EFGA 2B89A 1QLED 1YQ4C 1H88A 3C1LA 5KKZB 1K9MQ 3TGUE 1JYHA 4JYCA 3AE3C 4WWIA 5KAUA 3AE1C 1W5CE 3BCCG 2GA1A 2P7JA 1GK4A 5AW1B 3E1RA 3FWNA 2R5DA 1T2KC 5CCHC 1EQ7A 1EZVE 1RF0A 1L0NG 1ZOYC 3H32B 3KZIH 4C46A 1M90Q 1ZRTE 1PGJA 4ASWA 3EZFA 1GW3A 3HUSC 2IBZE 4WY4B 2R5BA 2ZT9D 3H1KE 2W6JH 4HH2A 5CBNA 3SSUA 1JTHB 3MTUE 4L73A 3E1IA 2P58A 5KAIE 4K3AA 1KFNA 4XFJA 2OYOA 5CCGC 1HWTC 2HODA 2BCCD 1Y9BA 3P8CD 2YXQB 5CCHD 4EIJA 1Q7YQ 1GU5A 2WZ7A 4PV1C 1SQPD 2I1JA 2JDIH 2GOVA 3AE7C 3NFQA 2KS1B 5AVVB 5TJHA 2HR3A 4W7ZA 3B49A 1L4AA 5KLVE 2JO1A 2BCCJ 4Y28J 1WT6A 2KYVA 2HPCA 1P84E 1JM0A 2M8RA 2R3SA 5APTA 2O1KA 2QVAA 3LURA 1JUNA 1X22A 2Y9YA 1SQPJ 3PRJA 1W2BO 2O01J 4IFDK 2YMYA 3RK2C 3H1JG 4EDFA 3G9RA 2KNCA 3AEFC 1CZQA 3MUDA 3RL0C 1LP1B 4DOJA 1NTKG 2KIKA 5BU5A 2V7QH 5H2FH 2IBZD 1G1IA 1H89A 5KLVK 1GDTA 1QL2A 3CMEP 5I44A 1BE3G 3R2PA 3VMAA 4RJTA 2WSFJ 2K1AA 1LTJB 2M0BA 2KK7A 1S72P 3E7KA 3RK2D 1SQXD 2D2CC 2FFDA 2ZYAA 4U3FG 1FZCC 5KAFE 1FE6A 3M0DC 2Q3EA 4KT0J 3RL0D 3GF7A 3IAOA 4WBAA 1PPJD 1OMIA 3E0HA 1AQ5A 3KQGA 2MJZA 1D7MA 3WUUA 1LX8A 1LT9B 2YKOA 3JCUH 4OVNF 3PLNA 1SQXJ 2E42A 3TNUB 5KLVD 2QJYB 4AYZB 4OH8B 4IFFA 1LJ2A 1P84D 4JQ0D 3BATA 2D2CD 3FGAD 1PZQA 2XKMA 3C8VA 5KAVA 1OFCX 3HD7B 1SQBE 3N4XA 5GTIE 2W27A 3GHGA 2XNXA 2WPSA 2AXTH 2IZ0A 1N73B 4XA4A 4N78E 1T3JA 4ZKUA 2WSCJ 1KORA 5KLVJ 1VPCA 1NWQA 2W90A 2H89C 1YHQP 2RH0A 3CCEP 1RH6A 1E5WA 1MUUA 1KB9E 2YXRB 1JO5A 2JWAA 3RK3E 2AEMA 3HE4B 2PRRA 1DEEG 3L35A 3PP5A 2IYOA 1Y6UA 3WU2H 1SFCB 3H1HE 5AVUB 2RMZA 4R4MA 1KV4A 1NTME 1YJ9P 4NPDA 4BRYA 5KCBA 2QM7A 1SQBK 2W6AA 3CI9A 3W68A 1GL2A 2IBZI 3L73E 2FYNB 2N9YB 3OW2O 1FZFA 3A7OA 3WUTA 3U1AA 5TISE 1QX8A 1NU1G 1RF0C 3W67A 1VQ4P 4KHXA 3SFEC 2NZ2A 3VN0A 3RK3C 3HD7D 2Z4EA 1N86A 1VF5C 5AW0B 2OYHA 1NTMK 1JMMA 3V5BA 3IFMA 1CI6B 1S5LH 2O01H 1YJWP 1D5YA 1L0LE 5AVQB 4Y99C 3V4WA 1LT1A 2E76B 1A02J 3CCVP 3OA7A 2WMMA 4N78D 1GD2E 3QH9A 3V2RA 1PP9E 2PP6A 1P84I 1EXJA 3L75D 3AE2C 1SFCD 3CL3D 5C39A 1KB9D 2HYNA 1NTZG 1K8AQ 3V6IA 1M8OB 2C9NY 4C7NB 1GK6A 3KYQA 3RK3D 1L4AC 3H1IG 2A06E 3QWOC 1VF5D 3BCCE 2WSFH 1JY2P 3CXHD 2QIWA 3AEGC 3LW5J 1KZUB 2JJLA 2QJKB 3CWBD 1T3UA 1NTMD 4CPGA 1RH5B 1L0LK 4OGQB 3L72G 3L75J 2E74B 3AE4C 1L0NE 2YIUB 3L73D 2ZXEB 2K9JA 1S5LX 1GW4A 1IFDA 3MUDC 3L71E 4C7RA 2WTYA 4PJ0H 3P8MC 3JSVC 3LIEA 1KQLA 1L4AD 3CWBJ 1NTMJ 2G8YA 2NRGA 1JBGA 3EZ2A 1H0TA 2KXPB 2UWJE 3L73J 1USDA 2XV5A 2E76D 1VQNP 1GU4A 1M1JC 3L74G 2L91A 1QVGO 3GW6A 3UCSA 1L0LD 2FFDC 1HGZA 1L0NK 3F5HA 2WSCH 3Q1MA 4H13B 5E79E 2OG0A 2G3AA 4L75A 3M9BA 1P84H 1VL2A 1ZP0C 5GQQA 4YTPC 4LGDE 1PP9D 1CSBA 3SWYA 3VMXA 2KB7P 3R8KA 3CCLP 3EZ9A 3M06A 3B5NB 1L0LJ 3H1LG 3G3ZA 1LWUA 1URQB 2A06D 1U7MA 1JEKA 2E74D 1RF1B 5K5GB 1GZLA 3H1JE 4L74A 5KTBA 1Q0AA 1RE4A 5BU8B 1PP9J 1KB9I 5CHXA 3KPEA 5AW3B 3GHGC 1ZR4A 1N8RQ 1HTLC 1L0ND 2XDJA 1OW6A 5AW2B 1U7JA 1ZXGA 3EQ2A 3CXHI 1KN7A 3L71D 1KQFB 1QVFO 1EDKA 3S9OA 1VQLP 3T97B 1HUCA 1HF9A 4AYCA 1J2JB 3RGUA 4GKGA 2C0WA 3OAKA 3O6QB 1VQ6P 4BWNA 1L2PA 1G2CB 1L0NJ 4H13D 5AW6B 4U3FE 2LXBA 1DEBA 3L71J 1USEA 4MN4C 1GTWA 1GL2C 3CLQA 1YI2P 2H8PD 1UIXA 3F89A 4UB8E 1HBWA 4A7PA 3B5ND 3HUSB 1URQD 3V4QA 1AQTA 1AV1A 2R32A 2OTLP 4DCZA 5GTIH 1VQOP 2K9YA 3LW5H 1MFTA 3CC2P 1HH0A 2W6BA 4R22B 2OYHC 5KJ7A 1KB9H 3H1JD 4ASVA 3GF3A 1GL2D 2M5AA 4YXWH 5B66E 2IYPA 1VQPP 2GUSA 2QRXA 3AE8C 1FDIA 2ZHHA 3CXHH 4PV1B 4N3YB 2AEFA 3L70G 2ZYGA 2HG5D 2XZRA 1JCDA 3D70A 5AW8B 5APSA 2E5TA 2O3JA 1EDIA 3H1JJ 2PFXA 1NAYA 3P7KA 1IO4A 1CW5A 2BEQD 5APVA 2KSJA 3CMAP 1T2KD 3B71A 3SWKA 4EYYQ 1IC2A 3EFFK 1R5LA 5TISH 1VQ9P 1H0TB 1VQKP 1ZR2A 3RK2B 4KJMA 5AW4B 4HYTB 5DJTB 3VMZA 3ZDMA 3RL0B 1NU1E 1SS1A 2Z5HA 2Y9ZA 3RBZA 1HJBA 2JWDA 2YO3A 4IL6E 2ZHGA 4I1LA 5KLIC 3QAOA 1LGHB 1SVFA 2P67A 3TGUD 1GMJA 5CCGD 1Q07A 1KILC 1IFPA 1PL5A 1RQUA 1KYOE 1IJDB 1PFIA 1LTIC 1BCCE 2D2CB 4R24B 3CCMP 3VP8A 1JB0J 4PV1D 4B86A 1EZVD 1FZCB 1OVVA 3A0BH 2AEJA 2IFMA 3S4RA 1ZRTD 5APQA 3TGUJ 3HE5B 1NU1K 1YTZT 2PGDA 1JMBA 3VOPA 2WSSH 4IOIH 3HTKA 3H1KD 1NTZE 2OYIA 2IX7C 3VYIA 1J1EC 2E43A 1Q82Q 1PM6A 2ZYDA 3AEBC 3Q5PA 3H1IE 1OWAA 1M1JA 2HVAA 1FDOA 2XU6A 4YXDC 3CX5E 1NJIQ 1LWUC 4DT0A 3L72E 4WLSA 4R4EA 3H1KJ 4I7ZC 2FY8A 1LTBC 1AFOA 3R8JA 2FYZA 2BCCG 3M0AA 2VZ4A 4PD4E 2LKMA 3EZ6A 1RE4C 4IFMA 1MV8A 1NU1D 2ZFCA 1NTZK 3MIWA 1NKNA 1SQPG 3IN6A 2OQQA 2M3EA 3AECC 3BVHA 3EWKA 2A45G 2KSEA 1BGYE 1NAFA 5CJ4A 3L74E 2RKLA 5E79H 2J58A 2YKPA 1SQVG 3D71A 1KYOD 1NU1J 1BCCD 2JEEA 5APYA 2K3RA 1LTTC 1IK7A 2FXPA 1PGOA 1N2DC 1S3JA 2POHA 2YMKA 1WRGA 2Z5IA 4D6TE 5AVYB 3K5BA 1VQ7P 2B87A 2BEZF 2IBZG 2ZJSE 5KAWA 3H1LE 3H1ID 2Q5UA 5AVSB 1BCCJ 1EZVI 3RK3B 2QE7H 2W83C 3WUVA 1E79H 3CX5D 2QM8A 1VF5B 4BXLA 1J1DC 2QEXP 4ZMDA 3AE9C 1NVOA 1LTGC 1SQXG 4Y99B 3AEAC 5KJ7C 2HODB 1RE3A 3TF5A 4PD4D 2IFNA 3PHLA 1DX7A 5BVZA 4AQRD 1YITP 2N1TA 3H1IJ 2V4HA 2Q9IA 5AW9B 3II6A 2LXCB 5M1BA 1PPJG 1TU3F 4GOEA 1KFMA 1JY3O 3FXEA 4OWFA 1FJPA 1N7SA 2NPSA 1M7LA 1X79B 3CC4P 1L4AB 1S2EA 5KLVG 3CPWO 3V2NA 2Y0CA 2HPCB 2H7HA 1FS0E 1BGYD 3B4SA 1SQQE 1SQBD 3L74D 1M56D 4I6MC 4UB8H 4L76A 1VDFA 2HFED 1EC5A 1ZMEC 1QEXA 2CPSA 2KNCB 1NOHA 2WT7A 4N6JA 4H0LC 1BGYJ 5CBOA 1SQBJ 3L74J 1KYOI 4D6TD 2FKWB 2FYUG 3AE5C 3HTKB 3H1HD 1ZLLA 5B66H 4DJGA 3RBXA 3NTNA 1SQQK 3TK1A 3GPVA 2LR2A 1M1JB 1SLQA 2OTJP 2R44A 1OW7A 1Q81Q 3H32A 4ZKPA 3FX0A 2FFDB 2CK3H 5KAIH 1OVUA 4D6TJ 2K37A 4WY4A 2L5GB 1QL1A 3H1HJ 3VP9A 1JTHA 3CX5I 4W7YA 1KILA 1DH3A 3GG2A 3KDPB 5E01A 1UIIA 2OYIC 3MGNA 2E75C 4HB1A 2WQYC 3BASA 2CPBA 4PD4I 1JY3N 2SPZA 1YTZI 1SQQD 1EDLA 4GT1A 1K05A 2B88A 4AUWA 3D6YA 1M1KQ 4EI2A 3KXDA 3GHGB 2KS1A 1HJ0A 2QG4A 3M9HA 1IFIA 1NH4A 2H88C 3USSA 2WPVB 1KYOH 3PTZA 2E75D 3L75G 4LLHA 1SQQJ 3BCCD 4NPEA 3MHVA 3FXDA 2I8DA 4JBZA 1ZW0A 1KTMA 2C0XA 1AVOA 3CWBG 4BRYB 3TSIA 1LP1A 1NTKE 2KZJA 3PH0A 1GL2B 2KI7B 3BCCJ 4H44C 2DW3A 4LHFA 2IPPA 5KATA 3CCRP 1XTGB 3CX5H 3G71P 1QGKB 5I41B 1BE3E 5EFWB 3M9QA 1RQVA 3OJAB 3V2PA 3A0HE 5KAFH 2J59M 2V7QJ 1LTJA 4PD4H 1K73Q 2ZVNB 2P10A 5D90A 2OGUA 2KCUA 3WMM0 4HJGH 3U59A 4J2NA 2IEFA 2OYHB 3P8CE 1NTKK 1Q06A 3G6EP 1HVVA 4WB4A 1L0LG 2QJPC 4H44D 1M57D 2OTKE 2QA4P 1RE3C 1ZN5A 1LT9A 3A3YB 4RKUJ 1T8ZA 1SQPE 1VQ8P 2GUVA 1S5LE 1YJNP 2N1TC 4AYZA 1DD4A 3GP4A 1PP9G 2KVVA 2ZT9C 1N7SC 2NPSC 2DG6A 1OXZA 3HD7A 3S1KA 1SQVE 2A06G 1MZ9A 1NYHA 1KQGB 1VQ5P 3HRNA 1N73A 4TT3H 4O9BA 2KOGA 2WSEJ 4GDOA 1A02F 1IFNA 2ITAA 1YQ3C 1S1CX 2ZXXA 1NTKD 4RO0A 1T6AA 2Y0DA 2N1TD 4B0YA 1SQPK 3AEDC 3FWLA 2HLOA 3HE4A 2K9JB 2YO2A 3N7NA 1JNMA 1KILE 1OZHA 3G4SP 4GOFA 5GTHE 1BE3D 5KLIB 2KUBA 1SFCA 3L71G 3ITKA 5KKZC 1BSNA 1N7SD 1W2EA 1RHZB 2NPSD 3L36A 1KILB 1NTKJ 4HKZH 1SQVK 4PJ0E 4U3FD 1H8AA 1SQXE 5APXA 2JP3A 3CC7P 1FBMA 1BE3J 3IR9A 3BRTB 4UB6E 2N9BA 5DJUB 1FOSF 1Q05A 4WY4C 1PPJE 1WMKA 3AE6C 2IZ1A 1J1EB 4U3FJ 1EXIA 1EDJA 4JF7A 3PJSK 1CI6A 1LWUB 1U57A 2BASA 1SQVD 1RY3A 3Q5SA 1Y8AA 1SQXK 2Y0EA 4I7ZB 3CCUP 1KMIZ 3SFDC 4WY4D 4YPCA 1FC2C 1Q08A 5B5EE 2GM4A 2J5UA 4C7NA 3B8EB 4K35A 1IFJA 1FZEA 1KILD 1AVYA 5CMZA 5AVXB 1SQVJ 2RN0A 2JR8A 1MKMA 1AJYA 2FYUE 2KLUA 3TYYA 3L37A 3AEEC 1K04A 2O1JA 4JYBA 2Q1KA 1PGPA 3BRVB 2B9BA 2Q6QA 4JPZB 1S9KE 2XNDH 1NGMB 2Q3IA 2I1KA 1FZGA 2M3BA 1ZV8A 2Q7CA 3Q5RA 2FYUK 1IK9A 3TGUG 1LTJC 5AW5B 2H43A 1J1DB 1FU1A 2WSEH 1HGVA 4W80A 3O8ZA 2WWWA 3GK6A 1EZVG 2M5AB 1Q09A 2JMLA 2A45I 1NTZD 1R8DA 3GMAA 1LT9C 2R3CA 3NMDA 1OX3A 3L75E 3H1KG 3B5NA 1FDMA 1URQA 2E5YA 2QJYC 3KZIE 3IF4A 2ZVOB 1RF1A 2FYUD 2AXCA 1FOSE 3CXHE 1FAVA 3L72D 3HD7C 1NTZJ 3CWBE 1X0TA 1N73C 3I5CA 1BOWA 4WLWA 1OIPA 3GLMA 3CD6P 3A0HH 1S9KD 3JC22 2WPRA 2FYUJ 3D6ZA 5CJ0A 3T97A 1Q2NA 3L72J 4H0LB 2ZAEB 1MFZA 2FXOA 3O6QA 4EOTA 4WVZA 1JY3P 1SFCC 1G2CA 3UIAA 3MP7B 1OW8A 5AVRB 1BSHA 4U7JA 3P32A 2P2UA 5KJ7D 2P1JA 5CCHA 3A5TA 3KHUA 4I2LC 1Y47A 3A2AA 1VQMP 1R8EA 2FYNC 2JKVA 2WVRA 1FJKA 1BCCG 4DCKA 3HUSA 2A45H 1X8YA 2BOWA 1JCCA 3CCSP 4GODA 3TDKA 1BDCA 2VRSA 1JY2O 3H1LD 3NXSA 3A0BE 2OYIB 1LTAC 2E75B 2FXMA 3CCQP 5L8RJ 5CCGA 5H2FE 3SWFA 3EZ7A 4GIFA 1DIPA 4RESB 1SP4A 5KAXA 2E76C 1KC8Q 5AVWB 5GTHH 5AW7B 1PIXA 4R4LA 3H1LJ 3RL0g 3L70E 4H0LD 2YKQA 3M91A 3R4YA 1NKZB 5APUA 1LNQA 2KLVA 3VMYA 1AA0A 2WPQA 4QMAA 2C9LY 3H6PA 1Z56A 2K88A 1N7LA 3Q2YA 1OVRA 3JCUE 2QJKC 4UB6H 1KQSO 1S4XA 4IL6H 4OGQC 1PGQA 1BDDA 1BGYG 1FZAA 1YBKA 1SQBG 1FZBA 2E74C 3I55P 4DZOA 1NHLA 2YIUC 2FBWC 2KZIA 4NPFX 1KD1Q 4H44B 1DD3A 5AVZB 2AXTE 1XTCC 1IFMA 5D8CA 2O01N 4D6TG 5APWA 2B87B 3HH0A 2MKVA 3ABVC 1YYCA 3H1HG 3H25A 3VTPC 4OGQD 3L4FA 1JY2N 1FZCA 1NTMG 5B5EH 3M0DA 3MD0A 3MZWB 3WU2E 1YIJP 3HE5A 5AVTB 3LIDA 3L73G 4H13C 2IDBA 2QJPB 4Z1MH 1Q86Q 4IL6X 3L70D 2KP8A 1IZNB 3Q3DA 2N1TB 4ZNCA 3V2QA 1JOCA 2W8ZA 2PAJA 3B5NC 1URQC 2ZT9B 1Q90D 1X9VA 1N7SB 2QSIA
chains in the Genus database with same CATH topology
3GP4A 3AE8C 1IK7A 3Q2YA 2FXPA 2D2CC 2E74B 2WPVB 2YMKA 1OW8A 1EXIA 3AE4C 4H0LC 2E75D 1FDIA 2ZHHA 1Y9BA 4U7JA 2QJKC 4PV1B 1OW6A 2KVVA 2ZT9C 4KT0J 4OGQC 1S5LX 3GF7A 3IAOA 2BEZF 2DG6A 1PV3A 2E74C 1PM6A 3AE5C 3AEBC 1KQFB 3Q5PA 3D70A 1U57A 5KAWA 3S9OA 2YIUC 1R8EA 3Q5SA 2HVAA 1FDOA 2FYNC 1NYHA 3T97B 1KQGB 4PV1C 1OMIA 4YXDC 3E0HA 1HF9A 2FBWC 4I7ZB 4TT3H 3SFEC 4A1MA 2GOVA 2NZ2A 2WSEJ 3GPVA 1VF5B 1LX8A 2BEQD 2G8YA 3AE7C 1JBGA 4GDOA 4H44B 1YQ3C 3EZ2A 1KTMA 3B49A 3GK6A 2BOWA 1KMIZ 1DD3A 1S1CX 1Q09A 3AE9C 2JO1A 3B71A 3SFDC 4WLSA 2JMLA 1OW7A 4AYZB 4R4EA 1Q08A 1YQ4C 4I7ZC 4Y28J 1R8DA 2E76D 2J5UA 1VF5C 3GMAA 3AEAC 3R8JA 4H13D 2VZ4A 4B0YA 3AEDC 5D8CA 4H44C 1JYHA 3EZ6A 3LURA 3AE3C 3UCSA 4LHFA 1KILE 5KAUA 3AE1C 5KATA 2D2CD 5I41B 2QJYC 3FGAD 3C8VA 2E75B 5KAVA 1D5YA 1RQVA 1MKMA 1AJYA 3HH0A 2MKVA 3ABVC 3H25A 5L8RJ 4OGQD 2O01J 2E76B 5KKZC 5M1BA 3Q1MA 3EZ7A 1UIXA 1TU3F 5E01A 4H13B 2OG0A 2G3AA 2V7QJ 3G9RA 1DIPA 3AEEC 2E75C 2ZHGA 5KLIC 3AEFC 1VL2A 1ZP0C 5GQQA 4YTPC 3QAOA 1K04A 1KORA 2WQYC 2OQQA 2WSCJ 3IN6A 2H89C 3AECC 5KAXA 2E76C 2P10A 5D90A 1ZOYC 1RH6A 1EXJA 3EWKA 2KCUA 3AE2C 4H13C 1PIXA 1ZRTE 1GMJA 2IDBA 4R4LA 4Z1MH 1Q07A 2JP3A 3RL0g 3EZFA 4J2NA 4DCZA 4H0LD 4IL6X 2IEFA 1BOWA 3R8KA 1PL5A 4WLWA 3RK3E 3GLMA 3EZ9A 2K9YA 1K05A 2ZT9D 3R4YA 1NGMB 1RQUA 1Q06A 3D71A 3Q3DA 1VF5D 5I44A 3D6ZA 1Y6UA 2E74D 2QJPC 4H44D 2QIWA 1Q05A 3AEGC 1ZMEC 3D6YA 4R22B 2D2CB 3LW5J 4R24B 1JB0J 4R4MA 4H0LB 4PV1D 4RKUJ 2WSFJ 1Q0AA 1HJ0A 3GF3A 1WMKA 2ZT9B 5KCBA 1Q90D 4OGQB 3AE6C 4XFJA 3O6QA 2QSIA 4AYZA 3Q5RA 1DD4A 2H88C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOV A;  3GP4 A;  4J2N A;  3GPV A;  1BOW A;  3HH0 A;  3R8K A;  4WLW A;  1JBG A;  3Q2Y A;  1EXI A;  3GK6 A;  3B49 A;  2ZHH A;  2BOW A;  3Q1M A;  1Q06 A;  5E01 A;  3D71 A;  3Q3D A;  1Q09 A;  5I44 A;  3D6Z A;  4WLS A;  2JML A;  3G9R A;  4AYZ B;  1DIP A;  4R4E A;  1Q08 A;  2ZHG A;  1R8D A;  1Q05 A;  3IAO A;  5GQQ A;  2J5U A;  3QAO A;  3D6Y A;  4R22 B;  2OQQ A;  2DG6 A;  5KAW A;  4R24 B;  3R8J A;  2VZ4 A;  3Q5P A;  3D70 A;  5D8C A;  4R4M A;  5KAX A;  1JYH A;  4B0Y A;  3LUR A;  5D90 A;  1Q0A A;  3UCS A;  1R8E A;  3Q5S A;  1EXJ A;  3T97 B;  2HVA A;  2KCU A;  5KAU A;  5KAT A;  5KCB A;  3E0H A;  5I41 B;  4A1M A;  5KAV A;  1D5Y A;  4R4L A;  4AYZ A;  3Q5R A;  1Q07 A; 
#chains in the Genus database with same CATH topology
 1RF1 C;  3CCJ P;  2NPS B;  2BCC E;  2OAR A;  3L70 J;  1LTS C;  2WIT A;  1G1J A;  4TLF A;  1NO4 A;  2YNY A;  1SQQ G;  1PV3 A;  4XE5 B;  3C9I A;  3U1C A;  3TNU A;  4A1M A;  4M3L A;  3I56 P;  2WT7 B;  4LC1 A;  1R5S A;  3EFG A;  2B89 A;  1QLE D;  1YQ4 C;  1H88 A;  3C1L A;  5KKZ B;  1K9M Q;  3TGU E;  1JYH A;  4JYC A;  3AE3 C;  4WWI A;  5KAU A;  3AE1 C;  1W5C E;  3BCC G;  2GA1 A;  2P7J A;  1GK4 A;  5AW1 B;  3E1R A;  3FWN A;  2R5D A;  1T2K C;  5CCH C;  1EQ7 A;  1EZV E;  1RF0 A;  1L0N G;  1ZOY C;  3H32 B;  3KZI H;  4C46 A;  1M90 Q;  1ZRT E;  1PGJ A;  4ASW A;  3EZF A;  1GW3 A;  3HUS C;  2IBZ E;  4WY4 B;  2R5B A;  2ZT9 D;  3H1K E;  2W6J H;  4HH2 A;  5CBN A;  3SSU A;  1JTH B;  3MTU E;  4L73 A;  3E1I A;  2P58 A;  5KAI E;  4K3A A;  1KFN A;  4XFJ A;  2OYO A;  5CCG C;  1HWT C;  2HOD A;  2BCC D;  1Y9B A;  3P8C D;  2YXQ B;  5CCH D;  4EIJ A;  1Q7Y Q;  1GU5 A;  2WZ7 A;  4PV1 C;  1SQP D;  2I1J A;  2JDI H;  2GOV A;  3AE7 C;  3NFQ A;  2KS1 B;  5AVV B;  5TJH A;  2HR3 A;  4W7Z A;  3B49 A;  1L4A A;  5KLV E;  2JO1 A;  2BCC J;  4Y28 J;  1WT6 A;  2KYV A;  2HPC A;  1P84 E;  1JM0 A;  2M8R A;  2R3S A;  5APT A;  2O1K A;  2QVA A;  3LUR A;  1JUN A;  1X22 A;  2Y9Y A;  1SQP J;  3PRJ A;  1W2B O;  2O01 J;  4IFD K;  2YMY A;  3RK2 C;  3H1J G;  4EDF A;  3G9R A;  2KNC A;  3AEF C;  1CZQ A;  3MUD A;  3RL0 C;  1LP1 B;  4DOJ A;  1NTK G;  2KIK A;  5BU5 A;  2V7Q H;  5H2F H;  2IBZ D;  1G1I A;  1H89 A;  5KLV K;  1GDT A;  1QL2 A;  3CME P;  5I44 A;  1BE3 G;  3R2P A;  3VMA A;  4RJT A;  2WSF J;  2K1A A;  1LTJ B;  2M0B A;  2KK7 A;  1S72 P;  3E7K A;  3RK2 D;  1SQX D;  2D2C C;  2FFD A;  2ZYA A;  4U3F G;  1FZC C;  5KAF E;  1FE6 A;  3M0D C;  2Q3E A;  4KT0 J;  3RL0 D;  3GF7 A;  3IAO A;  4WBA A;  1PPJ D;  1OMI A;  3E0H A;  1AQ5 A;  3KQG A;  2MJZ A;  1D7M A;  3WUU A;  1LX8 A;  1LT9 B;  2YKO A;  3JCU H;  4OVN F;  3PLN A;  1SQX J;  2E42 A;  3TNU B;  5KLV D;  2QJY B;  4AYZ B;  4OH8 B;  4IFF A;  1LJ2 A;  1P84 D;  4JQ0 D;  3BAT A;  2D2C D;  3FGA D;  1PZQ A;  2XKM A;  3C8V A;  5KAV A;  1OFC X;  3HD7 B;  1SQB E;  3N4X A;  5GTI E;  2W27 A;  3GHG A;  2XNX A;  2WPS A;  2AXT H;  2IZ0 A;  1N73 B;  4XA4 A;  4N78 E;  1T3J A;  4ZKU A;  2WSC J;  1KOR A;  5KLV J;  1VPC A;  1NWQ A;  2W90 A;  2H89 C;  1YHQ P;  2RH0 A;  3CCE P;  1RH6 A;  1E5W A;  1MUU A;  1KB9 E;  2YXR B;  1JO5 A;  2JWA A;  3RK3 E;  2AEM A;  3HE4 B;  2PRR A;  1DEE G;  3L35 A;  3PP5 A;  2IYO A;  1Y6U A;  3WU2 H;  1SFC B;  3H1H E;  5AVU B;  2RMZ A;  4R4M A;  1KV4 A;  1NTM E;  1YJ9 P;  4NPD A;  4BRY A;  5KCB A;  2QM7 A;  1SQB K;  2W6A A;  3CI9 A;  3W68 A;  1GL2 A;  2IBZ I;  3L73 E;  2FYN B;  2N9Y B;  3OW2 O;  1FZF A;  3A7O A;  3WUT A;  3U1A A;  5TIS E;  1QX8 A;  1NU1 G;  1RF0 C;  3W67 A;  1VQ4 P;  4KHX A;  3SFE C;  2NZ2 A;  3VN0 A;  3RK3 C;  3HD7 D;  2Z4E A;  1N86 A;  1VF5 C;  5AW0 B;  2OYH A;  1NTM K;  1JMM A;  3V5B A;  3IFM A;  1CI6 B;  1S5L H;  2O01 H;  1YJW P;  1D5Y A;  1L0L E;  5AVQ B;  4Y99 C;  3V4W A;  1LT1 A;  2E76 B;  1A02 J;  3CCV P;  3OA7 A;  2WMM A;  4N78 D;  1GD2 E;  3QH9 A;  3V2R A;  1PP9 E;  2PP6 A;  1P84 I;  1EXJ A;  3L75 D;  3AE2 C;  1SFC D;  3CL3 D;  5C39 A;  1KB9 D;  2HYN A;  1NTZ G;  1K8A Q;  3V6I A;  1M8O B;  2C9N Y;  4C7N B;  1GK6 A;  3KYQ A;  3RK3 D;  1L4A C;  3H1I G;  2A06 E;  3QWO C;  1VF5 D;  3BCC E;  2WSF H;  1JY2 P;  3CXH D;  2QIW A;  3AEG C;  3LW5 J;  1KZU B;  2JJL A;  2QJK B;  3CWB D;  1T3U A;  1NTM D;  4CPG A;  1RH5 B;  1L0L K;  4OGQ B;  3L72 G;  3L75 J;  2E74 B;  3AE4 C;  1L0N E;  2YIU B;  3L73 D;  2ZXE B;  2K9J A;  1S5L X;  1GW4 A;  1IFD A;  3MUD C;  3L71 E;  4C7R A;  2WTY A;  4PJ0 H;  3P8M C;  3JSV C;  3LIE A;  1KQL A;  1L4A D;  3CWB J;  1NTM J;  2G8Y A;  2NRG A;  1JBG A;  3EZ2 A;  1H0T A;  2KXP B;  2UWJ E;  3L73 J;  1USD A;  2XV5 A;  2E76 D;  1VQN P;  1GU4 A;  1M1J C;  3L74 G;  2L91 A;  1QVG O;  3GW6 A;  3UCS A;  1L0L D;  2FFD C;  1HGZ A;  1L0N K;  3F5H A;  2WSC H;  3Q1M A;  4H13 B;  5E79 E;  2OG0 A;  2G3A A;  4L75 A;  3M9B A;  1P84 H;  1VL2 A;  1ZP0 C;  5GQQ A;  4YTP C;  4LGD E;  1PP9 D;  1CSB A;  3SWY A;  3VMX A;  2KB7 P;  3R8K A;  3CCL P;  3EZ9 A;  3M06 A;  3B5N B;  1L0L J;  3H1L G;  3G3Z A;  1LWU A;  1URQ B;  2A06 D;  1U7M A;  1JEK A;  2E74 D;  1RF1 B;  5K5G B;  1GZL A;  3H1J E;  4L74 A;  5KTB A;  1Q0A A;  1RE4 A;  5BU8 B;  1PP9 J;  1KB9 I;  5CHX A;  3KPE A;  5AW3 B;  3GHG C;  1ZR4 A;  1N8R Q;  1HTL C;  1L0N D;  2XDJ A;  1OW6 A;  5AW2 B;  1U7J A;  1ZXG A;  3EQ2 A;  3CXH I;  1KN7 A;  3L71 D;  1KQF B;  1QVF O;  1EDK A;  3S9O A;  1VQL P;  3T97 B;  1HUC A;  1HF9 A;  4AYC A;  1J2J B;  3RGU A;  4GKG A;  2C0W A;  3OAK A;  3O6Q B;  1VQ6 P;  4BWN A;  1L2P A;  1G2C B;  1L0N J;  4H13 D;  5AW6 B;  4U3F E;  2LXB A;  1DEB A;  3L71 J;  1USE A;  4MN4 C;  1GTW A;  1GL2 C;  3CLQ A;  1YI2 P;  2H8P D;  1UIX A;  3F89 A;  4UB8 E;  1HBW A;  4A7P A;  3B5N D;  3HUS B;  1URQ D;  3V4Q A;  1AQT A;  1AV1 A;  2R32 A;  2OTL P;  4DCZ A;  5GTI H;  1VQO P;  2K9Y A;  3LW5 H;  1MFT A;  3CC2 P;  1HH0 A;  2W6B A;  4R22 B;  2OYH C;  5KJ7 A;  1KB9 H;  3H1J D;  4ASV A;  3GF3 A;  1GL2 D;  2M5A A;  4YXW H;  5B66 E;  2IYP A;  1VQP P;  2GUS A;  2QRX A;  3AE8 C;  1FDI A;  2ZHH A;  3CXH H;  4PV1 B;  4N3Y B;  2AEF A;  3L70 G;  2ZYG A;  2HG5 D;  2XZR A;  1JCD A;  3D70 A;  5AW8 B;  5APS A;  2E5T A;  2O3J A;  1EDI A;  3H1J J;  2PFX A;  1NAY A;  3P7K A;  1IO4 A;  1CW5 A;  2BEQ D;  5APV A;  2KSJ A;  3CMA P;  1T2K D;  3B71 A;  3SWK A;  4EYY Q;  1IC2 A;  3EFF K;  1R5L A;  5TIS H;  1VQ9 P;  1H0T B;  1VQK P;  1ZR2 A;  3RK2 B;  4KJM A;  5AW4 B;  4HYT B;  5DJT B;  3VMZ A;  3ZDM A;  3RL0 B;  1NU1 E;  1SS1 A;  2Z5H A;  2Y9Z A;  3RBZ A;  1HJB A;  2JWD A;  2YO3 A;  4IL6 E;  2ZHG A;  4I1L A;  5KLI C;  3QAO A;  1LGH B;  1SVF A;  2P67 A;  3TGU D;  1GMJ A;  5CCG D;  1Q07 A;  1KIL C;  1IFP A;  1PL5 A;  1RQU A;  1KYO E;  1IJD B;  1PFI A;  1LTI C;  1BCC E;  2D2C B;  4R24 B;  3CCM P;  3VP8 A;  1JB0 J;  4PV1 D;  4B86 A;  1EZV D;  1FZC B;  1OVV A;  3A0B H;  2AEJ A;  2IFM A;  3S4R A;  1ZRT D;  5APQ A;  3TGU J;  3HE5 B;  1NU1 K;  1YTZ T;  2PGD A;  1JMB A;  3VOP A;  2WSS H;  4IOI H;  3HTK A;  3H1K D;  1NTZ E;  2OYI A;  2IX7 C;  3VYI A;  1J1E C;  2E43 A;  1Q82 Q;  1PM6 A;  2ZYD A;  3AEB C;  3Q5P A;  3H1I E;  1OWA A;  1M1J A;  2HVA A;  1FDO A;  2XU6 A;  4YXD C;  3CX5 E;  1NJI Q;  1LWU C;  4DT0 A;  3L72 E;  4WLS A;  4R4E A;  3H1K J;  4I7Z C;  2FY8 A;  1LTB C;  1AFO A;  3R8J A;  2FYZ A;  2BCC G;  3M0A A;  2VZ4 A;  4PD4 E;  2LKM A;  3EZ6 A;  1RE4 C;  4IFM A;  1MV8 A;  1NU1 D;  2ZFC A;  1NTZ K;  3MIW A;  1NKN A;  1SQP G;  3IN6 A;  2OQQ A;  2M3E A;  3AEC C;  3BVH A;  3EWK A;  2A45 G;  2KSE A;  1BGY E;  1NAF A;  5CJ4 A;  3L74 E;  2RKL A;  5E79 H;  2J58 A;  2YKP A;  1SQV G;  3D71 A;  1KYO D;  1NU1 J;  1BCC D;  2JEE A;  5APY A;  2K3R A;  1LTT C;  1IK7 A;  2FXP A;  1PGO A;  1N2D C;  1S3J A;  2POH A;  2YMK A;  1WRG A;  2Z5I A;  4D6T E;  5AVY B;  3K5B A;  1VQ7 P;  2B87 A;  2BEZ F;  2IBZ G;  2ZJS E;  5KAW A;  3H1L E;  3H1I D;  2Q5U A;  5AVS B;  1BCC J;  1EZV I;  3RK3 B;  2QE7 H;  2W83 C;  3WUV A;  1E79 H;  3CX5 D;  2QM8 A;  1VF5 B;  4BXL A;  1J1D C;  2QEX P;  4ZMD A;  3AE9 C;  1NVO A;  1LTG C;  1SQX G;  4Y99 B;  3AEA C;  5KJ7 C;  2HOD B;  1RE3 A;  3TF5 A;  4PD4 D;  2IFN A;  3PHL A;  1DX7 A;  5BVZ A;  4AQR D;  1YIT P;  2N1T A;  3H1I J;  2V4H A;  2Q9I A;  5AW9 B;  3II6 A;  2LXC B;  5M1B A;  1PPJ G;  1TU3 F;  4GOE A;  1KFM A;  1JY3 O;  3FXE A;  4OWF A;  1FJP A;  1N7S A;  2NPS A;  1M7L A;  1X79 B;  3CC4 P;  1L4A B;  1S2E A;  5KLV G;  3CPW O;  3V2N A;  2Y0C A;  2HPC B;  2H7H A;  1FS0 E;  1BGY D;  3B4S A;  1SQQ E;  1SQB D;  3L74 D;  1M56 D;  4I6M C;  4UB8 H;  4L76 A;  1VDF A;  2HFE D;  1EC5 A;  1ZME C;  1QEX A;  2CPS A;  2KNC B;  1NOH A;  2WT7 A;  4N6J A;  4H0L C;  1BGY J;  5CBO A;  1SQB J;  3L74 J;  1KYO I;  4D6T D;  2FKW B;  2FYU G;  3AE5 C;  3HTK B;  3H1H D;  1ZLL A;  5B66 H;  4DJG A;  3RBX A;  3NTN A;  1SQQ K;  3TK1 A;  3GPV A;  2LR2 A;  1M1J B;  1SLQ A;  2OTJ P;  2R44 A;  1OW7 A;  1Q81 Q;  3H32 A;  4ZKP A;  3FX0 A;  2FFD B;  2CK3 H;  5KAI H;  1OVU A;  4D6T J;  2K37 A;  4WY4 A;  2L5G B;  1QL1 A;  3H1H J;  3VP9 A;  1JTH A;  3CX5 I;  4W7Y A;  1KIL A;  1DH3 A;  3GG2 A;  3KDP B;  5E01 A;  1UII A;  2OYI C;  3MGN A;  2E75 C;  4HB1 A;  2WQY C;  3BAS A;  2CPB A;  4PD4 I;  1JY3 N;  2SPZ A;  1YTZ I;  1SQQ D;  1EDL A;  4GT1 A;  1K05 A;  2B88 A;  4AUW A;  3D6Y A;  1M1K Q;  4EI2 A;  3KXD A;  3GHG B;  2KS1 A;  1HJ0 A;  2QG4 A;  3M9H A;  1IFI A;  1NH4 A;  2H88 C;  3USS A;  2WPV B;  1KYO H;  3PTZ A;  2E75 D;  3L75 G;  4LLH A;  1SQQ J;  3BCC D;  4NPE A;  3MHV A;  3FXD A;  2I8D A;  4JBZ A;  1ZW0 A;  1KTM A;  2C0X A;  1AVO A;  3CWB G;  4BRY B;  3TSI A;  1LP1 A;  1NTK E;  2KZJ A;  3PH0 A;  1GL2 B;  2KI7 B;  3BCC J;  4H44 C;  2DW3 A;  4LHF A;  2IPP A;  5KAT A;  3CCR P;  1XTG B;  3CX5 H;  3G71 P;  1QGK B;  5I41 B;  1BE3 E;  5EFW B;  3M9Q A;  1RQV A;  3OJA B;  3V2P A;  3A0H E;  5KAF H;  2J59 M;  2V7Q J;  1LTJ A;  4PD4 H;  1K73 Q;  2ZVN B;  2P10 A;  5D90 A;  2OGU A;  2KCU A;  3WMM 0;  4HJG H;  3U59 A;  4J2N A;  2IEF A;  2OYH B;  3P8C E;  1NTK K;  1Q06 A;  3G6E P;  1HVV A;  4WB4 A;  1L0L G;  2QJP C;  4H44 D;  1M57 D;  2OTK E;  2QA4 P;  1RE3 C;  1ZN5 A;  1LT9 A;  3A3Y B;  4RKU J;  1T8Z A;  1SQP E;  1VQ8 P;  2GUV A;  1S5L E;  1YJN P;  2N1T C;  4AYZ A;  1DD4 A;  3GP4 A;  1PP9 G;  2KVV A;  2ZT9 C;  1N7S C;  2NPS C;  2DG6 A;  1OXZ A;  3HD7 A;  3S1K A;  1SQV E;  2A06 G;  1MZ9 A;  1NYH A;  1KQG B;  1VQ5 P;  3HRN A;  1N73 A;  4TT3 H;  4O9B A;  2KOG A;  2WSE J;  4GDO A;  1A02 F;  1IFN A;  2ITA A;  1YQ3 C;  1S1C X;  2ZXX A;  1NTK D;  4RO0 A;  1T6A A;  2Y0D A;  2N1T D;  4B0Y A;  1SQP K;  3AED C;  3FWL A;  2HLO A;  3HE4 A;  2K9J B;  2YO2 A;  3N7N A;  1JNM A;  1KIL E;  1OZH A;  3G4S P;  4GOF A;  5GTH E;  1BE3 D;  5KLI B;  2KUB A;  1SFC A;  3L71 G;  3ITK A;  5KKZ C;  1BSN A;  1N7S D;  1W2E A;  1RHZ B;  2NPS D;  3L36 A;  1KIL B;  1NTK J;  4HKZ H;  1SQV K;  4PJ0 E;  4U3F D;  1H8A A;  1SQX E;  5APX A;  2JP3 A;  3CC7 P;  1FBM A;  1BE3 J;  3IR9 A;  3BRT B;  4UB6 E;  2N9B A;  5DJU B;  1FOS F;  1Q05 A;  4WY4 C;  1PPJ E;  1WMK A;  3AE6 C;  2IZ1 A;  1J1E B;  4U3F J;  1EXI A;  1EDJ A;  4JF7 A;  3PJS K;  1CI6 A;  1LWU B;  1U57 A;  2BAS A;  1SQV D;  1RY3 A;  3Q5S A;  1Y8A A;  1SQX K;  2Y0E A;  4I7Z B;  3CCU P;  1KMI Z;  3SFD C;  4WY4 D;  4YPC A;  1FC2 C;  1Q08 A;  5B5E E;  2GM4 A;  2J5U A;  4C7N A;  3B8E B;  4K35 A;  1IFJ A;  1FZE A;  1KIL D;  1AVY A;  5CMZ A;  5AVX B;  1SQV J;  2RN0 A;  2JR8 A;  1MKM A;  1AJY A;  2FYU E;  2KLU A;  3TYY A;  3L37 A;  3AEE C;  1K04 A;  2O1J A;  4JYB A;  2Q1K A;  1PGP A;  3BRV B;  2B9B A;  2Q6Q A;  4JPZ B;  1S9K E;  2XND H;  1NGM B;  2Q3I A;  2I1K A;  1FZG A;  2M3B A;  1ZV8 A;  2Q7C A;  3Q5R A;  2FYU K;  1IK9 A;  3TGU G;  1LTJ C;  5AW5 B;  2H43 A;  1J1D B;  1FU1 A;  2WSE H;  1HGV A;  4W80 A;  3O8Z A;  2WWW A;  3GK6 A;  1EZV G;  2M5A B;  1Q09 A;  2JML A;  2A45 I;  1NTZ D;  1R8D A;  3GMA A;  1LT9 C;  2R3C A;  3NMD A;  1OX3 A;  3L75 E;  3H1K G;  3B5N A;  1FDM A;  1URQ A;  2E5Y A;  2QJY C;  3KZI E;  3IF4 A;  2ZVO B;  1RF1 A;  2FYU D;  2AXC A;  1FOS E;  3CXH E;  1FAV A;  3L72 D;  3HD7 C;  1NTZ J;  3CWB E;  1X0T A;  1N73 C;  3I5C A;  1BOW A;  4WLW A;  1OIP A;  3GLM A;  3CD6 P;  3A0H H;  1S9K D;  3JC2 2;  2WPR A;  2FYU J;  3D6Z A;  5CJ0 A;  3T97 A;  1Q2N A;  3L72 J;  4H0L B;  2ZAE B;  1MFZ A;  2FXO A;  3O6Q A;  4EOT A;  4WVZ A;  1JY3 P;  1SFC C;  1G2C A;  3UIA A;  3MP7 B;  1OW8 A;  5AVR B;  1BSH A;  4U7J A;  3P32 A;  2P2U A;  5KJ7 D;  2P1J A;  5CCH A;  3A5T A;  3KHU A;  4I2L C;  1Y47 A;  3A2A A;  1VQM P;  1R8E A;  2FYN C;  2JKV A;  2WVR A;  1FJK A;  1BCC G;  4DCK A;  3HUS A;  2A45 H;  1X8Y A;  2BOW A;  1JCC A;  3CCS P;  4GOD A;  3TDK A;  1BDC A;  2VRS A;  1JY2 O;  3H1L D;  3NXS A;  3A0B E;  2OYI B;  1LTA C;  2E75 B;  2FXM A;  3CCQ P;  5L8R J;  5CCG A;  5H2F E;  3SWF A;  3EZ7 A;  4GIF A;  1DIP A;  4RES B;  1SP4 A;  5KAX A;  2E76 C;  1KC8 Q;  5AVW B;  5GTH H;  5AW7 B;  1PIX A;  4R4L A;  3H1L J;  3RL0 g;  3L70 E;  4H0L D;  2YKQ A;  3M91 A;  3R4Y A;  1NKZ B;  5APU A;  1LNQ A;  2KLV A;  3VMY A;  1AA0 A;  2WPQ A;  4QMA A;  2C9L Y;  3H6P A;  1Z56 A;  2K88 A;  1N7L A;  3Q2Y A;  1OVR A;  3JCU E;  2QJK C;  4UB6 H;  1KQS O;  1S4X A;  4IL6 H;  4OGQ C;  1PGQ A;  1BDD A;  1BGY G;  1FZA A;  1YBK A;  1SQB G;  1FZB A;  2E74 C;  3I55 P;  4DZO A;  1NHL A;  2YIU C;  2FBW C;  2KZI A;  4NPF X;  1KD1 Q;  4H44 B;  1DD3 A;  5AVZ B;  2AXT E;  1XTC C;  1IFM A;  5D8C A;  2O01 N;  4D6T G;  5APW A;  2B87 B;  3HH0 A;  2MKV A;  3ABV C;  1YYC A;  3H1H G;  3H25 A;  3VTP C;  4OGQ D;  3L4F A;  1JY2 N;  1FZC A;  1NTM G;  5B5E H;  3M0D A;  3MD0 A;  3MZW B;  3WU2 E;  1YIJ P;  3HE5 A;  5AVT B;  3LID A;  3L73 G;  4H13 C;  2IDB A;  2QJP B;  4Z1M H;  1Q86 Q;  4IL6 X;  3L70 D;  2KP8 A;  1IZN B;  3Q3D A;  2N1T B;  4ZNC A;  3V2Q A;  1JOC A;  2W8Z A;  2PAJ A;  3B5N C;  1URQ C;  2ZT9 B;  1Q90 D;  1X9V A;  1N7S B;  2QSI A; 
#chains in the Genus database with same CATH homology
 3GP4 A;  3AE8 C;  1IK7 A;  3Q2Y A;  2FXP A;  2D2C C;  2E74 B;  2WPV B;  2YMK A;  1OW8 A;  1EXI A;  3AE4 C;  4H0L C;  2E75 D;  1FDI A;  2ZHH A;  1Y9B A;  4U7J A;  2QJK C;  4PV1 B;  1OW6 A;  2KVV A;  2ZT9 C;  4KT0 J;  4OGQ C;  1S5L X;  3GF7 A;  3IAO A;  2BEZ F;  2DG6 A;  1PV3 A;  2E74 C;  1PM6 A;  3AE5 C;  3AEB C;  1KQF B;  3Q5P A;  3D70 A;  1U57 A;  5KAW A;  3S9O A;  2YIU C;  1R8E A;  3Q5S A;  2HVA A;  1FDO A;  2FYN C;  1NYH A;  3T97 B;  1KQG B;  4PV1 C;  1OMI A;  4YXD C;  3E0H A;  1HF9 A;  2FBW C;  4I7Z B;  4TT3 H;  3SFE C;  4A1M A;  2GOV A;  2NZ2 A;  2WSE J;  3GPV A;  1VF5 B;  1LX8 A;  2BEQ D;  2G8Y A;  3AE7 C;  1JBG A;  4GDO A;  4H44 B;  1YQ3 C;  3EZ2 A;  1KTM A;  3B49 A;  3GK6 A;  2BOW A;  1KMI Z;  1DD3 A;  1S1C X;  1Q09 A;  3AE9 C;  2JO1 A;  3B71 A;  3SFD C;  4WLS A;  2JML A;  1OW7 A;  4AYZ B;  4R4E A;  1Q08 A;  1YQ4 C;  4I7Z C;  4Y28 J;  1R8D A;  2E76 D;  2J5U A;  1VF5 C;  3GMA A;  3AEA C;  3R8J A;  4H13 D;  2VZ4 A;  4B0Y A;  3AED C;  5D8C A;  4H44 C;  1JYH A;  3EZ6 A;  3LUR A;  3AE3 C;  3UCS A;  4LHF A;  1KIL E;  5KAU A;  3AE1 C;  5KAT A;  2D2C D;  5I41 B;  2QJY C;  3FGA D;  3C8V A;  2E75 B;  5KAV A;  1D5Y A;  1RQV A;  1MKM A;  1AJY A;  3HH0 A;  2MKV A;  3ABV C;  3H25 A;  5L8R J;  4OGQ D;  2O01 J;  2E76 B;  5KKZ C;  5M1B A;  3Q1M A;  3EZ7 A;  1UIX A;  1TU3 F;  5E01 A;  4H13 B;  2OG0 A;  2G3A A;  2V7Q J;  3G9R A;  1DIP A;  3AEE C;  2E75 C;  2ZHG A;  5KLI C;  3AEF C;  1VL2 A;  1ZP0 C;  5GQQ A;  4YTP C;  3QAO A;  1K04 A;  1KOR A;  2WQY C;  2OQQ A;  2WSC J;  3IN6 A;  2H89 C;  3AEC C;  5KAX A;  2E76 C;  2P10 A;  5D90 A;  1ZOY C;  1RH6 A;  1EXJ A;  3EWK A;  2KCU A;  3AE2 C;  4H13 C;  1PIX A;  1ZRT E;  1GMJ A;  2IDB A;  4R4L A;  4Z1M H;  1Q07 A;  2JP3 A;  3RL0 g;  3EZF A;  4J2N A;  4DCZ A;  4H0L D;  4IL6 X;  2IEF A;  1BOW A;  3R8K A;  1PL5 A;  4WLW A;  3RK3 E;  3GLM A;  3EZ9 A;  2K9Y A;  1K05 A;  2ZT9 D;  3R4Y A;  1NGM B;  1RQU A;  1Q06 A;  3D71 A;  3Q3D A;  1VF5 D;  5I44 A;  3D6Z A;  1Y6U A;  2E74 D;  2QJP C;  4H44 D;  2QIW A;  1Q05 A;  3AEG C;  1ZME C;  3D6Y A;  4R22 B;  2D2C B;  3LW5 J;  4R24 B;  1JB0 J;  4R4M A;  4H0L B;  4PV1 D;  4RKU J;  2WSF J;  1Q0A A;  1HJ0 A;  3GF3 A;  1WMK A;  2ZT9 B;  5KCB A;  1Q90 D;  4OGQ B;  3AE6 C;  4XFJ A;  3O6Q A;  2QSI A;  4AYZ A;  3Q5R A;  1DD4 A;  2H88 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...