3Q3DA

Crystal structure of bmrr bound to puromycin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator/dna/antibiotic
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q3dA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q3dA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q3dA03
3Q5RA 2HVAA 1EXIA 1Q05A 5GQQA 2BOWA 3R8JA 5KAXA 3QAOA 3IAOA 3E0HA 2J5UA 5KATA 3Q5PA 1Q09A 1R8EA 3HH0A 1EXJA 3B49A 3G9RA 2ZHHA 3Q5SA 4AYZA 3GP4A 4WLWA 3R8KA 3LURA 1Q06A 4R24B 5KAUA 5I41B 1BOWA 5KAWA 2KCUA 4R4MA 5KCBA 4AYZB 3D6ZA 3D71A 4R4LA 3D6YA 1Q08A 3Q3DA 5D90A 2VZ4A 3D70A 2DG6A 4J2NA 4WLSA 4R22B 5I44A 3Q1MA 5KAVA 2JMLA 4R4EA 1Q0AA 3GPVA 1JYHA 5E01A 3T97B 4A1MA 1R8DA 2ZHGA 1DIPA 2GOVA 3GK6A 1JBGA 1D5YA 4B0YA 3Q2YA 5D8CA 2OQQA 1Q07A 3UCSA
chains in the Genus database with same CATH superfamily
4PV1D 2K88A 3FXDA 4A7PA 4IL6X 4XA4A 1JB0J 3WMM0 4R4LA 4B86A 1NTMJ 4N3YB 1QL2A 1VQLP 3B8EB 1GMJA 4EYYQ 1Y8AA 4WY4B 1N2DC 4NPEA 1NOHA 4D6TD 3WU2E 4DT0A 1AA0A 5DJUB 1LT9A 3EZFA 1SQBG 3RK2D 1JCCA 4LGDE 1WMKA 1NTZG 2KS1B 2Y9ZA 2P10A 2WITA 1KYOI 3A7OA 1GL2A 1JY2N 1IFIA 3H1JD 4U7JA 5KLVD 3CCRP 3H1JE 2FYNC 4PD4E 5KLVE 4K35A 2WSCJ 2JEEA 1DEEG 4AYCA 3B71A 3L71E 1DEBA 1URQD 2I8DA 1RF1C 1LTAC 1OW6A 5D90A 4ASVA 1LX8A 1GZLA 2KP8A 2FKWB 3QWOC 1FZCC 1EZVG 3JCUH 2Q9IA 1L0NK 2OQQA 1BGYD 3M9HA 1BGYE 2BCCG 1FJKA 1HJ0A 4GT1A 1X22A 2OG0A 1FBMA 1SQVE 2L91A 1NKNA 5AVWB 2IFMA 1USDA 1KILC 2IBZI 3Q5RA 3EFGA 2WPSA 4H44D 1NTKE 5KAWA 2I1KA 2XKMA 3HUSA 2OYOA 2W83C 3M91A 3BVHA 1FDOA 2OYHB 3SWFA 1OX3A 5BU8B 2E76D 1GL2D 4WVZA 3RBXA 3GP4A 2OTKE 1L4AD 2O01H 5H2FE 2QJKB 5KAVA 1FZFA 1IFPA 1LP1A 3R2PA 2OTLP 2KLVA 3WUUA 3F5HA 4C7NB 3AE8C 1EDKA 5BU5A 1N8RQ 3GMAA 4W7YA 3HD7B 1AFOA 2M3BA 2AXTE 1H0TA 1X79B 1NTMK 4C46A 1SQXD 1EDJA 2JP3A 1JM0A 5AW6B 5APQA 4WY4C 1KC8Q 1VDFA 1OXZA 2ZHHA 1H88A 1FS0E 1ZXGA 3M0DC 3CWBG 2BEZF 3CX5D 5CHXA 1D5YA 1KB9I 3CX5E 3UCSA 1NU1K 2O01J 2KIKA 1GK6A 2N1TB 1VQ5P 4AYZA 1H89A 2HLOA 3D6ZA 4OGQD 2KZJA 3RBZA 3OAKA 3HTKB 2WT7B 2IFNA 1QL1A 2XU6A 3FX0A 5D8CA 1X8YA 2KOGA 1PGPA 3KXDA 1RF0C 4R24B 1KMIZ 5I41B 4IOIH 3KHUA 3D70A 2PP6A 2FYUG 1Y9BA 1YJ9P 4OVNF 1S5LX 4LLHA 5GQQA 4AUWA 1SQBJ 5TJHA 4IFFA 4I2LC 1NTZJ 1S9KD 3L72D 3L72E 1PGJA 4IL6E 1YJWP 2NRGA 2QVAA 4IL6H 2OYHC 2D2CD 1S1CX 4XFJA 3I5CA 5KAUA 1CSBA 1RE4A 3QH9A 1JUNA 3L70G 2QJKC 3AECC 1Q90D 2BCCJ 1DIPA 5TISH 3TGUD 1NHLA 2UWJE 1JY2O 2QRXA 1LTJA 1EQ7A 1NKZB 1JOCA 2KYVA 1FE6A 4HJGH 5AVRB 3HD7C 3MGNA 3V4WA 4N6JA 1SQQD 1SQVK 1YTZT 1FAVA 1Y47A 2PFXA 2ZVOB 3L35A 2NPSB 2E75D 2Y9YA 3R8JA 1JY2P 1GTWA 3AE5C 4EI2A 3KZIE 2BASA 2A06D 2E5YA 3LW5H 1VQPP 3RL0B 4DJGA 2HODA 2RMZA 1KORA 1LT1A 2KNCA 1AVOA 2KXPB 1D7MA 1BE3G 2P58A 3M9BA 2N1TC 2IBZD 4J2NA 1NU1G 2R5DA 2M3EA 1AV1A 2VRSA 3H32B 3H1LE 3CCLP 3B5NA 2OYIA 1P84I 1R5SA 1WRGA 4U3FE 2KSEA 2L5GB 4I6MC 1YITP 3HE4A 1SFCA 4LC1A 1SQBK 2JJLA 1K04A 3CWBJ 1NTZK 1FC2C 1K8AQ 2FXOA 3V2PA 5AW8B 3GHGA 3V6IA 1L0LD 1YHQP 1BSHA 1L0LE 2A45G 1JMBA 1ZRTE 4PV1B 1LWUB 3E0HA 3L73D 1RE3C 2B88A 4N78E 3MIWA 1PGQA 3OW2O 1IK9A 3AE3C 3H1JG 1CI6A 1ZMEC 5KLVG 3MUDC 4A1MA 1FZBA 1RH5B 3L71G 3H1ID 5CCGC 2ZYGA 3B5ND 3CL3D 3H1IE 4GIFA 2FYUJ 1HBWA 1JEKA 4KT0J 2Q7CA 2PAJA 1Q2NA 1BCCD 2E43A 1N7LA 1BCCE 1BGYG 1NWQA 1N73A 1J1EB 2HFED 2NPSC 3A5TA 1PP9E 3FXEA 1SQVG 3TNUA 2WSSH 2JKVA 2J59M 3U1AA 4L74A 1RF1A 1RY3A 2AEJA 1URQB 3O6QA 1PPJE 1OZHA 1E5WA 5AVYB 1YQ3C 1EZVI 3RL0C 1Q0AA 1VQOP 1NTKG 5KKZB 3CXHE 1MKMA 5APXA 4W7ZA 2HYNA 2H8PD 4WWIA 3L75D 1R8EA 3MP7B 3OA7A 3L70J 3L75E 2Q6QA 1M1JB 1T8ZA 5L8RJ 3M0AA 1M57D 1S5LH 3Q1MA 5KAIE 4H44B 1NJIQ 1YJNP 1HVVA 1KD1Q 1HGZA 4TT3H 2E76B 1GL2B 1U7JA 5C39A 2K9JA 3RK3D 1HWTC 2YNYA 3RK3E 2XZRA 1K05A 1L4AB 3LIDA 3MHVA 1RQVA 3CC4P 4D6TE 5EFWB 1NGMB 1T3UA 3N4XA 3G4SP 1OW7A 4O9BA 2DW3A 2A45H 2W27A 3WU2H 1BE3J 3CCSP 3MD0A 4PV1C 2P67A 1LWUC 3CMAP 1NU1J 4EDFA 1T3JA 2HR3A 3TK1A 1QX8A 1KQFB 2B87B 1T6AA 3GW6A 4PD4H 5AW1B 2GA1A 1PL5A 3AEDC 4WY4A 2E42A 3FWLA 2M8RA 4RO0A 3ITKA 2LXBA 2R3CA 3EZ9A 2FYUK 1PIXA 1KQLA 5I44A 1ZR4A 1HGVA 1ZN5A 3T97B 2KS1A 1EDLA 5AW3B 5KAFE 3V2QA 1J1EC 5CMZA 2IYPA 3PRJA 1LGHB 1PFIA 1JTHA 2P2UA 5KAFH 5M1BA 2G8YA 4OGQB 2Y0DA 2YMKA 3TDKA 1URQC 4Y99B 1QEXA 3IR9A 1P84D 2NZ2A 5KKZC 1LP1B 1VQ6P 4L73A 2C0XA 2Y0EA 3L72G 3IAOA 3L74D 3L74E 2K9YA 3H1JJ 5KLVJ 2WTYA 1T2KD 1M1JC 1H0TB 3L71J 1X0TA 3F89A 2IX7C 1VQ8P 1FZEA 5H2FH 4WY4D 4JYBA 1VL2A 1NH4A 2GUVA 2YKQA 1VQMP 1BGYJ 4H44C 1JO5A 1SS1A 2IZ0A 3CCQP 2V4HA 2H89C 3M06A 4GOFA 5AVVB 1SQVJ 3SWYA 2Q3EA 1SQXE 2AXTH 3BATA 2YXRB 3LIEA 1RHZB 2D2CB 2J5UA 2E76C 1GL2C 1NYHA 1N7SB 4HYTB 2WVRA 1NTKJ 1IC2A 3H1KD 1L4AC 2W6BA 3H1KE 1XTCC 3IN6A 2QM8A 2C0WA 3BASA 1BSNA 1LTIC 1MFZA 1IFJA 1N86A 4ZMDA 1IZNB 3HD7A 3CX5H 3CPWO 1VF5D 1QLED 1S4XA 2JO1A 4TLFA 3H1HD 2GOVA 1IJDB 3H1HE 2B89A 2E75B 2I1JA 1Q05A 1KN7A 3BCCD 2O01N 3BCCE 2R32A 3AEAC 1EZVD 2RH0A 1IK7A 2QA4P 4WLWA 2QE7H 3H1LG 3GF3A 1VQ7P 2WMMA 1Q82Q 2DG6A 2BCCD 2Y0CA 2XNXA 1LTGC 3OJAB 3RGUA 2POHA 3H6PA 4NPFX 1HJBA 3GK6A 3U59A 5AW2B 4U3FG 2YXQB 2M5AB 3HH0A 2HG5D 3JC22 2QM7A 3MTUE 5B66E 2V7QH 3ABVC 4DZOA 4OGQC 1S9KE 4NPDA 4RJTA 4Y99C 1R5LA 3HTKA 4MN4C 4ASWA 4H0LD 1XTGB 4RKUJ 3CCMP 1L0LG 1HH0A 5KLVK 2FXMA 1JCDA 3HD7D 3SSUA 3W68A 1FOSF 4BRYA 4C7RA 2YKOA 2MKVA 2E74D 3VP9A 5AW7B 5KTBA 3C9IA 3EFFK 4H13D 3TGUE 4AQRD 1NVOA 2Q1KA 3B4SA 1PZQA 4HKZH 1Q08A 1KYOD 2A45I 2OARA 3RL0g 1SQPD 1KYOE 3H1IG 1SQQE 1SQPE 2V7QJ 4ZKUA 2K1AA 1BCCG 1OWAA 2D2CC 1DD4A 2FBWC 3SWKA 1K9MQ 3V5BA 1QVFO 2HPCB 3Q5SA 1NTKK 1N7SC 2A06E 2FFDB 1PP9G 4PD4I 2R5BA 3KZIH 2LR2A 3L72J 2KUBA 3S4RA 1S3JA 5APUA 2ITAA 1PPJG 3HE5A 5CCGA 2ZT9D 3CWBD 3B5NB 1QVGO 1G2CB 1M8OB 2IEFA 2VZ4A 4IFMA 2IBZE 3L75G 1JYHA 5E79E 2PRRA 3E1RA 5GTHE 3AE6C 4UB8E 5DJTB 3HE4B 3H25A 2E75C 1BDDA 3P32A 5E79H 1Q86Q 4GDOA 4Y28J 1JY3N 5GTHH 3A2AA 2ZXEB 2Z5IA 1ZLLA 2G3AA 1GU4A 1NAFA 4KJMA 2CPSA 3GHGB 1QGKB 1L0ND 2KB7P 1L0NE 1FDIA 5APYA 1GDTA 3IF4A 1BDCA 3QAOA 5AW9B 1VQ4P 3LW5J 2WSEH 1Q81Q 4JQ0D 2GUSA 3UIAA 1RE4C 5CCHA 1CI6B 5APWA 1W5CE 4D6TG 4GOEA 3AE7C 3NTNA 2OTJP 5CCGD 2M0BA 3VMAA 2YMYA 3L73E 4JPZB 5AVZB 3VTPC 1CW5A 2LKMA 3D6YA 3VMZA 3TF5A 1N73B 3V4QA 5CJ4A 2IZ1A 3RK3B 3TNUB 3Q5PA 3H1LJ 4PJ0E 3CCUP 3CC7P 3RK2B 3O6QB 1KB9D 5AVTB 2QSIA 4U3FJ 1KB9E 4PJ0H 1YI2P 1X9VA 1KV4A 1CZQA 3VP8A 1TU3F 2WSEJ 4K3AA 3C8VA 1SFCD 4OWFA 1DX7A 1ZP0C 1NTMD 2KCUA 5KCBA 1NTME 2FFDC 1FZCA 4EOTA 4YTPC 5CCHD 5E01A 1IFDA 1IFNA 3CLQA 1L0LJ 4IFDK 1NAYA 4W80A 2JWAA 2O1KA 4ZKPA 3B5NC 3CXHH 2N9BA 2AEFA 5KJ7C 5AVSB 3L74G 3GPVA 3PH0A 1KILA 4XE5B 2ZYAA 2K37A 2OGUA 1NU1D 3PP5A 2K9JB 3BRTB 1KTMA 4QMAA 2FYZA 3H1IJ 2W8ZA 4GODA 5KAIH 1LT9B 3AE9C 1BCCJ 1GD2E 2WSFH 1LTTC 3GHGC 1SQQK 3AE1C 3GLMA 4WB4A 2H7HA 1PP9J 4WBAA 3AEEC 3USSA 1M1JA 1YIJP 1SQXG 1RQUA 1PV3A 3HRNA 5GTIE 4R4MA 3II6A 1G1IA 3EZ2A 3P8CD 2E5TA 3CCVP 5AW0B 2YO2A 3P8CE 4JBZA 5GTIH 3Q2YA 2QG4A 3M9QA 1G1JA 3H1KG 3WUTA 2YKPA 3TSIA 1L2PA 1MFTA 3L75J 5CBOA 3EZ7A 3I55P 3CCJP 1GW3A 3Q3DA 4WLSA 3KYQA 2QJYB 1YBKA 2W90A 3L4FA 1N73C 1KILD 1KILE 4PD4D 3A0HE 3CC2P 4YPCA 3RK3C 1JTHB 4L76A 4M3LA 3PJSK 1L4AA 1DD3A 3H1HG 3L71D 2WSFJ 3JCUE 5AVXB 4BWNA 3A0HH 2AEMA 3RK2C 1SVFA 3M0DA 3BCCG 3HUSB 1ZW0A 5AW5B 2CPBA 2O1JA 1PGOA 4I7ZB 1Z56A 2J58A 1WT6A 3NMDA 1JY3O 2WQYC 2B87A 3G71P 1SQVD 2KLUA 1VF5B 4D6TJ 5KLIB 2O3JA 1L0LK 1P84E 3E1IA 1M1KQ 2YIUB 1KQGB 1LTSC 1NTKD 1RF0A 1P84H 1JY3P 3PLNA 1M7LA 2ZFCA 2H88C 2QJPB 4GKGA 3T97A 1AVYA 4ZNCA 3NFQA 3GF7A 2IPPA 1OMIA 3AEBC 2QIWA 2WWWA 1KQSO 4L75A 3TGUG 3KPEA 1VQKP 1LT9C 2ZYDA 4H0LB 3G6EP 2FY8A 1IO4A 3EQ2A 2OYHA 3A0BE 5AVUB 2BOWA 4CPGA 1SQQG 2KZIA 1SQPG 1T2KC 3A0BH 4AYZB 3CCEP 2E74B 2CK3H 1R8DA 2A06G 1SQBD 1KFNA 4H13B 4C7NA 1SQBE 1NTZD 1LNQA 5B5EE 1NTZE 3L74J 1AQTA 1GW4A 3PTZA 2SPZA 2KI7B 2P1JA 5B5EH 1ZR2A 2QJYC 1Q7YQ 2WPRA 3GG2A 1MZ9A 3L36A 1DH3A 2IBZG 2Q3IA 1LJ2A 2Z4EA 1N7SA 1VQ9P 1KZUB 2MJZA 1EZVE 3PHLA 1U7MA 4DOJA 2BCCE 3HUSC 3V2RA 2XDJA 1SQXJ 2ZT9B 4I7ZC 1GU5A 1S72P 3CXHI 1OIPA 1L0NG 2N1TA 3BRVB 1HUCA 1U57A 1VF5C 3H1KJ 5B66H 3VMYA 2WT7A 4BRYB 3KDPB 5KLIC 3FGAD 1SP4A 2YIUC 3N7NA 1USEA 1LTJB 3G9RA 2ZVNB 3NXSA 1RH6A 3C1LA 5K5GB 2QJPC 3L73G 1MV8A 3G3ZA 1EC5A 3H1HJ 2M5AA 2HVAA 2JWDA 4HB1A 4BXLA 4LHFA 2R3SA 3BCCJ 1N7SD 2KK7A 5TISE 1ZOYC 1SLQA 2WPVB 3AE2C 1GK4A 4R4EA 3P8MC 4EIJA 4H0LC 1OW8A 1W2EA 2HODB 3CMEP 1RE3A 3HE5B 1KYOH 1KFMA 2C9NY 1S2EA 3VMXA 3AEGC 3B49A 5APSA 2KNCB 1K73Q 2N1TD 2WPQA 3FWNA 2XV5A 2LXCB 3MUDA 2E74C 1HTLC 2JDIH 1FJPA 1NTMG 4KHXA 4H13C 3SFEC 2OYIB 1EXJA 4HH2A 3CWBE 3A3YB 3R8KA 3LURA 2H43A 4UB6E 1OVRA 2R44A 4DCKA 2Q5UA 4B0YA 2NPSA 1J1DB 1FOSE 3EZ6A 4UB6H 1SFCB 1FZGA 2W6AA 3TGUJ 1OFCX 2HPCA 3I56P 4UB8H 2FFDA 2FXPA 3IFMA 1NO4A 3S1KA 2K3RA 3E7KA 2QEXP 1SQQJ 1ZV8A 1SQPJ 1OVVA 3H1LD 1M90Q 1SQXK 2YO3A 1UIIA 1VPCA 2ZT9C 5APTA 2FYUD 1Q09A 1G2CA 2FYUE 3KQGA 1A02F 4U3FD 1PM6A 5BVZA 5KJ7A 1UIXA 1OVUA 4I1LA 3MZWB 1JMMA 1HF9A 1H8AA 3VYIA 2IDBA 5CBNA 3EWKA 3TYYA 3H32A 3S9OA 1FZAA 5AVQB 1LTJC 1Y6UA 4Z1MH 1IFMA 1ZRTD 1JBGA 2NPSD 3L70D 3W67A 4JYCA 3L70E 2FYNB 4N78D 1W2BO 2XNDH 3ZDMA 1RF1B 2RKLA 1YTZI 1FZCB 4R22B 5CJ0A 4OH8B 4JF7A 3RL0D 2WZ7A 1AQ5A 3O8ZA 1L0NJ 1JNMA 1LWUA 1KB9H 1EXIA 2C9LY 2KSJA 2KVVA 3L37A 3AE4C 2ZAEB 4DCZA 2PGDA 3CX5I 1M56D 2Z5HA 1BOWA 1FDMA 3D71A 3WUVA 3SFDC 2B9BA 5KJ7D 2JMLA 1KILB 4YXDC 1E79H 1PP9D 1Q07A 2P7JA 3R4YA 5AW4B 5APVA 1MUUA 2ZJSE 5KATA 1YQ4C 4YXWH 3V2NA 1VQNP 1EDIA 2OYIC 3L73J 1PPJD 2GM4A 2RN0A 2JR8A 2N9YB 2AXCA 3CXHD 3CD6P 1LTBC 1BE3D 1YYCA 1BE3E 3AEFC 1J1DC 5KAXA 1NU1E 1SFCC 4RESB 3VN0A 3JSVC 3VOPA 2BEQD 2W6JH 1Q06A 1URQA 2ZXXA 1FU1A 1S5LE 1AJYA 3U1CA 2WSCH 1J2JB 5CCHC 3K5BA 2ZHGA 3P7KA 1A02J 2IYOA 1SQPK 3CI9A
chains in the Genus database with same CATH topology
2D2CB 3C8VA 4PV1D 4H13C 3SFEC 2J5UA 2E76C 1NYHA 4IL6X 1R8EA 4RKUJ 2O01J 1EXJA 4GDOA 4H44D 4Y28J 3EZ9A 1K04A 1JB0J 4AYZA 3R8KA 3EZ7A 3LURA 1ZP0C 5KAWA 2KCUA 5KCBA 2G3AA 1PIXA 3D6ZA 4OGQD 4R4LA 1U57A 3IN6A 5L8RJ 3Q3DA 4WLSA 4R22B 5I44A 1VF5C 4YTPC 4H0LB 5E01A 3T97B 2MKVA 1GMJA 5KLIC 2E74D 1FDIA 3FGAD 4B0YA 5D8CA 1ZRTE 4PV1B 1FDOA 3EZ6A 1KILE 3Q1MA 2E75D 1EXIA 4H13D 2BOWA 3R8JA 3QAOA 3E0HA 2KVVA 2E76D 2WSEJ 4H44B 3AE4C 2YIUC 3AE5C 3LW5J 4DCZA 3G9RA 5M1BA 1DD3A 2G8YA 3GP4A 3AEBC 4OGQB 4R24B 1KMIZ 5I41B 2WSFJ 1BOWA 4AYZB 2YMKA 3D71A 3EZFA 1Q08A 3SFDC 1RH6A 2FXPA 3D70A 1VF5D 3AE3C 5KAVA 2JMLA 1WMKA 2QJPC 1ZMEC 3RL0g 3GPVA 2JO1A 1Y9BA 2E74B 4A1MA 1R8DA 2NZ2A 2GOVA 5KKZC 1KORA 4I7ZB 2E75B 2V7QJ 2P10A 4YXDC 4TT3H 4H13B 1Q07A 1S5LX 3R4YA 2E76B 3AE8C 3AE7C 1Q05A 2HVAA 2ZT9C 5GQQA 3IAOA 2D2CC 1DD4A 1YQ4C 2FBWC 4U7JA 1Q09A 5KATA 4LHFA 3AEAC 2FYNC 3RK3E 1KTMA 2K9YA 2WSCJ 1IK7A 1K05A 3Q5SA 4WLWA 3GMAA 2WQYC 4KT0J 1RQVA 1PM6A 1ZOYC 3B71A 1UIXA 1VF5B 3D6YA 1NGMB 2WPVB 1OW6A 3AE2C 5D90A 3GF3A 2DG6A 4J2NA 1LX8A 3AE9C 4R4EA 1HF9A 1OW7A 2QJYC 4H0LC 1OW8A 2IDBA 3AE1C 3GK6A 2JP3A 3EWKA 3GLMA 3AEFC 2OQQA 1VL2A 4PV1C 2E75C 1KQGB 2ZT9D 5KAXA 2D2CD 3S9OA 1S1CX 3Q5PA 4XFJA 3AEEC 3HH0A 3AEGC 4H44C 3ABVC 3B49A 2ZHHA 1RQUA 2BEQD 1PV3A 1Q06A 1HJ0A 5KAUA 1Y6UA 4R4MA 2ZT9B 1KQFB 2IEFA 3O6QA 4OGQC 2H88C 2OG0A 1AJYA 4I7ZC 2QSIA 2VZ4A 3EZ2A 4Z1MH 2H89C 1YQ3C 2QJKC 3AECC 1Q0AA 1JYHA 2BEZF 2ZHGA 1MKMA 1Q90D 4H0LD 1DIPA 3AEDC 1PL5A 2E74C 1JBGA 1D5YA 3AE6C 3Q2YA 1TU3F 3GF7A 3H25A 1OMIA 2QIWA 3Q5RA 3UCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5R A;  2HVA A;  1EXI A;  1Q05 A;  5GQQ A;  2BOW A;  3R8J A;  5KAX A;  3QAO A;  3IAO A;  3E0H A;  2J5U A;  5KAT A;  3Q5P A;  1Q09 A;  1R8E A;  3HH0 A;  1EXJ A;  3B49 A;  3G9R A;  2ZHH A;  3Q5S A;  4AYZ A;  3GP4 A;  4WLW A;  3R8K A;  3LUR A;  1Q06 A;  4R24 B;  5KAU A;  5I41 B;  1BOW A;  5KAW A;  2KCU A;  4R4M A;  5KCB A;  4AYZ B;  3D6Z A;  3D71 A;  4R4L A;  3D6Y A;  1Q08 A;  3Q3D A;  5D90 A;  2VZ4 A;  3D70 A;  2DG6 A;  4J2N A;  4WLS A;  4R22 B;  5I44 A;  3Q1M A;  5KAV A;  2JML A;  4R4E A;  1Q0A A;  3GPV A;  1JYH A;  5E01 A;  3T97 B;  4A1M A;  1R8D A;  2ZHG A;  1DIP A;  2GOV A;  3GK6 A;  1JBG A;  1D5Y A;  4B0Y A;  3Q2Y A;  5D8C A;  2OQQ A;  1Q07 A;  3UCS A; 
#chains in the Genus database with same CATH topology
 4PV1 D;  2K88 A;  3FXD A;  4A7P A;  4IL6 X;  4XA4 A;  1JB0 J;  3WMM 0;  4R4L A;  4B86 A;  1NTM J;  4N3Y B;  1QL2 A;  1VQL P;  3B8E B;  1GMJ A;  4EYY Q;  1Y8A A;  4WY4 B;  1N2D C;  4NPE A;  1NOH A;  4D6T D;  3WU2 E;  4DT0 A;  1AA0 A;  5DJU B;  1LT9 A;  3EZF A;  1SQB G;  3RK2 D;  1JCC A;  4LGD E;  1WMK A;  1NTZ G;  2KS1 B;  2Y9Z A;  2P10 A;  2WIT A;  1KYO I;  3A7O A;  1GL2 A;  1JY2 N;  1IFI A;  3H1J D;  4U7J A;  5KLV D;  3CCR P;  3H1J E;  2FYN C;  4PD4 E;  5KLV E;  4K35 A;  2WSC J;  2JEE A;  1DEE G;  4AYC A;  3B71 A;  3L71 E;  1DEB A;  1URQ D;  2I8D A;  1RF1 C;  1LTA C;  1OW6 A;  5D90 A;  4ASV A;  1LX8 A;  1GZL A;  2KP8 A;  2FKW B;  3QWO C;  1FZC C;  1EZV G;  3JCU H;  2Q9I A;  1L0N K;  2OQQ A;  1BGY D;  3M9H A;  1BGY E;  2BCC G;  1FJK A;  1HJ0 A;  4GT1 A;  1X22 A;  2OG0 A;  1FBM A;  1SQV E;  2L91 A;  1NKN A;  5AVW B;  2IFM A;  1USD A;  1KIL C;  2IBZ I;  3Q5R A;  3EFG A;  2WPS A;  4H44 D;  1NTK E;  5KAW A;  2I1K A;  2XKM A;  3HUS A;  2OYO A;  2W83 C;  3M91 A;  3BVH A;  1FDO A;  2OYH B;  3SWF A;  1OX3 A;  5BU8 B;  2E76 D;  1GL2 D;  4WVZ A;  3RBX A;  3GP4 A;  2OTK E;  1L4A D;  2O01 H;  5H2F E;  2QJK B;  5KAV A;  1FZF A;  1IFP A;  1LP1 A;  3R2P A;  2OTL P;  2KLV A;  3WUU A;  3F5H A;  4C7N B;  3AE8 C;  1EDK A;  5BU5 A;  1N8R Q;  3GMA A;  4W7Y A;  3HD7 B;  1AFO A;  2M3B A;  2AXT E;  1H0T A;  1X79 B;  1NTM K;  4C46 A;  1SQX D;  1EDJ A;  2JP3 A;  1JM0 A;  5AW6 B;  5APQ A;  4WY4 C;  1KC8 Q;  1VDF A;  1OXZ A;  2ZHH A;  1H88 A;  1FS0 E;  1ZXG A;  3M0D C;  3CWB G;  2BEZ F;  3CX5 D;  5CHX A;  1D5Y A;  1KB9 I;  3CX5 E;  3UCS A;  1NU1 K;  2O01 J;  2KIK A;  1GK6 A;  2N1T B;  1VQ5 P;  4AYZ A;  1H89 A;  2HLO A;  3D6Z A;  4OGQ D;  2KZJ A;  3RBZ A;  3OAK A;  3HTK B;  2WT7 B;  2IFN A;  1QL1 A;  2XU6 A;  3FX0 A;  5D8C A;  1X8Y A;  2KOG A;  1PGP A;  3KXD A;  1RF0 C;  4R24 B;  1KMI Z;  5I41 B;  4IOI H;  3KHU A;  3D70 A;  2PP6 A;  2FYU G;  1Y9B A;  1YJ9 P;  4OVN F;  1S5L X;  4LLH A;  5GQQ A;  4AUW A;  1SQB J;  5TJH A;  4IFF A;  4I2L C;  1NTZ J;  1S9K D;  3L72 D;  3L72 E;  1PGJ A;  4IL6 E;  1YJW P;  2NRG A;  2QVA A;  4IL6 H;  2OYH C;  2D2C D;  1S1C X;  4XFJ A;  3I5C A;  5KAU A;  1CSB A;  1RE4 A;  3QH9 A;  1JUN A;  3L70 G;  2QJK C;  3AEC C;  1Q90 D;  2BCC J;  1DIP A;  5TIS H;  3TGU D;  1NHL A;  2UWJ E;  1JY2 O;  2QRX A;  1LTJ A;  1EQ7 A;  1NKZ B;  1JOC A;  2KYV A;  1FE6 A;  4HJG H;  5AVR B;  3HD7 C;  3MGN A;  3V4W A;  4N6J A;  1SQQ D;  1SQV K;  1YTZ T;  1FAV A;  1Y47 A;  2PFX A;  2ZVO B;  3L35 A;  2NPS B;  2E75 D;  2Y9Y A;  3R8J A;  1JY2 P;  1GTW A;  3AE5 C;  4EI2 A;  3KZI E;  2BAS A;  2A06 D;  2E5Y A;  3LW5 H;  1VQP P;  3RL0 B;  4DJG A;  2HOD A;  2RMZ A;  1KOR A;  1LT1 A;  2KNC A;  1AVO A;  2KXP B;  1D7M A;  1BE3 G;  2P58 A;  3M9B A;  2N1T C;  2IBZ D;  4J2N A;  1NU1 G;  2R5D A;  2M3E A;  1AV1 A;  2VRS A;  3H32 B;  3H1L E;  3CCL P;  3B5N A;  2OYI A;  1P84 I;  1R5S A;  1WRG A;  4U3F E;  2KSE A;  2L5G B;  4I6M C;  1YIT P;  3HE4 A;  1SFC A;  4LC1 A;  1SQB K;  2JJL A;  1K04 A;  3CWB J;  1NTZ K;  1FC2 C;  1K8A Q;  2FXO A;  3V2P A;  5AW8 B;  3GHG A;  3V6I A;  1L0L D;  1YHQ P;  1BSH A;  1L0L E;  2A45 G;  1JMB A;  1ZRT E;  4PV1 B;  1LWU B;  3E0H A;  3L73 D;  1RE3 C;  2B88 A;  4N78 E;  3MIW A;  1PGQ A;  3OW2 O;  1IK9 A;  3AE3 C;  3H1J G;  1CI6 A;  1ZME C;  5KLV G;  3MUD C;  4A1M A;  1FZB A;  1RH5 B;  3L71 G;  3H1I D;  5CCG C;  2ZYG A;  3B5N D;  3CL3 D;  3H1I E;  4GIF A;  2FYU J;  1HBW A;  1JEK A;  4KT0 J;  2Q7C A;  2PAJ A;  1Q2N A;  1BCC D;  2E43 A;  1N7L A;  1BCC E;  1BGY G;  1NWQ A;  1N73 A;  1J1E B;  2HFE D;  2NPS C;  3A5T A;  1PP9 E;  3FXE A;  1SQV G;  3TNU A;  2WSS H;  2JKV A;  2J59 M;  3U1A A;  4L74 A;  1RF1 A;  1RY3 A;  2AEJ A;  1URQ B;  3O6Q A;  1PPJ E;  1OZH A;  1E5W A;  5AVY B;  1YQ3 C;  1EZV I;  3RL0 C;  1Q0A A;  1VQO P;  1NTK G;  5KKZ B;  3CXH E;  1MKM A;  5APX A;  4W7Z A;  2HYN A;  2H8P D;  4WWI A;  3L75 D;  1R8E A;  3MP7 B;  3OA7 A;  3L70 J;  3L75 E;  2Q6Q A;  1M1J B;  1T8Z A;  5L8R J;  3M0A A;  1M57 D;  1S5L H;  3Q1M A;  5KAI E;  4H44 B;  1NJI Q;  1YJN P;  1HVV A;  1KD1 Q;  1HGZ A;  4TT3 H;  2E76 B;  1GL2 B;  1U7J A;  5C39 A;  2K9J A;  3RK3 D;  1HWT C;  2YNY A;  3RK3 E;  2XZR A;  1K05 A;  1L4A B;  3LID A;  3MHV A;  1RQV A;  3CC4 P;  4D6T E;  5EFW B;  1NGM B;  1T3U A;  3N4X A;  3G4S P;  1OW7 A;  4O9B A;  2DW3 A;  2A45 H;  2W27 A;  3WU2 H;  1BE3 J;  3CCS P;  3MD0 A;  4PV1 C;  2P67 A;  1LWU C;  3CMA P;  1NU1 J;  4EDF A;  1T3J A;  2HR3 A;  3TK1 A;  1QX8 A;  1KQF B;  2B87 B;  1T6A A;  3GW6 A;  4PD4 H;  5AW1 B;  2GA1 A;  1PL5 A;  3AED C;  4WY4 A;  2E42 A;  3FWL A;  2M8R A;  4RO0 A;  3ITK A;  2LXB A;  2R3C A;  3EZ9 A;  2FYU K;  1PIX A;  1KQL A;  5I44 A;  1ZR4 A;  1HGV A;  1ZN5 A;  3T97 B;  2KS1 A;  1EDL A;  5AW3 B;  5KAF E;  3V2Q A;  1J1E C;  5CMZ A;  2IYP A;  3PRJ A;  1LGH B;  1PFI A;  1JTH A;  2P2U A;  5KAF H;  5M1B A;  2G8Y A;  4OGQ B;  2Y0D A;  2YMK A;  3TDK A;  1URQ C;  4Y99 B;  1QEX A;  3IR9 A;  1P84 D;  2NZ2 A;  5KKZ C;  1LP1 B;  1VQ6 P;  4L73 A;  2C0X A;  2Y0E A;  3L72 G;  3IAO A;  3L74 D;  3L74 E;  2K9Y A;  3H1J J;  5KLV J;  2WTY A;  1T2K D;  1M1J C;  1H0T B;  3L71 J;  1X0T A;  3F89 A;  2IX7 C;  1VQ8 P;  1FZE A;  5H2F H;  4WY4 D;  4JYB A;  1VL2 A;  1NH4 A;  2GUV A;  2YKQ A;  1VQM P;  1BGY J;  4H44 C;  1JO5 A;  1SS1 A;  2IZ0 A;  3CCQ P;  2V4H A;  2H89 C;  3M06 A;  4GOF A;  5AVV B;  1SQV J;  3SWY A;  2Q3E A;  1SQX E;  2AXT H;  3BAT A;  2YXR B;  3LIE A;  1RHZ B;  2D2C B;  2J5U A;  2E76 C;  1GL2 C;  1NYH A;  1N7S B;  4HYT B;  2WVR A;  1NTK J;  1IC2 A;  3H1K D;  1L4A C;  2W6B A;  3H1K E;  1XTC C;  3IN6 A;  2QM8 A;  2C0W A;  3BAS A;  1BSN A;  1LTI C;  1MFZ A;  1IFJ A;  1N86 A;  4ZMD A;  1IZN B;  3HD7 A;  3CX5 H;  3CPW O;  1VF5 D;  1QLE D;  1S4X A;  2JO1 A;  4TLF A;  3H1H D;  2GOV A;  1IJD B;  3H1H E;  2B89 A;  2E75 B;  2I1J A;  1Q05 A;  1KN7 A;  3BCC D;  2O01 N;  3BCC E;  2R32 A;  3AEA C;  1EZV D;  2RH0 A;  1IK7 A;  2QA4 P;  4WLW A;  2QE7 H;  3H1L G;  3GF3 A;  1VQ7 P;  2WMM A;  1Q82 Q;  2DG6 A;  2BCC D;  2Y0C A;  2XNX A;  1LTG C;  3OJA B;  3RGU A;  2POH A;  3H6P A;  4NPF X;  1HJB A;  3GK6 A;  3U59 A;  5AW2 B;  4U3F G;  2YXQ B;  2M5A B;  3HH0 A;  2HG5 D;  3JC2 2;  2QM7 A;  3MTU E;  5B66 E;  2V7Q H;  3ABV C;  4DZO A;  4OGQ C;  1S9K E;  4NPD A;  4RJT A;  4Y99 C;  1R5L A;  3HTK A;  4MN4 C;  4ASW A;  4H0L D;  1XTG B;  4RKU J;  3CCM P;  1L0L G;  1HH0 A;  5KLV K;  2FXM A;  1JCD A;  3HD7 D;  3SSU A;  3W68 A;  1FOS F;  4BRY A;  4C7R A;  2YKO A;  2MKV A;  2E74 D;  3VP9 A;  5AW7 B;  5KTB A;  3C9I A;  3EFF K;  4H13 D;  3TGU E;  4AQR D;  1NVO A;  2Q1K A;  3B4S A;  1PZQ A;  4HKZ H;  1Q08 A;  1KYO D;  2A45 I;  2OAR A;  3RL0 g;  1SQP D;  1KYO E;  3H1I G;  1SQQ E;  1SQP E;  2V7Q J;  4ZKU A;  2K1A A;  1BCC G;  1OWA A;  2D2C C;  1DD4 A;  2FBW C;  3SWK A;  1K9M Q;  3V5B A;  1QVF O;  2HPC B;  3Q5S A;  1NTK K;  1N7S C;  2A06 E;  2FFD B;  1PP9 G;  4PD4 I;  2R5B A;  3KZI H;  2LR2 A;  3L72 J;  2KUB A;  3S4R A;  1S3J A;  5APU A;  2ITA A;  1PPJ G;  3HE5 A;  5CCG A;  2ZT9 D;  3CWB D;  3B5N B;  1QVG O;  1G2C B;  1M8O B;  2IEF A;  2VZ4 A;  4IFM A;  2IBZ E;  3L75 G;  1JYH A;  5E79 E;  2PRR A;  3E1R A;  5GTH E;  3AE6 C;  4UB8 E;  5DJT B;  3HE4 B;  3H25 A;  2E75 C;  1BDD A;  3P32 A;  5E79 H;  1Q86 Q;  4GDO A;  4Y28 J;  1JY3 N;  5GTH H;  3A2A A;  2ZXE B;  2Z5I A;  1ZLL A;  2G3A A;  1GU4 A;  1NAF A;  4KJM A;  2CPS A;  3GHG B;  1QGK B;  1L0N D;  2KB7 P;  1L0N E;  1FDI A;  5APY A;  1GDT A;  3IF4 A;  1BDC A;  3QAO A;  5AW9 B;  1VQ4 P;  3LW5 J;  2WSE H;  1Q81 Q;  4JQ0 D;  2GUS A;  3UIA A;  1RE4 C;  5CCH A;  1CI6 B;  5APW A;  1W5C E;  4D6T G;  4GOE A;  3AE7 C;  3NTN A;  2OTJ P;  5CCG D;  2M0B A;  3VMA A;  2YMY A;  3L73 E;  4JPZ B;  5AVZ B;  3VTP C;  1CW5 A;  2LKM A;  3D6Y A;  3VMZ A;  3TF5 A;  1N73 B;  3V4Q A;  5CJ4 A;  2IZ1 A;  3RK3 B;  3TNU B;  3Q5P A;  3H1L J;  4PJ0 E;  3CCU P;  3CC7 P;  3RK2 B;  3O6Q B;  1KB9 D;  5AVT B;  2QSI A;  4U3F J;  1KB9 E;  4PJ0 H;  1YI2 P;  1X9V A;  1KV4 A;  1CZQ A;  3VP8 A;  1TU3 F;  2WSE J;  4K3A A;  3C8V A;  1SFC D;  4OWF A;  1DX7 A;  1ZP0 C;  1NTM D;  2KCU A;  5KCB A;  1NTM E;  2FFD C;  1FZC A;  4EOT A;  4YTP C;  5CCH D;  5E01 A;  1IFD A;  1IFN A;  3CLQ A;  1L0L J;  4IFD K;  1NAY A;  4W80 A;  2JWA A;  2O1K A;  4ZKP A;  3B5N C;  3CXH H;  2N9B A;  2AEF A;  5KJ7 C;  5AVS B;  3L74 G;  3GPV A;  3PH0 A;  1KIL A;  4XE5 B;  2ZYA A;  2K37 A;  2OGU A;  1NU1 D;  3PP5 A;  2K9J B;  3BRT B;  1KTM A;  4QMA A;  2FYZ A;  3H1I J;  2W8Z A;  4GOD A;  5KAI H;  1LT9 B;  3AE9 C;  1BCC J;  1GD2 E;  2WSF H;  1LTT C;  3GHG C;  1SQQ K;  3AE1 C;  3GLM A;  4WB4 A;  2H7H A;  1PP9 J;  4WBA A;  3AEE C;  3USS A;  1M1J A;  1YIJ P;  1SQX G;  1RQU A;  1PV3 A;  3HRN A;  5GTI E;  4R4M A;  3II6 A;  1G1I A;  3EZ2 A;  3P8C D;  2E5T A;  3CCV P;  5AW0 B;  2YO2 A;  3P8C E;  4JBZ A;  5GTI H;  3Q2Y A;  2QG4 A;  3M9Q A;  1G1J A;  3H1K G;  3WUT A;  2YKP A;  3TSI A;  1L2P A;  1MFT A;  3L75 J;  5CBO A;  3EZ7 A;  3I55 P;  3CCJ P;  1GW3 A;  3Q3D A;  4WLS A;  3KYQ A;  2QJY B;  1YBK A;  2W90 A;  3L4F A;  1N73 C;  1KIL D;  1KIL E;  4PD4 D;  3A0H E;  3CC2 P;  4YPC A;  3RK3 C;  1JTH B;  4L76 A;  4M3L A;  3PJS K;  1L4A A;  1DD3 A;  3H1H G;  3L71 D;  2WSF J;  3JCU E;  5AVX B;  4BWN A;  3A0H H;  2AEM A;  3RK2 C;  1SVF A;  3M0D A;  3BCC G;  3HUS B;  1ZW0 A;  5AW5 B;  2CPB A;  2O1J A;  1PGO A;  4I7Z B;  1Z56 A;  2J58 A;  1WT6 A;  3NMD A;  1JY3 O;  2WQY C;  2B87 A;  3G71 P;  1SQV D;  2KLU A;  1VF5 B;  4D6T J;  5KLI B;  2O3J A;  1L0L K;  1P84 E;  3E1I A;  1M1K Q;  2YIU B;  1KQG B;  1LTS C;  1NTK D;  1RF0 A;  1P84 H;  1JY3 P;  3PLN A;  1M7L A;  2ZFC A;  2H88 C;  2QJP B;  4GKG A;  3T97 A;  1AVY A;  4ZNC A;  3NFQ A;  3GF7 A;  2IPP A;  1OMI A;  3AEB C;  2QIW A;  2WWW A;  1KQS O;  4L75 A;  3TGU G;  3KPE A;  1VQK P;  1LT9 C;  2ZYD A;  4H0L B;  3G6E P;  2FY8 A;  1IO4 A;  3EQ2 A;  2OYH A;  3A0B E;  5AVU B;  2BOW A;  4CPG A;  1SQQ G;  2KZI A;  1SQP G;  1T2K C;  3A0B H;  4AYZ B;  3CCE P;  2E74 B;  2CK3 H;  1R8D A;  2A06 G;  1SQB D;  1KFN A;  4H13 B;  4C7N A;  1SQB E;  1NTZ D;  1LNQ A;  5B5E E;  1NTZ E;  3L74 J;  1AQT A;  1GW4 A;  3PTZ A;  2SPZ A;  2KI7 B;  2P1J A;  5B5E H;  1ZR2 A;  2QJY C;  1Q7Y Q;  2WPR A;  3GG2 A;  1MZ9 A;  3L36 A;  1DH3 A;  2IBZ G;  2Q3I A;  1LJ2 A;  2Z4E A;  1N7S A;  1VQ9 P;  1KZU B;  2MJZ A;  1EZV E;  3PHL A;  1U7M A;  4DOJ A;  2BCC E;  3HUS C;  3V2R A;  2XDJ A;  1SQX J;  2ZT9 B;  4I7Z C;  1GU5 A;  1S72 P;  3CXH I;  1OIP A;  1L0N G;  2N1T A;  3BRV B;  1HUC A;  1U57 A;  1VF5 C;  3H1K J;  5B66 H;  3VMY A;  2WT7 A;  4BRY B;  3KDP B;  5KLI C;  3FGA D;  1SP4 A;  2YIU C;  3N7N A;  1USE A;  1LTJ B;  3G9R A;  2ZVN B;  3NXS A;  1RH6 A;  3C1L A;  5K5G B;  2QJP C;  3L73 G;  1MV8 A;  3G3Z A;  1EC5 A;  3H1H J;  2M5A A;  2HVA A;  2JWD A;  4HB1 A;  4BXL A;  4LHF A;  2R3S A;  3BCC J;  1N7S D;  2KK7 A;  5TIS E;  1ZOY C;  1SLQ A;  2WPV B;  3AE2 C;  1GK4 A;  4R4E A;  3P8M C;  4EIJ A;  4H0L C;  1OW8 A;  1W2E A;  2HOD B;  3CME P;  1RE3 A;  3HE5 B;  1KYO H;  1KFM A;  2C9N Y;  1S2E A;  3VMX A;  3AEG C;  3B49 A;  5APS A;  2KNC B;  1K73 Q;  2N1T D;  2WPQ A;  3FWN A;  2XV5 A;  2LXC B;  3MUD A;  2E74 C;  1HTL C;  2JDI H;  1FJP A;  1NTM G;  4KHX A;  4H13 C;  3SFE C;  2OYI B;  1EXJ A;  4HH2 A;  3CWB E;  3A3Y B;  3R8K A;  3LUR A;  2H43 A;  4UB6 E;  1OVR A;  2R44 A;  4DCK A;  2Q5U A;  4B0Y A;  2NPS A;  1J1D B;  1FOS E;  3EZ6 A;  4UB6 H;  1SFC B;  1FZG A;  2W6A A;  3TGU J;  1OFC X;  2HPC A;  3I56 P;  4UB8 H;  2FFD A;  2FXP A;  3IFM A;  1NO4 A;  3S1K A;  2K3R A;  3E7K A;  2QEX P;  1SQQ J;  1ZV8 A;  1SQP J;  1OVV A;  3H1L D;  1M90 Q;  1SQX K;  2YO3 A;  1UII A;  1VPC A;  2ZT9 C;  5APT A;  2FYU D;  1Q09 A;  1G2C A;  2FYU E;  3KQG A;  1A02 F;  4U3F D;  1PM6 A;  5BVZ A;  5KJ7 A;  1UIX A;  1OVU A;  4I1L A;  3MZW B;  1JMM A;  1HF9 A;  1H8A A;  3VYI A;  2IDB A;  5CBN A;  3EWK A;  3TYY A;  3H32 A;  3S9O A;  1FZA A;  5AVQ B;  1LTJ C;  1Y6U A;  4Z1M H;  1IFM A;  1ZRT D;  1JBG A;  2NPS D;  3L70 D;  3W67 A;  4JYC A;  3L70 E;  2FYN B;  4N78 D;  1W2B O;  2XND H;  3ZDM A;  1RF1 B;  2RKL A;  1YTZ I;  1FZC B;  4R22 B;  5CJ0 A;  4OH8 B;  4JF7 A;  3RL0 D;  2WZ7 A;  1AQ5 A;  3O8Z A;  1L0N J;  1JNM A;  1LWU A;  1KB9 H;  1EXI A;  2C9L Y;  2KSJ A;  2KVV A;  3L37 A;  3AE4 C;  2ZAE B;  4DCZ A;  2PGD A;  3CX5 I;  1M56 D;  2Z5H A;  1BOW A;  1FDM A;  3D71 A;  3WUV A;  3SFD C;  2B9B A;  5KJ7 D;  2JML A;  1KIL B;  4YXD C;  1E79 H;  1PP9 D;  1Q07 A;  2P7J A;  3R4Y A;  5AW4 B;  5APV A;  1MUU A;  2ZJS E;  5KAT A;  1YQ4 C;  4YXW H;  3V2N A;  1VQN P;  1EDI A;  2OYI C;  3L73 J;  1PPJ D;  2GM4 A;  2RN0 A;  2JR8 A;  2N9Y B;  2AXC A;  3CXH D;  3CD6 P;  1LTB C;  1BE3 D;  1YYC A;  1BE3 E;  3AEF C;  1J1D C;  5KAX A;  1NU1 E;  1SFC C;  4RES B;  3VN0 A;  3JSV C;  3VOP A;  2BEQ D;  2W6J H;  1Q06 A;  1URQ A;  2ZXX A;  1FU1 A;  1S5L E;  1AJY A;  3U1C A;  2WSC H;  1J2J B;  5CCH C;  3K5B A;  2ZHG A;  3P7K A;  1A02 J;  2IYO A;  1SQP K;  3CI9 A; 
#chains in the Genus database with same CATH homology
 2D2C B;  3C8V A;  4PV1 D;  4H13 C;  3SFE C;  2J5U A;  2E76 C;  1NYH A;  4IL6 X;  1R8E A;  4RKU J;  2O01 J;  1EXJ A;  4GDO A;  4H44 D;  4Y28 J;  3EZ9 A;  1K04 A;  1JB0 J;  4AYZ A;  3R8K A;  3EZ7 A;  3LUR A;  1ZP0 C;  5KAW A;  2KCU A;  5KCB A;  2G3A A;  1PIX A;  3D6Z A;  4OGQ D;  4R4L A;  1U57 A;  3IN6 A;  5L8R J;  3Q3D A;  4WLS A;  4R22 B;  5I44 A;  1VF5 C;  4YTP C;  4H0L B;  5E01 A;  3T97 B;  2MKV A;  1GMJ A;  5KLI C;  2E74 D;  1FDI A;  3FGA D;  4B0Y A;  5D8C A;  1ZRT E;  4PV1 B;  1FDO A;  3EZ6 A;  1KIL E;  3Q1M A;  2E75 D;  1EXI A;  4H13 D;  2BOW A;  3R8J A;  3QAO A;  3E0H A;  2KVV A;  2E76 D;  2WSE J;  4H44 B;  3AE4 C;  2YIU C;  3AE5 C;  3LW5 J;  4DCZ A;  3G9R A;  5M1B A;  1DD3 A;  2G8Y A;  3GP4 A;  3AEB C;  4OGQ B;  4R24 B;  1KMI Z;  5I41 B;  2WSF J;  1BOW A;  4AYZ B;  2YMK A;  3D71 A;  3EZF A;  1Q08 A;  3SFD C;  1RH6 A;  2FXP A;  3D70 A;  1VF5 D;  3AE3 C;  5KAV A;  2JML A;  1WMK A;  2QJP C;  1ZME C;  3RL0 g;  3GPV A;  2JO1 A;  1Y9B A;  2E74 B;  4A1M A;  1R8D A;  2NZ2 A;  2GOV A;  5KKZ C;  1KOR A;  4I7Z B;  2E75 B;  2V7Q J;  2P10 A;  4YXD C;  4TT3 H;  4H13 B;  1Q07 A;  1S5L X;  3R4Y A;  2E76 B;  3AE8 C;  3AE7 C;  1Q05 A;  2HVA A;  2ZT9 C;  5GQQ A;  3IAO A;  2D2C C;  1DD4 A;  1YQ4 C;  2FBW C;  4U7J A;  1Q09 A;  5KAT A;  4LHF A;  3AEA C;  2FYN C;  3RK3 E;  1KTM A;  2K9Y A;  2WSC J;  1IK7 A;  1K05 A;  3Q5S A;  4WLW A;  3GMA A;  2WQY C;  4KT0 J;  1RQV A;  1PM6 A;  1ZOY C;  3B71 A;  1UIX A;  1VF5 B;  3D6Y A;  1NGM B;  2WPV B;  1OW6 A;  3AE2 C;  5D90 A;  3GF3 A;  2DG6 A;  4J2N A;  1LX8 A;  3AE9 C;  4R4E A;  1HF9 A;  1OW7 A;  2QJY C;  4H0L C;  1OW8 A;  2IDB A;  3AE1 C;  3GK6 A;  2JP3 A;  3EWK A;  3GLM A;  3AEF C;  2OQQ A;  1VL2 A;  4PV1 C;  2E75 C;  1KQG B;  2ZT9 D;  5KAX A;  2D2C D;  3S9O A;  1S1C X;  3Q5P A;  4XFJ A;  3AEE C;  3HH0 A;  3AEG C;  4H44 C;  3ABV C;  3B49 A;  2ZHH A;  1RQU A;  2BEQ D;  1PV3 A;  1Q06 A;  1HJ0 A;  5KAU A;  1Y6U A;  4R4M A;  2ZT9 B;  1KQF B;  2IEF A;  3O6Q A;  4OGQ C;  2H88 C;  2OG0 A;  1AJY A;  4I7Z C;  2QSI A;  2VZ4 A;  3EZ2 A;  4Z1M H;  2H89 C;  1YQ3 C;  2QJK C;  3AEC C;  1Q0A A;  1JYH A;  2BEZ F;  2ZHG A;  1MKM A;  1Q90 D;  4H0L D;  1DIP A;  3AED C;  1PL5 A;  2E74 C;  1JBG A;  1D5Y A;  3AE6 C;  3Q2Y A;  1TU3 F;  3GF7 A;  3H25 A;  1OMI A;  2QIW A;  3Q5R A;  3UCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...