3Q3DA

Crystal structure of bmrr bound to puromycin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna/antibiotic
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q3dA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q3dA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q3dA03
3GP4A 3Q5SA 3Q5PA 1EXIA 5KAUA 2JMLA 5KAXA 5D8CA 5KCBA 2OQQA 1JBGA 4WLWA 2BOWA 1Q09A 5KAWA 3UCSA 2ZHHA 3Q3DA 4AYZA 1DIPA 4R4MA 3GK6A 5KATA 3GPVA 3G9RA 3Q1MA 3B49A 3IAOA 4A1MA 1Q0AA 3D6YA 3QAOA 5KAVA 5GQQA 4B0YA 1Q05A 2DG6A 3R8KA 2GOVA 4AYZB 3D71A 3Q2YA 2HVAA 3LURA 4WLSA 4R24B 3HH0A 1Q06A 4R22B 2ZHGA 1R8DA 1R8EA 3D70A 2J5UA 1Q07A 5I41B 4R4LA 5D90A 3Q5RA 1JYHA 1D5YA 5I44A 1EXJA 1Q08A 3T97B 4J2NA 3D6ZA 2VZ4A 1BOWA 2KCUA 4R4EA 3E0HA 3R8JA 5E01A
chains in the Genus database with same CATH superfamily
1N73C 2L5GB 3C9IA 1FAVA 1H8AA 1JY2O 2N9BA 2IBZI 1GTWA 1DEBA 1ZR4A 1NTKE 3H32A 2HG5D 1OIPA 4D6TD 4IFDK 3KZIE 1FJPA 2P2UA 4I6MC 4N6JA 4R4EA 4H0LB 1IFIA 4U3FJ 3CMAP 1VQNP 3PHLA 3UCSA 2E42A 3M91A 4I2LC 1NU1G 1SS1A 3A0HH 1CSBA 2XDJA 2YXRB 3HTKA 5AVSB 3H1KG 1FZCC 1YJ9P 1MZ9A 3H32B 3TGUG 3L71E 3Q5PA 3G4SP 5APWA 2OQQA 2E75B 2WSCH 1M90Q 3CCVP 1FZEA 1NAYA 2FBWC 2WPSA 2QE7H 5GTHE 1M8OB 4UB8E 2HR3A 1Q06A 1JY3N 2ZVOB 4D6TG 2AXCA 4J2NA 4UB6E 4WWIA 2FXMA 3JC22 2I1JA 3V4WA 3HTKB 4I7ZC 1FOSE 3GW6A 3ITKA 1Q0AA 1VQKP 3TK1A 1NKNA 2OTKE 3QH9A 2QSIA 1A02F 3CX5I 3CX5E 1VQ6P 2M0BA 3L36A 2PFXA 3AE1C 1NTME 2E74C 3PJSK 1QVGO 3H6PA 1ZV8A 4XA4A 3H1HD 3AEAC 2A06D 4HYTB 1CW5A 2KUBA 1KILD 3WU2E 1BGYD 5I44A 2XNXA 3PP5A 5BU8B 1KB9H 3EWKA 3AE8C 1IZNB 5B5EH 1SQXK 4RO0A 1S1CX 4TT3H 2FYUJ 1EZVI 1Z56A 1EZVE 3V2RA 1NHLA 4WVZA 2C0XA 3BCCD 2GUSA 2A45I 2QM7A 5EFWB 1S4XA 2P1JA 4MN4C 1FZFA 4ZNCA 3H1HG 1DH3A 2A06G 4H13D 1BGYG 5TISH 1JY2N 4L76A 1CZQA 3C1LA 1K04A 1Q82Q 3H25A 2ZFCA 1S3JA 1SQQE 4H0LC 2OYIB 4R24B 1GL2D 3AE9C 3L75J 2BASA 2W6JH 3R8JA 1G1IA 3BCCG 4AYZA 5AW5B 3B8EB 2D2CC 5CCHA 4K3AA 2E75C 1IFNA 2OYOA 3W68A 1XTGB 3GP4A 2IEFA 3CPWO 1N7LA 4IFFA 5CBNA 1PV3A 1Q09A 1LNQA 4U3FE 2WSSH 1IC2A 1NTZD 1VQ5P 4GT1A 2AEFA 5KLIC 3HUSC 3CCLP 4W7YA 1NTKD 1YTZI 1LT9A 2B9BA 2OTLP 2OYHC 3AEFC 3TNUA 1ZLLA 3CXHI 3CXHE 3GMAA 2Y9YA 2RMZA 3AE5C 3OW2O 1PGJA 3F5HA 1JY2P 1GL2A 1SQBJ 2XU6A 1KYOH 3RL0C 2KP8A 3G9RA 3HD7A 4PD4I 2ZT9C 4YPCA 4PD4E 1LT9B 2WZ7A 3VMAA 1NTZG 4NPDA 3TNUB 2FYUK 5AW1B 2JO1A 1J1DC 1J2JB 1FJKA 1L0NK 5KLVJ 1NTKG 1YI2P 1IFDA 3AECC 4W80A 3GPVA 3SWFA 3LIDA 4JYCA 4B0YA 1GL2B 3NMDA 1URQC 4DOJA 2IFNA 4XFJA 1ZN5A 3HD7B 3CC7P 2H8PD 3EZFA 1LTIC 1N73A 2FFDC 2QJPB 1GK6A 1ZRTE 3RL0g 1EDKA 2ZYAA 4JBZA 4I1LA 2E74D 3H1IJ 3L73J 1NTMD 1K05A 2WQYC 1SFCD 2K37A 4DCKA 2YIUC 2FYUE 3JCUE 4W7ZA 5CBOA 2OYIC 1MFZA 1KB9D 2ZHHA 3IN6A 1N73B 1FC2C 3FGAD 1K9MQ 1VQ8P 3HH0A 1K8AQ 1L0LJ 3FWNA 1FZCA 1SQVK 1NAFA 2IZ1A 4A7PA 1BSHA 1YQ3C 1KQLA 3VTPC 3RK2C 1RE3A 2W27A 1EZVD 2QVAA 3CCRP 1NTMG 4Y99B 1M56D 2E76C 5KAIE 4N78E 1KQFB 3RGUA 2O1JA 4GIFA 5E79E 2Q9IA 3L75E 5AW3B 3LW5J 1FZCB 1RF0C 3K5BA 2HFED 1GZLA 3MZWB 5CCHC 2E5YA 1H88A 2GOVA 1YQ4C 4AUWA 3II6A 1KFNA 4OVNF 1IFMA 3VMXA 2PGDA 4H0LD 3S1KA 2FYNB 1KFMA 2I8DA 4HJGH 1VL2A 2JKVA 1M1KQ 1Y8AA 3VYIA 5GTIE 4WB4A 4I7ZB 1SQPJ 1EZVG 2BCCJ 3CWBJ 3M0AA 4ZKPA 1JO5A 3L72J 2A45G 5AW2B 2OTJP 1MUUA 2E75D 2POHA 1H0TA 2YMKA 5KAVA 1ZXGA 2CPBA 3M9QA 1PPJD 2VRSA 1KC8Q 3AEBC 5L8RJ 2BOWA 3S4RA 3IR9A 1NTKK 3KXDA 1SQBE 3O6QA 2LR2A 4R4LA 3MGNA 1H0TB 5BU5A 1IFPA 1QL2A 3CCJP 2IX7C 2OG0A 1JBGA 1FOSF 2N9YB 4M3LA 1JCCA 2M5AA 3CXHD 1KMIZ 3USSA 5KAFH 5KLVE 1MV8A 4WBAA 4JQ0D 3AEDC 1GU5A 2H43A 3HE5A 1EXJA 1JOCA 4B86A 2V7QJ 3RL0D 3O6QB 1KTMA 1L0LK 4LLHA 5KAXA 1PPJG 5APUA 1OXZA 4PD4D 1QVFO 1JNMA 1NOHA 2IBZE 2FY8A 1VQ9P 3ABVC 2QG4A 1M7LA 1BE3J 2KXPB 1OVVA 2M5AB 4C7RA 3H1IE 3L73E 3HE5B 2WSEJ 3KZIH 3NXSA 3E1IA 1S5LE 2R5BA 5AVYB 4Y99C 5APVA 2XKMA 3V4QA 2G8YA 3KDPB 3CCUP 3GHGA 2Q3IA 1ZRTD 2KCUA 3NFQA 1NTMK 3HUSA 2D2CB 3TDKA 1L0LE 3L4FA 3A3YB 1YJWP 2KSEA 4IOIH 5AVRB 5KJ7C 1RE3C 2OYHA 2K9YA 2FYUD 3Q5RA 1EDJA 2FYNC 1DD3A 1PP9D 1L0ND 5KAUA 3E7KA 3FWLA 5GTHH 3AE7C 1WRGA 2KYVA 3GHGB 4UB8H 4WLWA 3H1LD 3WUUA 5KLIB 3V6IA 3HUSB 4UB6H 1Q2NA 1N8RQ 1K73Q 1RQVA 4YXDC 4ASVA 2PP6A 2FXPA 3TGUJ 1QLED 2KI7B 3G6EP 2OYHB 3RK2D 1M1JC 3G3ZA 2YNYA 3H1JD 4GODA 2AXTE 2O1KA 1LTJC 1EDLA 1OW6A 4OGQB 2C9NY 4EYYQ 1SP4A 5AVQB 3L35A 1W5CE 2E76D 3S9OA 3E1RA 1URQA 4N78D 3RL0B 3SWYA 3L75D 1AQTA 2FYUG 2ZT9B 4EOTA 4WY4A 2H7HA 4RESB 1SQPE 2FFDA 5CCHD 2BCCE 1PP9G 1L0NG 3CWBE 3AE2C 3WU2H 1YITP 3L72E 1FDOA 4IL6X 2ZXEB 1SQQK 3B4SA 3T97A 3H1LG 2YMYA 3CCEP 1Q81Q 2YKPA 1J1DB 3MP7B 2QJKC 2M3BA 5B5EE 1SQVD 3Q5SA 2NPSA 3RK3E 1NVOA 1URQB 2JEEA 3H1JG 3TF5A 3RK3C 2OYIA 1VQPP 2NZ2A 4WY4B 3M06A 5GQQA 1PGOA 2FFDB 1YYCA 3Q2YA 3WUVA 2JWDA 1JY3P 1OFCX 3T97B 2A45H 2WPRA 2PAJA 5B66E 3L75G 3NTNA 1LWUC 2O01J 2YIUB 2NPSB 1ZOYC 1HTLC 3GF7A 5I41B 3FX0A 1SQVG 4LGDE 1JMBA 3HD7D 3LIEA 1HWTC 1UIXA 1RH6A 2K3RA 1FU1A 1RF0A 1T3UA 2C0WA 1PM6A 3L70D 3CCQP 4JYBA 3EZ9A 4JF7A 2MKVA 4HKZH 1RF1C 3RK2B 5H2FE 3R8KA 2WTYA 1BE3E 1JB0J 2KS1A 1YHQP 1PGPA 2M8RA 5C39A 2E76B 1HGVA 1JUNA 2I1KA 2E43A 3GHGC 2YKOA 2IBZD 3MUDC 2WSFJ 5KCBA 1FZAA 3V2NA 2KS1B 5AW9B 3H1ID 3TYYA 3EZ7A 3AE4C 3L73D 1R8DA 3L70G 4OGQC 3MD0A 5APXA 1DEEG 2AEMA 3I55P 1W2EA 3CXHH 5CCGC 4R4MA 1UIIA 1RQUA 2YKQA 1G1JA 2B89A 1NU1E 1YBKA 1KYOI 3M9HA 1KYOE 3L71D 1DX7A 2KVVA 1L0LD 5E01A 1OVUA 5KJ7D 1AVYA 3TGUE 3AE6C 3N7NA 4PD4H 5AVVB 1X9VA 1HVVA 2QJYC 3CLQA 2ZVNB 3OAKA 2IBZG 3Q1MA 4ZMDA 2C9LY 3B71A 3BASA 1CI6A 3H1IG 1GDTA 1YIJP 1OVRA 3L73G 1GMJA 1FDIA 4WY4C 1N2DC 5D8CA 3P32A 1IO4A 1DIPA 3CCMP 3B5NB 5CHXA 1G2CA 2KZIA 2WPQA 3CX5D 3GF3A 1NWQA 1GK4A 2HODA 3CCSP 3BRVB 1Q08A 3CD6P 3L71G 5APSA 2JR8A 1L0LG 1BCCJ 1KQGB 2NPSC 1J1EB 1AFOA 1CI6B 3CI9A 3P8CE 3F89A 3L74J 4N3YB 1MKMA 4K35A 3JCUH 1R8EA 1G2CB 2R3CA 5DJUB 2QA4P 3CWBD 4L75A 3L72D 2HODB 1S72P 2O3JA 2IZ0A 1QEXA 2IFMA 2WSCJ 4IL6H 4GOFA 1Y6UA 5KJ7A 2J59M 2HVAA 2CK3H 2CPSA 4NPEA 3RK3D 2R3SA 1LTAC 5AW8B 2ZYDA 4PV1C 1NJIQ 2Z5IA 2Q6QA 2RN0A 1SLQA 1JM0A 2RH0A 5KAIH 1LT1A 4KJMA 5KTBA 4OH8B 5E79H 3M0DC 4GOEA 1KILE 4JPZB 2GUVA 3TSIA 1M1JA 3CWBG 1LTJA 1SQQD 1VQ4P 3L72G 3MHVA 1ZP0C 1HH0A 2KZJA 3A2AA 2BEQD 1SQBK 2WMMA 1JYHA 5AVXB 4RKUJ 3QWOC 4A1MA 1LTGC 1HBWA 1AA0A 2D2CD 5GTIH 3A0BE 1M1JB 5CMZA 5KLVK 1LTJB 5APTA 1Y47A 4PJ0E 1JMMA 2VZ4A 3R4YA 4H13C 4U3FD 4DT0A 1S9KE 4Y28J 2IDBA 1GD2E 1SQQG 1JTHA 1FBMA 1AVOA 3SWKA 2WWWA 1D5YA 1LX8A 3WMM0 3CMEP 1HJ0A 3B5NC 2J58A 1WMKA 3GLMA 2QJKB 3VMYA 2WVRA 1P84I 1P84E 1LWUA 3KHUA 2SPZA 4OGQD 1NYHA 3VP9A 1Q7YQ 2L91A 3I5CA 2DG6A 1VF5B 1PL5A 3RK3B 1J1EC 1Q07A 1JTHB 1YJNP 5CCGD 3G71P 1S2EA 1BE3G 5AVWB 3A5TA 2W8ZA 1RY3A 1SQXJ 2ZT9D 5AW0B 4ZKUA 4U3FG 1JCDA 3IAOA 1IFJA 3VMZA 2WPVB 1XTCC 2E5TA 1LWUB 2PRRA 2XZRA 5KKZB 1RF1A 4U7JA 1KORA 1Q90D 1JEKA 2N1TC 1PFIA 3MIWA 1FZGA 1URQD 1BCCE 1L4AC 3M9BA 4WY4D 1KV4A 1LTTC 1GU4A 1T2KC 3L74E 4LHFA 1S5LH 2K1AA 3EQ2A 1M57D 1VQLP 3A0HE 2XNDH 3C8VA 3MUDA 1RF1B 1VDFA 1N7SA 4BXLA 1E5WA 3CL3D 1T8ZA 1OW7A 2ITAA 2NPSD 3IFMA 1X79B 2YO3A 3P8CD 1SQPK 4DZOA 3BVHA 4EI2A 1HGZA 1NU1J 2KSJA 2O01N 2P10A 5CCGA 2K9JA 4AYCA 5AVZB 1IJDB 3H1KJ 2KK7A 3D70A 1AV1A 1N7SB 3O8ZA 1R5LA 2V4HA 2GA1A 2GM4A 2KLVA 3LW5H 3Q3DA 3CX5H 1ZMEC 1USEA 1OW8A 5APQA 2AXTH 4D6TJ 3EFGA 4PV1D 1U57A 3KPEA 1TU3F 1VQ7P 2K9JB 1W2BO 2H89C 2Y0DA 1QGKB 5BVZA 2DW3A 1SFCC 1X22A 2Q1KA 1IK9A 1KB9I 1KB9E 2W6BA 1LJ2A 3VN0A 2KOGA 2QJYB 4HB1A 1HF9A 4R22B 3RBXA 2LXCB 4AQRD 4H44C 1FZBA 1EQ7A 1VF5C 2YXQB 3FXEA 4YTPC 3AEEC 4EDFA 4BWNA 3SFEC 5D90A 1R5SA 1PP9J 1L0NJ 2JWAA 2W83C 4RJTA 3H1LJ 2P7JA 1PGQA 3GK6A 5KKZC 3B49A 3JSVC 3CC4P 2Y9ZA 2JJLA 5TISE 2KIKA 5B66H 2W6AA 3UIAA 3H1JJ 3SSUA 1OZHA 1S9KD 1PIXA 4OWFA 4TLFA 1QL1A 1SQBD 3H1HJ 1SQXE 2WITA 2R5DA 2IPPA 3B5ND 1EDIA 1BGYJ 3HRNA 3R2PA 1Y9BA 2V7QH 3M0DA 5KAWA 3A7OA 3WUTA 1P84D 2R32A 3P7KA 3V2PA 3GG2A 1KILA 2HYNA 2P67A 2W90A 5KLVD 2Q7CA 5H2FH 3AE3C 1RE4A 1NU1K 1WT6A 2B88A 4PV1B 1D7MA 3VOPA 1RH5B 1SQVJ 2J5UA 1GW3A 4L74A 1PZQA 3AEGC 2LKMA 1HUCA 3BCCJ 2JMLA 1LTSC 2WSEH 1PPJE 2B87A 1BSNA 3BRTB 2WT7A 1E79H 1N7SC 3SFDC 1SQBG 1KILB 2N1TD 4AYZB 3BATA 2ZHGA 3L37A 1SVFA 4C7NA 1Q86Q 1L4AD 1EXIA 1BCCD 2P58A 4XE5B 1T2KD 2Q3EA 4BRYA 1H89A 3L74D 3QAOA 2QM8A 5KLVG 4GDOA 2QIWA 2B87B 3LURA 2WT7B 5KATA 4O9BA 3EZ2A 3H1KE 3KYQA 3B5NA 1FS0E 1AQ5A 1VQMP 1HJBA 4DCZA 3ZDMA 4C7NB 3FXDA 1MFTA 3L70J 5TJHA 4H13B 4BRYB 1S5LX 4D6TE 3EZ6A 2QEXP 1BCCG 1U7MA 5M1BA 1NTZJ 3OA7A 1VQOP 3L74G 1N86A 2ZJSE 1ZW0A 2OARA 1YTZT 1NTKJ 3EFFK 1X0TA 4IFMA 2N1TA 2KB7P 5AW6B 2ZYGA 1KN7A 1OX3A 1L4AA 3D6YA 3PLNA 1BDDA 1FDMA 1LP1A 3I56P 2ZXXA 2Z4EA 1FE6A 3D6ZA 4DJGA 1SQPD 1L2PA 2MJZA 2BCCD 4YXWH 4Z1MH 4ASWA 1PP9E 1L0NE 3MTUE 3H1LE 4H44D 4HH2A 2N1TB 2JP3A 3L71J 4LC1A 5AVUB 3KQGA 2Q5UA 4QMAA 1OMIA 1VF5D 1L4AB 1IK7A 3PRJA 4IL6E 1LP1B 3U1CA 2BEZF 2R44A 2Y0EA 3H1JE 2O01H 2UWJE 2Z5HA 1X8YA 3H1HE 2A06E 1AJYA 2AEJA 5AW7B 4KT0J 1BGYE 1SQPG 2BCCG 1USDA 1KILC 3V2QA 2NRGA 1LGHB 1NH4A 2IYOA 4GKGA 1KZUB 1RE4C 5K5GB 2HLOA 1NTMJ 1JY3O 1RHZB 1SQVE 1BDCA 1SQXD 2RKLA 1KQSO 2FKWB 3W67A 1LTBC 2KNCA 2M3EA 1SFCA 1KD1Q 3BCCE 2XV5A 3PH0A 3CC2P 5AVTB 2IYPA 2H88C 1VPCA 2LXBA 4EIJA 1BE3D 3N4XA 4NPFX 3A0BH 1ZR2A 2WSFH 1U7JA 1LT9C 4KHXA 1DD4A 2FXOA 5AW4B 3HE4A 2HPCA 4PJ0H 2E74B 2JDIH 4CPGA 3PTZA 1Q05A 3VP8A 3D71A 2KNCB 1QX8A 4WLSA 1SFCB 5APYA 1NTZK 2ZAEB 5DJTB 2Y0CA 1NKZB 1N7SD 4C46A 3P8MC 2FYZA 1NGMB 3U1AA 3IF4A 1GL2C 2YO2A 1SQXG 4H44B 3HD7C 3V5BA 2QJPC 2KLUA 3HE4B 2HPCB 3L70E 1P84H 3OJAB 2OGUA 3E0HA 5KAFE 1SQQJ 1NO4A 1NU1D 2QRXA 3RBZA 1T6AA 2G3AA 1A02J 1T3JA 2K88A 1GW4A 5CJ4A 3U59A 1KYOD 1EC5A 5CJ0A 3H1KD 1OWAA 3TGUD 4L73A 1NTZE 1BOWA
chains in the Genus database with same CATH topology
2E74C 2E76C 5KAUA 1KQFB 2JMLA 3R4YA 3C8VA 2JO1A 3AE7C 4H13C 2OG0A 3LW5J 1JBGA 4WLWA 1VF5C 4AYZA 3AECC 4R4MA 4Y28J 1RQUA 2IDBA 3GPVA 2O01J 1KMIZ 2WSCJ 4YTPC 3SFDC 3D6YA 1Y6UA 3AEAC 3AEEC 1OW7A 1ZOYC 2D2CC 1RQVA 4B0YA 2H88C 4YXDC 2GOVA 4AYZB 3AEDC 1YQ4C 2FXPA 2HVAA 2ZHGA 3GF7A 1D5YA 1LX8A 5I41B 3SFEC 5D90A 2KVVA 5I44A 1EXJA 1HJ0A 2E75C 3D6ZA 4XFJA 4R4EA 5E01A 2V7QJ 4H0LB 3EZFA 3GP4A 2IEFA 1KTMA 1EXIA 1UIXA 4H0LD 1RH6A 3AE6C 3EWKA 4PV1C 5KAXA 3AE8C 1WMKA 1ZRTE 3GLMA 1OW6A 4Z1MH 2QJYC 1PV3A 4OGQB 1Q09A 3UCSA 1DD4A 3RL0g 3GK6A 2P10A 5KKZC 3Q1MA 2E74B 4OGQD 3B49A 1NYHA 3QAOA 3ABVC 1PM6A 4H44D 2E74D 2E76D 4GDOA 2QIWA 1Q05A 2DG6A 1VL2A 3B71A 1S1CX 3D71A 2JP3A 1VF5B 1PL5A 3EZ9A 3S9OA 4WLSA 3LURA 1K05A 3D70A 2WQYC 4TT3H 5KATA 1OMIA 2MKVA 1Q07A 4I7ZB 1VF5D 3EZ2A 1IK7A 5KLIC 3R8KA 1KILE 2YIUC 2ZT9B 1GMJA 1FDIA 1PIXA 3Q5PA 1NGMB 2BEZF 1JB0J 2ZT9D 5D8CA 2OQQA 1ZP0C 2E75B 4DCZA 2WSEJ 2ZHHA 3Q3DA 3AE2C 1DIPA 1FDOA 4IL6X 2E75D 3IN6A 1ZMEC 3IAOA 4H44B 3AEFC 2E76B 2YMKA 5KAVA 2BEQD 2FBWC 3GF3A 1OW8A 2WPVB 3FGAD 4H13B 2QJPC 4PV1D 1U57A 3GMAA 3HH0A 1Q06A 2G8YA 2QJKC 1TU3F 4H13D 1JYHA 1Y9BA 4RKUJ 4A1MA 1Q08A 4U7JA 4J2NA 3AE5C 1KORA 2KCUA 1S5LX 1AJYA 3E0HA 2H89C 5KAWA 1Q90D 4KT0J 3EZ6A 3Q5SA 2D2CB 1KQGB 3AEBC 3RK3E 2WSFJ 2D2CD 5KCBA 1K04A 5L8RJ 2BOWA 1YQ3C 3H25A 4I7ZC 3G9RA 2G3AA 2NZ2A 1Q0AA 3AE3C 5M1BA 1MKMA 2ZT9C 4H0LC 5GQQA 2QSIA 3O6QA 4PV1B 2K9YA 3Q2YA 3EZ7A 3AE4C 1HF9A 4R24B 2J5UA 1R8EA 4R22B 1R8DA 4R4LA 3Q5RA 3AE9C 3T97B 1BOWA 4OGQC 2VZ4A 2FYNC 3AE1C 1DD3A 3R8JA 4LHFA 3AEGC 4H44C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP4 A;  3Q5S A;  3Q5P A;  1EXI A;  5KAU A;  2JML A;  5KAX A;  5D8C A;  5KCB A;  2OQQ A;  1JBG A;  4WLW A;  2BOW A;  1Q09 A;  5KAW A;  3UCS A;  2ZHH A;  3Q3D A;  4AYZ A;  1DIP A;  4R4M A;  3GK6 A;  5KAT A;  3GPV A;  3G9R A;  3Q1M A;  3B49 A;  3IAO A;  4A1M A;  1Q0A A;  3D6Y A;  3QAO A;  5KAV A;  5GQQ A;  4B0Y A;  1Q05 A;  2DG6 A;  3R8K A;  2GOV A;  4AYZ B;  3D71 A;  3Q2Y A;  2HVA A;  3LUR A;  4WLS A;  4R24 B;  3HH0 A;  1Q06 A;  4R22 B;  2ZHG A;  1R8D A;  1R8E A;  3D70 A;  2J5U A;  1Q07 A;  5I41 B;  4R4L A;  5D90 A;  3Q5R A;  1JYH A;  1D5Y A;  5I44 A;  1EXJ A;  1Q08 A;  3T97 B;  4J2N A;  3D6Z A;  2VZ4 A;  1BOW A;  2KCU A;  4R4E A;  3E0H A;  3R8J A;  5E01 A; 
#chains in the Genus database with same CATH topology
 1N73 C;  2L5G B;  3C9I A;  1FAV A;  1H8A A;  1JY2 O;  2N9B A;  2IBZ I;  1GTW A;  1DEB A;  1ZR4 A;  1NTK E;  3H32 A;  2HG5 D;  1OIP A;  4D6T D;  4IFD K;  3KZI E;  1FJP A;  2P2U A;  4I6M C;  4N6J A;  4R4E A;  4H0L B;  1IFI A;  4U3F J;  3CMA P;  1VQN P;  3PHL A;  3UCS A;  2E42 A;  3M91 A;  4I2L C;  1NU1 G;  1SS1 A;  3A0H H;  1CSB A;  2XDJ A;  2YXR B;  3HTK A;  5AVS B;  3H1K G;  1FZC C;  1YJ9 P;  1MZ9 A;  3H32 B;  3TGU G;  3L71 E;  3Q5P A;  3G4S P;  5APW A;  2OQQ A;  2E75 B;  2WSC H;  1M90 Q;  3CCV P;  1FZE A;  1NAY A;  2FBW C;  2WPS A;  2QE7 H;  5GTH E;  1M8O B;  4UB8 E;  2HR3 A;  1Q06 A;  1JY3 N;  2ZVO B;  4D6T G;  2AXC A;  4J2N A;  4UB6 E;  4WWI A;  2FXM A;  3JC2 2;  2I1J A;  3V4W A;  3HTK B;  4I7Z C;  1FOS E;  3GW6 A;  3ITK A;  1Q0A A;  1VQK P;  3TK1 A;  1NKN A;  2OTK E;  3QH9 A;  2QSI A;  1A02 F;  3CX5 I;  3CX5 E;  1VQ6 P;  2M0B A;  3L36 A;  2PFX A;  3AE1 C;  1NTM E;  2E74 C;  3PJS K;  1QVG O;  3H6P A;  1ZV8 A;  4XA4 A;  3H1H D;  3AEA C;  2A06 D;  4HYT B;  1CW5 A;  2KUB A;  1KIL D;  3WU2 E;  1BGY D;  5I44 A;  2XNX A;  3PP5 A;  5BU8 B;  1KB9 H;  3EWK A;  3AE8 C;  1IZN B;  5B5E H;  1SQX K;  4RO0 A;  1S1C X;  4TT3 H;  2FYU J;  1EZV I;  1Z56 A;  1EZV E;  3V2R A;  1NHL A;  4WVZ A;  2C0X A;  3BCC D;  2GUS A;  2A45 I;  2QM7 A;  5EFW B;  1S4X A;  2P1J A;  4MN4 C;  1FZF A;  4ZNC A;  3H1H G;  1DH3 A;  2A06 G;  4H13 D;  1BGY G;  5TIS H;  1JY2 N;  4L76 A;  1CZQ A;  3C1L A;  1K04 A;  1Q82 Q;  3H25 A;  2ZFC A;  1S3J A;  1SQQ E;  4H0L C;  2OYI B;  4R24 B;  1GL2 D;  3AE9 C;  3L75 J;  2BAS A;  2W6J H;  3R8J A;  1G1I A;  3BCC G;  4AYZ A;  5AW5 B;  3B8E B;  2D2C C;  5CCH A;  4K3A A;  2E75 C;  1IFN A;  2OYO A;  3W68 A;  1XTG B;  3GP4 A;  2IEF A;  3CPW O;  1N7L A;  4IFF A;  5CBN A;  1PV3 A;  1Q09 A;  1LNQ A;  4U3F E;  2WSS H;  1IC2 A;  1NTZ D;  1VQ5 P;  4GT1 A;  2AEF A;  5KLI C;  3HUS C;  3CCL P;  4W7Y A;  1NTK D;  1YTZ I;  1LT9 A;  2B9B A;  2OTL P;  2OYH C;  3AEF C;  3TNU A;  1ZLL A;  3CXH I;  3CXH E;  3GMA A;  2Y9Y A;  2RMZ A;  3AE5 C;  3OW2 O;  1PGJ A;  3F5H A;  1JY2 P;  1GL2 A;  1SQB J;  2XU6 A;  1KYO H;  3RL0 C;  2KP8 A;  3G9R A;  3HD7 A;  4PD4 I;  2ZT9 C;  4YPC A;  4PD4 E;  1LT9 B;  2WZ7 A;  3VMA A;  1NTZ G;  4NPD A;  3TNU B;  2FYU K;  5AW1 B;  2JO1 A;  1J1D C;  1J2J B;  1FJK A;  1L0N K;  5KLV J;  1NTK G;  1YI2 P;  1IFD A;  3AEC C;  4W80 A;  3GPV A;  3SWF A;  3LID A;  4JYC A;  4B0Y A;  1GL2 B;  3NMD A;  1URQ C;  4DOJ A;  2IFN A;  4XFJ A;  1ZN5 A;  3HD7 B;  3CC7 P;  2H8P D;  3EZF A;  1LTI C;  1N73 A;  2FFD C;  2QJP B;  1GK6 A;  1ZRT E;  3RL0 g;  1EDK A;  2ZYA A;  4JBZ A;  4I1L A;  2E74 D;  3H1I J;  3L73 J;  1NTM D;  1K05 A;  2WQY C;  1SFC D;  2K37 A;  4DCK A;  2YIU C;  2FYU E;  3JCU E;  4W7Z A;  5CBO A;  2OYI C;  1MFZ A;  1KB9 D;  2ZHH A;  3IN6 A;  1N73 B;  1FC2 C;  3FGA D;  1K9M Q;  1VQ8 P;  3HH0 A;  1K8A Q;  1L0L J;  3FWN A;  1FZC A;  1SQV K;  1NAF A;  2IZ1 A;  4A7P A;  1BSH A;  1YQ3 C;  1KQL A;  3VTP C;  3RK2 C;  1RE3 A;  2W27 A;  1EZV D;  2QVA A;  3CCR P;  1NTM G;  4Y99 B;  1M56 D;  2E76 C;  5KAI E;  4N78 E;  1KQF B;  3RGU A;  2O1J A;  4GIF A;  5E79 E;  2Q9I A;  3L75 E;  5AW3 B;  3LW5 J;  1FZC B;  1RF0 C;  3K5B A;  2HFE D;  1GZL A;  3MZW B;  5CCH C;  2E5Y A;  1H88 A;  2GOV A;  1YQ4 C;  4AUW A;  3II6 A;  1KFN A;  4OVN F;  1IFM A;  3VMX A;  2PGD A;  4H0L D;  3S1K A;  2FYN B;  1KFM A;  2I8D A;  4HJG H;  1VL2 A;  2JKV A;  1M1K Q;  1Y8A A;  3VYI A;  5GTI E;  4WB4 A;  4I7Z B;  1SQP J;  1EZV G;  2BCC J;  3CWB J;  3M0A A;  4ZKP A;  1JO5 A;  3L72 J;  2A45 G;  5AW2 B;  2OTJ P;  1MUU A;  2E75 D;  2POH A;  1H0T A;  2YMK A;  5KAV A;  1ZXG A;  2CPB A;  3M9Q A;  1PPJ D;  2VRS A;  1KC8 Q;  3AEB C;  5L8R J;  2BOW A;  3S4R A;  3IR9 A;  1NTK K;  3KXD A;  1SQB E;  3O6Q A;  2LR2 A;  4R4L A;  3MGN A;  1H0T B;  5BU5 A;  1IFP A;  1QL2 A;  3CCJ P;  2IX7 C;  2OG0 A;  1JBG A;  1FOS F;  2N9Y B;  4M3L A;  1JCC A;  2M5A A;  3CXH D;  1KMI Z;  3USS A;  5KAF H;  5KLV E;  1MV8 A;  4WBA A;  4JQ0 D;  3AED C;  1GU5 A;  2H43 A;  3HE5 A;  1EXJ A;  1JOC A;  4B86 A;  2V7Q J;  3RL0 D;  3O6Q B;  1KTM A;  1L0L K;  4LLH A;  5KAX A;  1PPJ G;  5APU A;  1OXZ A;  4PD4 D;  1QVF O;  1JNM A;  1NOH A;  2IBZ E;  2FY8 A;  1VQ9 P;  3ABV C;  2QG4 A;  1M7L A;  1BE3 J;  2KXP B;  1OVV A;  2M5A B;  4C7R A;  3H1I E;  3L73 E;  3HE5 B;  2WSE J;  3KZI H;  3NXS A;  3E1I A;  1S5L E;  2R5B A;  5AVY B;  4Y99 C;  5APV A;  2XKM A;  3V4Q A;  2G8Y A;  3KDP B;  3CCU P;  3GHG A;  2Q3I A;  1ZRT D;  2KCU A;  3NFQ A;  1NTM K;  3HUS A;  2D2C B;  3TDK A;  1L0L E;  3L4F A;  3A3Y B;  1YJW P;  2KSE A;  4IOI H;  5AVR B;  5KJ7 C;  1RE3 C;  2OYH A;  2K9Y A;  2FYU D;  3Q5R A;  1EDJ A;  2FYN C;  1DD3 A;  1PP9 D;  1L0N D;  5KAU A;  3E7K A;  3FWL A;  5GTH H;  3AE7 C;  1WRG A;  2KYV A;  3GHG B;  4UB8 H;  4WLW A;  3H1L D;  3WUU A;  5KLI B;  3V6I A;  3HUS B;  4UB6 H;  1Q2N A;  1N8R Q;  1K73 Q;  1RQV A;  4YXD C;  4ASV A;  2PP6 A;  2FXP A;  3TGU J;  1QLE D;  2KI7 B;  3G6E P;  2OYH B;  3RK2 D;  1M1J C;  3G3Z A;  2YNY A;  3H1J D;  4GOD A;  2AXT E;  2O1K A;  1LTJ C;  1EDL A;  1OW6 A;  4OGQ B;  2C9N Y;  4EYY Q;  1SP4 A;  5AVQ B;  3L35 A;  1W5C E;  2E76 D;  3S9O A;  3E1R A;  1URQ A;  4N78 D;  3RL0 B;  3SWY A;  3L75 D;  1AQT A;  2FYU G;  2ZT9 B;  4EOT A;  4WY4 A;  2H7H A;  4RES B;  1SQP E;  2FFD A;  5CCH D;  2BCC E;  1PP9 G;  1L0N G;  3CWB E;  3AE2 C;  3WU2 H;  1YIT P;  3L72 E;  1FDO A;  4IL6 X;  2ZXE B;  1SQQ K;  3B4S A;  3T97 A;  3H1L G;  2YMY A;  3CCE P;  1Q81 Q;  2YKP A;  1J1D B;  3MP7 B;  2QJK C;  2M3B A;  5B5E E;  1SQV D;  3Q5S A;  2NPS A;  3RK3 E;  1NVO A;  1URQ B;  2JEE A;  3H1J G;  3TF5 A;  3RK3 C;  2OYI A;  1VQP P;  2NZ2 A;  4WY4 B;  3M06 A;  5GQQ A;  1PGO A;  2FFD B;  1YYC A;  3Q2Y A;  3WUV A;  2JWD A;  1JY3 P;  1OFC X;  3T97 B;  2A45 H;  2WPR A;  2PAJ A;  5B66 E;  3L75 G;  3NTN A;  1LWU C;  2O01 J;  2YIU B;  2NPS B;  1ZOY C;  1HTL C;  3GF7 A;  5I41 B;  3FX0 A;  1SQV G;  4LGD E;  1JMB A;  3HD7 D;  3LIE A;  1HWT C;  1UIX A;  1RH6 A;  2K3R A;  1FU1 A;  1RF0 A;  1T3U A;  2C0W A;  1PM6 A;  3L70 D;  3CCQ P;  4JYB A;  3EZ9 A;  4JF7 A;  2MKV A;  4HKZ H;  1RF1 C;  3RK2 B;  5H2F E;  3R8K A;  2WTY A;  1BE3 E;  1JB0 J;  2KS1 A;  1YHQ P;  1PGP A;  2M8R A;  5C39 A;  2E76 B;  1HGV A;  1JUN A;  2I1K A;  2E43 A;  3GHG C;  2YKO A;  2IBZ D;  3MUD C;  2WSF J;  5KCB A;  1FZA A;  3V2N A;  2KS1 B;  5AW9 B;  3H1I D;  3TYY A;  3EZ7 A;  3AE4 C;  3L73 D;  1R8D A;  3L70 G;  4OGQ C;  3MD0 A;  5APX A;  1DEE G;  2AEM A;  3I55 P;  1W2E A;  3CXH H;  5CCG C;  4R4M A;  1UII A;  1RQU A;  2YKQ A;  1G1J A;  2B89 A;  1NU1 E;  1YBK A;  1KYO I;  3M9H A;  1KYO E;  3L71 D;  1DX7 A;  2KVV A;  1L0L D;  5E01 A;  1OVU A;  5KJ7 D;  1AVY A;  3TGU E;  3AE6 C;  3N7N A;  4PD4 H;  5AVV B;  1X9V A;  1HVV A;  2QJY C;  3CLQ A;  2ZVN B;  3OAK A;  2IBZ G;  3Q1M A;  4ZMD A;  2C9L Y;  3B71 A;  3BAS A;  1CI6 A;  3H1I G;  1GDT A;  1YIJ P;  1OVR A;  3L73 G;  1GMJ A;  1FDI A;  4WY4 C;  1N2D C;  5D8C A;  3P32 A;  1IO4 A;  1DIP A;  3CCM P;  3B5N B;  5CHX A;  1G2C A;  2KZI A;  2WPQ A;  3CX5 D;  3GF3 A;  1NWQ A;  1GK4 A;  2HOD A;  3CCS P;  3BRV B;  1Q08 A;  3CD6 P;  3L71 G;  5APS A;  2JR8 A;  1L0L G;  1BCC J;  1KQG B;  2NPS C;  1J1E B;  1AFO A;  1CI6 B;  3CI9 A;  3P8C E;  3F89 A;  3L74 J;  4N3Y B;  1MKM A;  4K35 A;  3JCU H;  1R8E A;  1G2C B;  2R3C A;  5DJU B;  2QA4 P;  3CWB D;  4L75 A;  3L72 D;  2HOD B;  1S72 P;  2O3J A;  2IZ0 A;  1QEX A;  2IFM A;  2WSC J;  4IL6 H;  4GOF A;  1Y6U A;  5KJ7 A;  2J59 M;  2HVA A;  2CK3 H;  2CPS A;  4NPE A;  3RK3 D;  2R3S A;  1LTA C;  5AW8 B;  2ZYD A;  4PV1 C;  1NJI Q;  2Z5I A;  2Q6Q A;  2RN0 A;  1SLQ A;  1JM0 A;  2RH0 A;  5KAI H;  1LT1 A;  4KJM A;  5KTB A;  4OH8 B;  5E79 H;  3M0D C;  4GOE A;  1KIL E;  4JPZ B;  2GUV A;  3TSI A;  1M1J A;  3CWB G;  1LTJ A;  1SQQ D;  1VQ4 P;  3L72 G;  3MHV A;  1ZP0 C;  1HH0 A;  2KZJ A;  3A2A A;  2BEQ D;  1SQB K;  2WMM A;  1JYH A;  5AVX B;  4RKU J;  3QWO C;  4A1M A;  1LTG C;  1HBW A;  1AA0 A;  2D2C D;  5GTI H;  3A0B E;  1M1J B;  5CMZ A;  5KLV K;  1LTJ B;  5APT A;  1Y47 A;  4PJ0 E;  1JMM A;  2VZ4 A;  3R4Y A;  4H13 C;  4U3F D;  4DT0 A;  1S9K E;  4Y28 J;  2IDB A;  1GD2 E;  1SQQ G;  1JTH A;  1FBM A;  1AVO A;  3SWK A;  2WWW A;  1D5Y A;  1LX8 A;  3WMM 0;  3CME P;  1HJ0 A;  3B5N C;  2J58 A;  1WMK A;  3GLM A;  2QJK B;  3VMY A;  2WVR A;  1P84 I;  1P84 E;  1LWU A;  3KHU A;  2SPZ A;  4OGQ D;  1NYH A;  3VP9 A;  1Q7Y Q;  2L91 A;  3I5C A;  2DG6 A;  1VF5 B;  1PL5 A;  3RK3 B;  1J1E C;  1Q07 A;  1JTH B;  1YJN P;  5CCG D;  3G71 P;  1S2E A;  1BE3 G;  5AVW B;  3A5T A;  2W8Z A;  1RY3 A;  1SQX J;  2ZT9 D;  5AW0 B;  4ZKU A;  4U3F G;  1JCD A;  3IAO A;  1IFJ A;  3VMZ A;  2WPV B;  1XTC C;  2E5T A;  1LWU B;  2PRR A;  2XZR A;  5KKZ B;  1RF1 A;  4U7J A;  1KOR A;  1Q90 D;  1JEK A;  2N1T C;  1PFI A;  3MIW A;  1FZG A;  1URQ D;  1BCC E;  1L4A C;  3M9B A;  4WY4 D;  1KV4 A;  1LTT C;  1GU4 A;  1T2K C;  3L74 E;  4LHF A;  1S5L H;  2K1A A;  3EQ2 A;  1M57 D;  1VQL P;  3A0H E;  2XND H;  3C8V A;  3MUD A;  1RF1 B;  1VDF A;  1N7S A;  4BXL A;  1E5W A;  3CL3 D;  1T8Z A;  1OW7 A;  2ITA A;  2NPS D;  3IFM A;  1X79 B;  2YO3 A;  3P8C D;  1SQP K;  4DZO A;  3BVH A;  4EI2 A;  1HGZ A;  1NU1 J;  2KSJ A;  2O01 N;  2P10 A;  5CCG A;  2K9J A;  4AYC A;  5AVZ B;  1IJD B;  3H1K J;  2KK7 A;  3D70 A;  1AV1 A;  1N7S B;  3O8Z A;  1R5L A;  2V4H A;  2GA1 A;  2GM4 A;  2KLV A;  3LW5 H;  3Q3D A;  3CX5 H;  1ZME C;  1USE A;  1OW8 A;  5APQ A;  2AXT H;  4D6T J;  3EFG A;  4PV1 D;  1U57 A;  3KPE A;  1TU3 F;  1VQ7 P;  2K9J B;  1W2B O;  2H89 C;  2Y0D A;  1QGK B;  5BVZ A;  2DW3 A;  1SFC C;  1X22 A;  2Q1K A;  1IK9 A;  1KB9 I;  1KB9 E;  2W6B A;  1LJ2 A;  3VN0 A;  2KOG A;  2QJY B;  4HB1 A;  1HF9 A;  4R22 B;  3RBX A;  2LXC B;  4AQR D;  4H44 C;  1FZB A;  1EQ7 A;  1VF5 C;  2YXQ B;  3FXE A;  4YTP C;  3AEE C;  4EDF A;  4BWN A;  3SFE C;  5D90 A;  1R5S A;  1PP9 J;  1L0N J;  2JWA A;  2W83 C;  4RJT A;  3H1L J;  2P7J A;  1PGQ A;  3GK6 A;  5KKZ C;  3B49 A;  3JSV C;  3CC4 P;  2Y9Z A;  2JJL A;  5TIS E;  2KIK A;  5B66 H;  2W6A A;  3UIA A;  3H1J J;  3SSU A;  1OZH A;  1S9K D;  1PIX A;  4OWF A;  4TLF A;  1QL1 A;  1SQB D;  3H1H J;  1SQX E;  2WIT A;  2R5D A;  2IPP A;  3B5N D;  1EDI A;  1BGY J;  3HRN A;  3R2P A;  1Y9B A;  2V7Q H;  3M0D A;  5KAW A;  3A7O A;  3WUT A;  1P84 D;  2R32 A;  3P7K A;  3V2P A;  3GG2 A;  1KIL A;  2HYN A;  2P67 A;  2W90 A;  5KLV D;  2Q7C A;  5H2F H;  3AE3 C;  1RE4 A;  1NU1 K;  1WT6 A;  2B88 A;  4PV1 B;  1D7M A;  3VOP A;  1RH5 B;  1SQV J;  2J5U A;  1GW3 A;  4L74 A;  1PZQ A;  3AEG C;  2LKM A;  1HUC A;  3BCC J;  2JML A;  1LTS C;  2WSE H;  1PPJ E;  2B87 A;  1BSN A;  3BRT B;  2WT7 A;  1E79 H;  1N7S C;  3SFD C;  1SQB G;  1KIL B;  2N1T D;  4AYZ B;  3BAT A;  2ZHG A;  3L37 A;  1SVF A;  4C7N A;  1Q86 Q;  1L4A D;  1EXI A;  1BCC D;  2P58 A;  4XE5 B;  1T2K D;  2Q3E A;  4BRY A;  1H89 A;  3L74 D;  3QAO A;  2QM8 A;  5KLV G;  4GDO A;  2QIW A;  2B87 B;  3LUR A;  2WT7 B;  5KAT A;  4O9B A;  3EZ2 A;  3H1K E;  3KYQ A;  3B5N A;  1FS0 E;  1AQ5 A;  1VQM P;  1HJB A;  4DCZ A;  3ZDM A;  4C7N B;  3FXD A;  1MFT A;  3L70 J;  5TJH A;  4H13 B;  4BRY B;  1S5L X;  4D6T E;  3EZ6 A;  2QEX P;  1BCC G;  1U7M A;  5M1B A;  1NTZ J;  3OA7 A;  1VQO P;  3L74 G;  1N86 A;  2ZJS E;  1ZW0 A;  2OAR A;  1YTZ T;  1NTK J;  3EFF K;  1X0T A;  4IFM A;  2N1T A;  2KB7 P;  5AW6 B;  2ZYG A;  1KN7 A;  1OX3 A;  1L4A A;  3D6Y A;  3PLN A;  1BDD A;  1FDM A;  1LP1 A;  3I56 P;  2ZXX A;  2Z4E A;  1FE6 A;  3D6Z A;  4DJG A;  1SQP D;  1L2P A;  2MJZ A;  2BCC D;  4YXW H;  4Z1M H;  4ASW A;  1PP9 E;  1L0N E;  3MTU E;  3H1L E;  4H44 D;  4HH2 A;  2N1T B;  2JP3 A;  3L71 J;  4LC1 A;  5AVU B;  3KQG A;  2Q5U A;  4QMA A;  1OMI A;  1VF5 D;  1L4A B;  1IK7 A;  3PRJ A;  4IL6 E;  1LP1 B;  3U1C A;  2BEZ F;  2R44 A;  2Y0E A;  3H1J E;  2O01 H;  2UWJ E;  2Z5H A;  1X8Y A;  3H1H E;  2A06 E;  1AJY A;  2AEJ A;  5AW7 B;  4KT0 J;  1BGY E;  1SQP G;  2BCC G;  1USD A;  1KIL C;  3V2Q A;  2NRG A;  1LGH B;  1NH4 A;  2IYO A;  4GKG A;  1KZU B;  1RE4 C;  5K5G B;  2HLO A;  1NTM J;  1JY3 O;  1RHZ B;  1SQV E;  1BDC A;  1SQX D;  2RKL A;  1KQS O;  2FKW B;  3W67 A;  1LTB C;  2KNC A;  2M3E A;  1SFC A;  1KD1 Q;  3BCC E;  2XV5 A;  3PH0 A;  3CC2 P;  5AVT B;  2IYP A;  2H88 C;  1VPC A;  2LXB A;  4EIJ A;  1BE3 D;  3N4X A;  4NPF X;  3A0B H;  1ZR2 A;  2WSF H;  1U7J A;  1LT9 C;  4KHX A;  1DD4 A;  2FXO A;  5AW4 B;  3HE4 A;  2HPC A;  4PJ0 H;  2E74 B;  2JDI H;  4CPG A;  3PTZ A;  1Q05 A;  3VP8 A;  3D71 A;  2KNC B;  1QX8 A;  4WLS A;  1SFC B;  5APY A;  1NTZ K;  2ZAE B;  5DJT B;  2Y0C A;  1NKZ B;  1N7S D;  4C46 A;  3P8M C;  2FYZ A;  1NGM B;  3U1A A;  3IF4 A;  1GL2 C;  2YO2 A;  1SQX G;  4H44 B;  3HD7 C;  3V5B A;  2QJP C;  2KLU A;  3HE4 B;  2HPC B;  3L70 E;  1P84 H;  3OJA B;  2OGU A;  3E0H A;  5KAF E;  1SQQ J;  1NO4 A;  1NU1 D;  2QRX A;  3RBZ A;  1T6A A;  2G3A A;  1A02 J;  1T3J A;  2K88 A;  1GW4 A;  5CJ4 A;  3U59 A;  1KYO D;  1EC5 A;  5CJ0 A;  3H1K D;  1OWA A;  3TGU D;  4L73 A;  1NTZ E;  1BOW A; 
#chains in the Genus database with same CATH homology
 2E74 C;  2E76 C;  5KAU A;  1KQF B;  2JML A;  3R4Y A;  3C8V A;  2JO1 A;  3AE7 C;  4H13 C;  2OG0 A;  3LW5 J;  1JBG A;  4WLW A;  1VF5 C;  4AYZ A;  3AEC C;  4R4M A;  4Y28 J;  1RQU A;  2IDB A;  3GPV A;  2O01 J;  1KMI Z;  2WSC J;  4YTP C;  3SFD C;  3D6Y A;  1Y6U A;  3AEA C;  3AEE C;  1OW7 A;  1ZOY C;  2D2C C;  1RQV A;  4B0Y A;  2H88 C;  4YXD C;  2GOV A;  4AYZ B;  3AED C;  1YQ4 C;  2FXP A;  2HVA A;  2ZHG A;  3GF7 A;  1D5Y A;  1LX8 A;  5I41 B;  3SFE C;  5D90 A;  2KVV A;  5I44 A;  1EXJ A;  1HJ0 A;  2E75 C;  3D6Z A;  4XFJ A;  4R4E A;  5E01 A;  2V7Q J;  4H0L B;  3EZF A;  3GP4 A;  2IEF A;  1KTM A;  1EXI A;  1UIX A;  4H0L D;  1RH6 A;  3AE6 C;  3EWK A;  4PV1 C;  5KAX A;  3AE8 C;  1WMK A;  1ZRT E;  3GLM A;  1OW6 A;  4Z1M H;  2QJY C;  1PV3 A;  4OGQ B;  1Q09 A;  3UCS A;  1DD4 A;  3RL0 g;  3GK6 A;  2P10 A;  5KKZ C;  3Q1M A;  2E74 B;  4OGQ D;  3B49 A;  1NYH A;  3QAO A;  3ABV C;  1PM6 A;  4H44 D;  2E74 D;  2E76 D;  4GDO A;  2QIW A;  1Q05 A;  2DG6 A;  1VL2 A;  3B71 A;  1S1C X;  3D71 A;  2JP3 A;  1VF5 B;  1PL5 A;  3EZ9 A;  3S9O A;  4WLS A;  3LUR A;  1K05 A;  3D70 A;  2WQY C;  4TT3 H;  5KAT A;  1OMI A;  2MKV A;  1Q07 A;  4I7Z B;  1VF5 D;  3EZ2 A;  1IK7 A;  5KLI C;  3R8K A;  1KIL E;  2YIU C;  2ZT9 B;  1GMJ A;  1FDI A;  1PIX A;  3Q5P A;  1NGM B;  2BEZ F;  1JB0 J;  2ZT9 D;  5D8C A;  2OQQ A;  1ZP0 C;  2E75 B;  4DCZ A;  2WSE J;  2ZHH A;  3Q3D A;  3AE2 C;  1DIP A;  1FDO A;  4IL6 X;  2E75 D;  3IN6 A;  1ZME C;  3IAO A;  4H44 B;  3AEF C;  2E76 B;  2YMK A;  5KAV A;  2BEQ D;  2FBW C;  3GF3 A;  1OW8 A;  2WPV B;  3FGA D;  4H13 B;  2QJP C;  4PV1 D;  1U57 A;  3GMA A;  3HH0 A;  1Q06 A;  2G8Y A;  2QJK C;  1TU3 F;  4H13 D;  1JYH A;  1Y9B A;  4RKU J;  4A1M A;  1Q08 A;  4U7J A;  4J2N A;  3AE5 C;  1KOR A;  2KCU A;  1S5L X;  1AJY A;  3E0H A;  2H89 C;  5KAW A;  1Q90 D;  4KT0 J;  3EZ6 A;  3Q5S A;  2D2C B;  1KQG B;  3AEB C;  3RK3 E;  2WSF J;  2D2C D;  5KCB A;  1K04 A;  5L8R J;  2BOW A;  1YQ3 C;  3H25 A;  4I7Z C;  3G9R A;  2G3A A;  2NZ2 A;  1Q0A A;  3AE3 C;  5M1B A;  1MKM A;  2ZT9 C;  4H0L C;  5GQQ A;  2QSI A;  3O6Q A;  4PV1 B;  2K9Y A;  3Q2Y A;  3EZ7 A;  3AE4 C;  1HF9 A;  4R24 B;  2J5U A;  1R8E A;  4R22 B;  1R8D A;  4R4L A;  3Q5R A;  3AE9 C;  3T97 B;  1BOW A;  4OGQ C;  2VZ4 A;  2FYN C;  3AE1 C;  1DD3 A;  3R8J A;  4LHF A;  3AEG C;  4H44 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...