3Q2YA

Crystal structure of bmrr bound to ethidium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q2yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q2yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q2yA03
4R4LA 4R24B 5KAXA 1BOWA 3D6ZA 1Q07A 5I44A 2KCUA 3Q2YA 3Q3DA 5KCBA 1Q05A 4AYZA 4AYZB 3R8KA 3D70A 1Q06A 1D5YA 5E01A 1Q0AA 3B49A 3HH0A 2JMLA 1DIPA 5I41B 4R4EA 3E0HA 3T97B 2VZ4A 2DG6A 3GP4A 4R22B 3UCSA 3GPVA 3Q1MA 3Q5RA 5KAUA 3GK6A 2ZHHA 3D71A 4A1MA 5D8CA 1EXIA 4B0YA 2ZHGA 3D6YA 4WLSA 1JYHA 3IAOA 5GQQA 1R8EA 3Q5SA 4R4MA 2GOVA 4WLWA 3LURA 1Q08A 3QAOA 2OQQA 5KATA 2BOWA 2J5UA 2HVAA 5KAVA 1Q09A 5KAWA 3R8JA 1JBGA 5D90A 3Q5PA 3G9RA 1R8DA 1EXJA 4J2NA
chains in the Genus database with same CATH superfamily
3ITKA 1LP1A 4PJ0H 5AW0B 1NKZB 1KQLA 1LNQA 4HYTB 1JCCA 4UB6E 4GOFA 2N1TD 4BXLA 3B4SA 2H89C 4U7JA 1NKNA 1KB9E 3AE2C 1X9VA 1L0LK 4Z1MH 4OGQB 3D71A 4B0YA 1NH4A 3P8MC 5KAIE 1G1IA 2ZYGA 2IDBA 3V2QA 1SQPK 2Y0EA 3CC2P 4ASVA 2QJPC 3WUUA 3KYQA 2B87A 1NTZE 2KSEA 1SQQK 3TGUD 3GP4A 2Y9ZA 4PV1D 2PAJA 1WMKA 2RKLA 3HTKB 3KZIH 2FYZA 1FZAA 5AVQB 1MFZA 3CWBG 1SFCB 2QM7A 3NMDA 1AV1A 3Q2YA 3Q3DA 1GTWA 1RE4C 1HBWA 4JF7A 2PFXA 4ZKPA 3H1IE 2HR3A 2YMYA 2HFED 2IBZG 2IFMA 3BASA 3RK3B 2MKVA 1EDIA 4GT1A 3L37A 4PD4I 4R4LA 2ZVOB 1YITP 3O6QB 1ZR2A 2FYNB 3A0HE 4W7ZA 1H89A 4CPGA 1YJNP 1NTMJ 1USDA 4C7NB 3L72D 2IEFA 1RQUA 2E75B 2KK7A 3E1IA 2LXCB 3H1JD 1M1KQ 5CCHD 1HH0A 2WSFJ 1XTCC 4GOEA 2N9BA 4LHFA 2JKVA 3RL0B 1NTZK 3WUVA 4EOTA 1KC8Q 3M9HA 1NTKK 1VQKP 5E01A 3AE4C 3FWNA 2V4HA 4HB1A 4H13C 3F5HA 3G3ZA 3HE5A 2XV5A 1BGYJ 2RMZA 3HUSA 4H0LB 2QIWA 1KZUB 4C46A 5KTBA 3BVHA 2Q3EA 1FOSE 2M5AA 4YXDC 1VL2A 2XU6A 1VQ5P 4KJMA 4PD4H 3MIWA 4OH8B 2H8PD 1NHLA 5CBNA 2WPVB 1BSNA 3KZIE 3G9RA 3IR9A 5C39A 1VQ7P 3L74E 1YBKA 1JMBA 3H1KJ 1D5YA 3H1ID 1JY3O 3GK6A 5APUA 2GUVA 2LR2A 1QVFO 1K9MQ 3CCUP 3CI9A 3RBZA 1QLED 2C9LY 2QRXA 1BE3D 2GUSA 2N1TA 1DH3A 1NTMK 4WY4B 1OX3A 4N3YB 1H0TA 4N6JA 4DCKA 1P84D 3AEAC 5D90A 1G2CA 1W2EA 3CCJP 1BCCJ 2GM4A 4AYZB 2HPCB 4Y99C 1OWAA 4BWNA 4ZNCA 1FJKA 4AYCA 1JY2O 5KJ7A 2O01H 1CW5A 2W27A 3H1LJ 3GG2A 3VP9A 2HVAA 1SFCC 3L4FA 1LTGC 5KKZB 2Z4EA 3TYYA 1DEEG 3RK2C 2NPSC 4LGDE 3SSUA 1PP9E 2CK3H 1USEA 3RL0D 5AVSB 1VQ6P 1PP9D 2XNDH 4WLWA 1JY2P 1IJDB 1IK9A 1URQC 2QJYB 4BRYB 1PL5A 1FDIA 1KB9D 2E75C 3QH9A 3RK3E 1GZLA 3SFDC 1PIXA 5APWA 3JCUE 2BCCE 4R4MA 3H25A 2FYNC 5DJUB 1L4AD 3RL0g 4RJTA 5APYA 3VMYA 1JTHA 1NTKJ 1NTZG 2E76D 3ABVC 1ZXGA 2J58A 3NTNA 1NU1J 4OWFA 2JDIH 2R5DA 3EZ6A 2LXBA 2FYUD 1FZGA 1FZEA 1D7MA 2FBWC 2JEEA 3C8VA 3H1IJ 1H8AA 3VMXA 1IC2A 1HVVA 3E7KA 3M06A 1VQLP 1OVRA 2ZYAA 3MUDC 4HH2A 1UIXA 1L0LD 2JR8A 2D2CC 1KILB 3SFEC 3A7OA 4D6TE 2XZRA 1VQNP 2KVVA 1IO4A 1N73A 2QG4A 3CD6P 2B88A 1OIPA 1PGOA 5AW2B 3B49A 1GL2B 3FWLA 4D6TG 3TNUA 2K37A 2OYHA 3AE1C 2Q5UA 1Z56A 4WBAA 3P8CE 4MN4C 3AE6C 1JUNA 1BGYE 3W67A 1LWUC 2HYNA 3W68A 1SQXJ 5GTHE 1VF5C 1P84I 4HJGH 1R5SA 1LT9C 2AEJA 3RK3C 2WT7B 1WRGA 1KILE 3HE4A 3SWYA 3L72J 1NTKG 2M8RA 1AA0A 4IOIH 3L71D 2WSCJ 1LTJB 3CCSP 3EZFA 2C0WA 1U57A 1R5LA 3RK2D 1OW6A 3AE8C 1QL2A 4Y99B 1QX8A 1SQBD 1BDCA 1S5LX 1KD1Q 1JO5A 1N7SD 1KORA 2WSEH 3EFGA 1LT9B 5GTIH 3L70G 3TDKA 3A5TA 3UCSA 5E79E 4U3FJ 1NU1K 1PM6A 3CPWO 5DJTB 2POHA 3L71G 2KP8A 2P58A 3IN6A 1NTMG 3TGUJ 1Q05A 1FBMA 5CMZA 2V7QH 4L74A 2WQYC 1JB0J 3HD7D 1DD4A 4DT0A 1RE4A 1T3JA 1U7MA 4K35A 1FJPA 1SQQD 1RH6A 3H32B 1H88A 1SQVE 1SQPD 4OGQD 3CXHI 2KXPB 3KQGA 3I56P 3SWKA 3T97A 2QJPB 3H1HJ 4RO0A 5B5EE 2ZT9C 1R8EA 3HD7A 1L0LG 1OW8A 1OVUA 1PGPA 5AW8B 1IFDA 1CI6A 1S9KD 3OW2O 2QA4P 3L75G 2DW3A 1AQ5A 1S3JA 5I41B 3GLMA 4Y28J 1FZCC 1N86A 2YO3A 3VTPC 4WLSA 2BEQD 1NTZD 1QL1A 2K1AA 4B86A 1J2JB 1KQGB 4R24B 3H1HE 5KAFE 3MTUE 3G4SP 3VMZA 5KAUA 1L0ND 1X8YA 1BCCG 4GODA 2P67A 3RK3D 1M90Q 3CWBD 1M56D 4U3FE 3AE3C 1M1JA 2NPSB 5EFWB 3IF4A 3SWFA 3M0DC 5AVRB 3VMAA 5TISH 1R8DA 1RE3A 3OA7A 3L35A 1EDJA 3I55P 3RL0C 4L75A 1N7SB 1M8OB 3IFMA 5M1BA 3PJSK 1IK7A 1OW7A 3L70E 2XNXA 2E76B 5AVYB 4U3FD 1JMMA 1PPJG 4EI2A 3LW5J 4JPZB 2FFDA 1YYCA 3F89A 3CMAP 2G8YA 1DIPA 2J59M 1LTJC 2HODB 1T8ZA 5KLVE 1SQBJ 3EZ2A 1N2DC 1J1EC 4JQ0D 1PFIA 1KYOE 1SQVD 1LTTC 3M91A 4K3AA 1SQQG 1OVVA 2FY8A 2WWWA 3HD7C 5AW7B 1SFCD 3KXDA 4H44C 3TGUG 2BEZF 4IL6E 1NAYA 2FXMA 2WMMA 1YTZI 4PD4D 2VZ4A 2H43A 4WB4A 2A45H 2Z5HA 3WUTA 1RF0C 5TISE 3Q5SA 1N8RQ 2WZ7A 2KB7P 4KHXA 3R8JA 4W7YA 1S1CX 2WSEJ 1YI2P 2D2CB 1LTAC 3OAKA 4L76A 4UB8H 2E5TA 4YPCA 2H88C 2K3RA 2B9BA 1L0NE 2ZT9B 3NFQA 2JWDA 3OJAB 1FDMA 1L0LJ 4H44D 3CXHD 2LKMA 1M1JC 3VYIA 3LIDA 2K88A 1MZ9A 2Q6QA 3V5BA 2ZXXA 3L75D 2M3EA 2KNCA 3AE9C 5AW9B 2FFDC 1Q09A 3M0AA 1NU1D 2Y0DA 2KZIA 1JBGA 2P10A 5APVA 1IFNA 2BASA 1WT6A 2IBZD 1L0LE 1KFNA 4IL6X 5AVUB 2IBZI 2CPBA 3H1JJ 3HUSB 3FX0A 1QEXA 3CXHH 4M3LA 2M5AB 2E5YA 1VQPP 2NRGA 2R44A 1SS1A 2IYOA 3H1LG 3L73E 3R2PA 2HG5D 2YXQB 4XFJA 5KAVA 1RHZB 2KI7B 1KV4A 1IZNB 3CMEP 5CJ4A 1SQXD 1L0NK 1HF9A 3Q5RA 1LT1A 2OYOA 2Q9IA 3E1RA 4DCZA 3L74G 1K73Q 3RBXA 3CXHE 3U1CA 1KQFB 3MUDA 3D6ZA 1RF1A 2N1TB 3R8KA 1Q06A 2E75D 1YJ9P 1NJIQ 1JCDA 2KLUA 3PHLA 2ZHHA 4H13D 3B5NB 5GTHH 1N7SC 4W80A 1NTZJ 1ZMEC 4AUWA 4KT0J 3WMM0 2KS1B 1NAFA 1DD3A 1NTME 1LWUB 3KHUA 2HPCA 2ZFCA 4OGQC 5KLIC 1Q86Q 2OYIC 2P2UA 3N4XA 1RH5B 5CCGC 2WT7A 3ZDMA 2WSCH 1LTIC 4PV1B 1ZN5A 3QAOA 2WVRA 1FE6A 1CSBA 3A3YB 5AVXB 3L73J 2RH0A 2OYIB 1PPJE 1EXJA 2E74C 2IZ1A 3P8CD 3AEFC 1L4AB 2QSIA 5CCGA 3KDPB 3EZ9A 2O01N 4H44B 1SQPE 1E5WA 2M3BA 4YXWH 2YKQA 4I6MC 2L91A 3PP5A 1KYOD 5KJ7D 5KLIB 3S1KA 2IPPA 2KLVA 1S2EA 2E74D 3CC7P 1JNMA 1IFPA 3GF3A 1VQ8P 4I1LA 2W8ZA 3BCCG 1Q90D 1BGYD 4NPEA 3EFFK 5AW3B 2YO2A 1P84E 3TF5A 2A45G 2Z5IA 4J2NA 2KYVA 2WITA 3L73G 1HUCA 1ZOYC 2JWAA 2Y9YA 1URQA 2QM8A 5H2FH 3H1LD 1AQTA 3V2RA 1G1JA 2GOVA 4TT3H 3PLNA 3C1LA 3L71E 1A02J 3BCCJ 5CJ0A 5BU5A 3L36A 1S9KE 2IZ0A 1RF0A 4LC1A 1L0NG 1XTGB 2YXRB 2OTLP 5KLVG 3BCCD 1FS0E 2YNYA 3AEDC 1RQVA 1VDFA 3B5ND 2ZAEB 1KILC 1SQQE 5CHXA 4I2LC 2K9JA 2BCCJ 4R22B 3L75J 2OYHB 1X0TA 1HJ0A 1EXIA 1FZFA 5BU8B 1N73C 1EZVE 3RK2B 1NU1E 1PPJD 3H1KD 2QE7H 5KCBA 1BDDA 2QVAA 2OGUA 2W6AA 3GW6A 4ZMDA 1GD2E 2QJYC 4XE5B 4NPDA 3VN0A 1LGHB 3HE4B 1M1JB 1DX7A 3MD0A 3VOPA 2GA1A 1SLQA 1LJ2A 1SQXK 1OXZA 3L72G 3CX5E 5GTIE 2VRSA 3H1LE 1N7SA 5KJ7C 1AFOA 3EWKA 3JCUH 3M0DA 1MKMA 3FXDA 1RE3C 3NXSA 2N9YB 1K05A 3P7KA 5E79H 2FKWB 2B89A 4L73A 2QJKB 1Q81Q 3H1JE 1GL2C 2FFDB 1Y6UA 1GW4A 1NTKD 1JY3N 2O1KA 1VQ9P 3CC4P 3U59A 3CX5D 1KYOI 2ITAA 3LURA 2R32A 5KATA 3BATA 1RY3A 1VPCA 1ZV8A 3USSA 5I44A 3FXEA 2OG0A 1LP1B 4DZOA 3LW5H 4WWIA 1VQMP 1JEKA 2R3SA 5AVWB 2A06D 2JJLA 3EQ2A 1SQBG 4IFDK 4I7ZB 2IX7C 1TU3F 1VQOP 1GMJA 4A1MA 1RF1C 1FU1A 1CI6B 3VP8A 3WU2E 2OARA 2G3AA 2B87B 1UIIA 1HWTC 2E43A 4O9BA 1SQXG 1NU1G 1X79B 3CCRP 1BCCE 2PGDA 3CWBJ 2AXCA 5CCGD 2A45I 1OZHA 1L0NJ 1QGKB 2OTJP 4QMAA 1FZCB 2AEFA 3GHGA 1OFCX 1SFCA 1VQ4P 4C7RA 1W5CE 1NO4A 2SPZA 5K5GB 1EDKA 3A0BH 3L73D 1LTBC 1BE3J 2XDJA 1EDLA 1SVFA 2KOGA 5GQQA 2E74B 2OQQA 2H7HA 3Q5PA 5KLVJ 3LIEA 1NGMB 3HUSC 3MP7B 5APSA 5AW1B 5APXA 1L4AC 3CL3D 4RKUJ 3H1HD 5BVZA 1SQXE 5APTA 2FYUG 1GDTA 1FOSF 5AVVB 2V7QJ 1SQQJ 2DG6A 2KUBA 2UWJE 1IFIA 1KMIZ 1GU5A 3TGUE 2HODA 3JSVC 3WU2H 3B8EB 3P32A 2BCCD 1Q07A 1EZVI 1KB9H 2K9YA 3II6A 3O8ZA 3CCLP 4H0LC 3H1HG 1M7LA 1S5LE 3L74D 3H6PA 2N1TC 5KAWA 4OVNF 3V2PA 1CZQA 1URQD 3QWOC 3L70J 3A2AA 1KQSO 2JP3A 3MGNA 1PZQA 1SQVJ 2KSJA 3CCEP 4HKZH 1BE3E 4IL6H 4IFFA 4PJ0E 4DOJA 1ZRTE 2ZXEB 1HGVA 3L70D 2KS1A 1SQBK 3L72E 1EQ7A 1LWUA 3N7NA 3AE7C 3Q1MA 1J1EB 4WY4A 3BRVB 1M57D 3HTKA 2E42A 1S4XA 1Q7YQ 3G71P 2ZYDA 2A06G 3RGUA 3KPEA 4AYZA 1J1DB 1L4AA 2AXTE 1LTSC 2YKOA 1NTKE 4WY4C 5AW4B 2FXPA 3CLQA 4PV1C 3V4QA 2R3CA 2KNCB 4GIFA 1ZP0C 2FXOA 1KFMA 1PP9G 2P7JA 2O3JA 3D70A 1SQVK 4D6TJ 1Q0AA 2YKPA 2IYPA 3O6QA 3H1KG 5H2FE 4C7NA 3JC22 2YIUC 1KN7A 2P1JA 1L2PA 3AEGC 1KYOH 4RESB 1N7LA 3FGAD 3GF7A 2KZJA 1U7JA 5KLVD 1FZBA 1VF5D 3MZWB 5AVZB 2QJKC 2MJZA 2O1JA 3IAOA 1BSHA 3HE5B 1HTLC 1JM0A 4LLHA 2W6JH 3G6EP 1NOHA 1JY3P 1JTHB 1FDOA 3S4RA 3H1JG 3PRJA 1OMIA 2FYUK 4U3FG 3CX5H 4D6TD 1GU4A 4EIJA 1QVGO 2PP6A 1PGJA 3GPVA 1SQPJ 2Y0CA 1MUUA 3B5NC 3H1KE 2J5UA 1ZRTD 3C9IA 3U1AA 5B5EH 2Q7CA 2ZJSE 4ASWA 1Q2NA 5KAXA 2OYHC 2Q1KA 3AE5C 1RF1B 1BE3G 1NWQA 1K8AQ 1ZLLA 3A0BE 4JYBA 2K9JB 3UIAA 1T2KC 1DEBA 2KIKA 2OTKE 4I7ZC 3B5NA 2WTYA 1PP9J 1W2BO 1S72P 2BCCG 3EZ7A 1NYHA 1Y8AA 1Y9BA 2IFNA 4UB6H 4JBZA 2NZ2A 1ZR4A 1N73B 2QEXP 1KILD 1YHQP 1PGQA 1GL2A 3AEBC 4N78E 4JYCA 4YTPC 4N78D 1S5LH 1H0TB 5KAIH 1EZVG 3M9BA 2BOWA 5KLVK 2FYUE 2OYIA 3V6IA 1G2CB 1EZVD 4GDOA 1PV3A 1Y47A 4EYYQ 1ZW0A 1YIJP 3H1IG 4EDFA 5D8CA 1GL2D 1K04A 2IBZE 2ZT9D 3M9QA 4ZKUA 5L8RJ 1P84H 5AVTB 1YTZT 3CWBE 1LTJA 4XA4A 1SQPG 1JOCA 2ZVNB 2C9NY 2R5BA 2O01J 3V4WA 5CCHA 2HLOA 2ZHGA 1Q08A 2WSSH 3K5BA 4H13B 2YMKA 2WPSA 1YQ4C 1AVOA 2JO1A 4BRYA 1LT9A 2AXTH 2I1JA 1URQB 1T2KD 3I5CA 2L5GB 3A0HH 3S9OA 4AQRD 3D6YA 3AECC 3R4YA 1YJWP 1MFTA 2W6BA 5TJHA 1GK4A 4H0LD 1LX8A 3AEEC 3PTZA 3TK1A 2C0XA 2W83C 2I1KA 2FYUJ 1E79H 3CCVP 3MHVA 2D2CD 3GMAA 4NPFX 1FAVA 2WSFH 1BGYG 3H32A 1SQBE 5B66H 1FC2C 3HRNA 2A06E 1BOWA 2WPRA 3PH0A 2PRRA 2XKMA 1IFMA 4R4EA 3E0HA 2Q3IA 3CX5I 3T97B 3CCMP 2CPSA 4GKGA 1T6AA 4PD4E 1IFJA 1KTMA 4UB8E 4IFMA 3HD7B 1NTMD 1HGZA 1KILA 1FZCA 1MV8A 3GHGB 5AW6B 1AJYA 1A02F 1T3UA 2E76C 3L71J 3BCCE 3BRTB 1YQ3C 2JMLA 3TNUB 3L74J 3GHGC 1JYHA 2M0BA 2W90A 5KKZC 4DJGA 1J1DC 4TLFA 5B66E 4A7PA 1SQVG 3B71A 2KCUA 1JY2N 3HH0A 1GW3A 4WY4D 1EC5A 3V2NA 1VF5B 5AW5B 4WVZA 5CBOA 5CCHC 1NVOA 2NPSA 3CCQP 1GK6A 2I8DA 5KAFH 2WPQA 1X22A 3L75E 2NPSD 1KB9I 2YIUB 1BCCD 3TSIA 1AVYA 1SP4A 2RN0A 1HJBA 1Q82Q 5APQA 2AEMA
chains in the Genus database with same CATH topology
4R4LA 1DD3A 1BOWA 3EZFA 4GDOA 1PV3A 1U57A 1Y6UA 1VF5D 4OGQC 5KLIC 5I41B 2E76D 4IL6X 4R4EA 3E0HA 3T97B 3GLMA 2QJKC 2JP3A 3ABVC 4H44C 4Y28J 2BEZF 5D8CA 1OW6A 4WLSA 2BEQD 3IAOA 2IEFA 1K04A 5GQQA 1RQUA 2E75B 3AE8C 1KTMA 2ZT9D 2E74B 3LURA 4PV1B 2OQQA 3QAOA 3EZ6A 3AEDC 2WSFJ 5KATA 1RQVA 1ZRTE 5L8RJ 1S5LX 3AEAC 5D90A 1KQGB 2H89C 3Q5PA 1FDOA 4U7JA 1AJYA 1EXJA 2E74C 4LHFA 4R24B 1KORA 3AEFC 1OMIA 5I44A 2E76C 2FBWC 3C8VA 4AYZB 5E01A 2QSIA 1YQ3C 3AE4C 2JMLA 2OG0A 1NGMB 3AE7C 3AE2C 2VZ4A 2O01J 5KAUA 4R22B 3UCSA 3GPVA 3Q1MA 4H13C 4Z1MH 4OGQB 3D71A 1HJ0A 1EXIA 4B0YA 3EZ9A 2ZHGA 1UIXA 1JYHA 4H44B 3Q5SA 2D2CC 1PM6A 3AE3C 5KKZC 1Q08A 4RKUJ 3SFEC 4H0LB 2QIWA 4H13B 2YMKA 4XFJA 2J5UA 2HVAA 5KAVA 2IDBA 3R8JA 2KVVA 1YQ4C 1S1CX 2WSEJ 2JO1A 1R8DA 2D2CB 4I7ZB 3IN6A 3B71A 5KAXA 2KCUA 3AE5C 5KCBA 1Q05A 1TU3F 2QJPC 4YXDC 4AYZA 1HF9A 2H88C 3HH0A 3B49A 2V7QJ 1VL2A 2WQYC 1JB0J 2DG6A 3GP4A 3Q5RA 1GMJA 2E74D 1DD4A 2FXPA 1KMIZ 2ZT9B 4I7ZC 4PV1D 3AE1C 3S9OA 4A1MA 4PV1C 3D6YA 1VF5B 3GF3A 4DCZA 2QJYC 5M1BA 4WLWA 3EZ7A 1Q90D 1NYHA 2WPVB 1WMKA 1Y9BA 3AECC 1IK7A 1OW7A 2NZ2A 3AE6C 1RH6A 3R4YA 1ZP0C 1KQFB 2E76B 4H44D 3G9RA 4J2NA 3D6ZA 1Q07A 4H0LD 3Q2YA 3Q3DA 1VF5C 4OGQD 3LW5J 3R8KA 3D70A 1Q06A 1ZOYC 2G3AA 2E75D 1PL5A 1Q0AA 1LX8A 1D5YA 2G8YA 3AEEC 1DIPA 3O6QA 2K9YA 3AEBC 1FDIA 2E75C 3RK3E 3GK6A 2ZHHA 3SFDC 3EWKA 4H13D 1PIXA 2ZT9C 4YTPC 1MKMA 4H0LC 2YIUC 3EZ2A 1R8EA 4R4MA 3H25A 1KILE 4TT3H 2GOVA 2FYNC 1OW8A 1K05A 3AEGC 2D2CD 3GMAA 3AE9C 2BOWA 2MKVA 1Q09A 5KAWA 3FGAD 1ZMEC 3RL0g 1JBGA 2P10A 4KT0J 3GF7A 2WSCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4L A;  4R24 B;  5KAX A;  1BOW A;  3D6Z A;  1Q07 A;  5I44 A;  2KCU A;  3Q2Y A;  3Q3D A;  5KCB A;  1Q05 A;  4AYZ A;  4AYZ B;  3R8K A;  3D70 A;  1Q06 A;  1D5Y A;  5E01 A;  1Q0A A;  3B49 A;  3HH0 A;  2JML A;  1DIP A;  5I41 B;  4R4E A;  3E0H A;  3T97 B;  2VZ4 A;  2DG6 A;  3GP4 A;  4R22 B;  3UCS A;  3GPV A;  3Q1M A;  3Q5R A;  5KAU A;  3GK6 A;  2ZHH A;  3D71 A;  4A1M A;  5D8C A;  1EXI A;  4B0Y A;  2ZHG A;  3D6Y A;  4WLS A;  1JYH A;  3IAO A;  5GQQ A;  1R8E A;  3Q5S A;  4R4M A;  2GOV A;  4WLW A;  3LUR A;  1Q08 A;  3QAO A;  2OQQ A;  5KAT A;  2BOW A;  2J5U A;  2HVA A;  5KAV A;  1Q09 A;  5KAW A;  3R8J A;  1JBG A;  5D90 A;  3Q5P A;  3G9R A;  1R8D A;  1EXJ A;  4J2N A; 
#chains in the Genus database with same CATH topology
 3ITK A;  1LP1 A;  4PJ0 H;  5AW0 B;  1NKZ B;  1KQL A;  1LNQ A;  4HYT B;  1JCC A;  4UB6 E;  4GOF A;  2N1T D;  4BXL A;  3B4S A;  2H89 C;  4U7J A;  1NKN A;  1KB9 E;  3AE2 C;  1X9V A;  1L0L K;  4Z1M H;  4OGQ B;  3D71 A;  4B0Y A;  1NH4 A;  3P8M C;  5KAI E;  1G1I A;  2ZYG A;  2IDB A;  3V2Q A;  1SQP K;  2Y0E A;  3CC2 P;  4ASV A;  2QJP C;  3WUU A;  3KYQ A;  2B87 A;  1NTZ E;  2KSE A;  1SQQ K;  3TGU D;  3GP4 A;  2Y9Z A;  4PV1 D;  2PAJ A;  1WMK A;  2RKL A;  3HTK B;  3KZI H;  2FYZ A;  1FZA A;  5AVQ B;  1MFZ A;  3CWB G;  1SFC B;  2QM7 A;  3NMD A;  1AV1 A;  3Q2Y A;  3Q3D A;  1GTW A;  1RE4 C;  1HBW A;  4JF7 A;  2PFX A;  4ZKP A;  3H1I E;  2HR3 A;  2YMY A;  2HFE D;  2IBZ G;  2IFM A;  3BAS A;  3RK3 B;  2MKV A;  1EDI A;  4GT1 A;  3L37 A;  4PD4 I;  4R4L A;  2ZVO B;  1YIT P;  3O6Q B;  1ZR2 A;  2FYN B;  3A0H E;  4W7Z A;  1H89 A;  4CPG A;  1YJN P;  1NTM J;  1USD A;  4C7N B;  3L72 D;  2IEF A;  1RQU A;  2E75 B;  2KK7 A;  3E1I A;  2LXC B;  3H1J D;  1M1K Q;  5CCH D;  1HH0 A;  2WSF J;  1XTC C;  4GOE A;  2N9B A;  4LHF A;  2JKV A;  3RL0 B;  1NTZ K;  3WUV A;  4EOT A;  1KC8 Q;  3M9H A;  1NTK K;  1VQK P;  5E01 A;  3AE4 C;  3FWN A;  2V4H A;  4HB1 A;  4H13 C;  3F5H A;  3G3Z A;  3HE5 A;  2XV5 A;  1BGY J;  2RMZ A;  3HUS A;  4H0L B;  2QIW A;  1KZU B;  4C46 A;  5KTB A;  3BVH A;  2Q3E A;  1FOS E;  2M5A A;  4YXD C;  1VL2 A;  2XU6 A;  1VQ5 P;  4KJM A;  4PD4 H;  3MIW A;  4OH8 B;  2H8P D;  1NHL A;  5CBN A;  2WPV B;  1BSN A;  3KZI E;  3G9R A;  3IR9 A;  5C39 A;  1VQ7 P;  3L74 E;  1YBK A;  1JMB A;  3H1K J;  1D5Y A;  3H1I D;  1JY3 O;  3GK6 A;  5APU A;  2GUV A;  2LR2 A;  1QVF O;  1K9M Q;  3CCU P;  3CI9 A;  3RBZ A;  1QLE D;  2C9L Y;  2QRX A;  1BE3 D;  2GUS A;  2N1T A;  1DH3 A;  1NTM K;  4WY4 B;  1OX3 A;  4N3Y B;  1H0T A;  4N6J A;  4DCK A;  1P84 D;  3AEA C;  5D90 A;  1G2C A;  1W2E A;  3CCJ P;  1BCC J;  2GM4 A;  4AYZ B;  2HPC B;  4Y99 C;  1OWA A;  4BWN A;  4ZNC A;  1FJK A;  4AYC A;  1JY2 O;  5KJ7 A;  2O01 H;  1CW5 A;  2W27 A;  3H1L J;  3GG2 A;  3VP9 A;  2HVA A;  1SFC C;  3L4F A;  1LTG C;  5KKZ B;  2Z4E A;  3TYY A;  1DEE G;  3RK2 C;  2NPS C;  4LGD E;  3SSU A;  1PP9 E;  2CK3 H;  1USE A;  3RL0 D;  5AVS B;  1VQ6 P;  1PP9 D;  2XND H;  4WLW A;  1JY2 P;  1IJD B;  1IK9 A;  1URQ C;  2QJY B;  4BRY B;  1PL5 A;  1FDI A;  1KB9 D;  2E75 C;  3QH9 A;  3RK3 E;  1GZL A;  3SFD C;  1PIX A;  5APW A;  3JCU E;  2BCC E;  4R4M A;  3H25 A;  2FYN C;  5DJU B;  1L4A D;  3RL0 g;  4RJT A;  5APY A;  3VMY A;  1JTH A;  1NTK J;  1NTZ G;  2E76 D;  3ABV C;  1ZXG A;  2J58 A;  3NTN A;  1NU1 J;  4OWF A;  2JDI H;  2R5D A;  3EZ6 A;  2LXB A;  2FYU D;  1FZG A;  1FZE A;  1D7M A;  2FBW C;  2JEE A;  3C8V A;  3H1I J;  1H8A A;  3VMX A;  1IC2 A;  1HVV A;  3E7K A;  3M06 A;  1VQL P;  1OVR A;  2ZYA A;  3MUD C;  4HH2 A;  1UIX A;  1L0L D;  2JR8 A;  2D2C C;  1KIL B;  3SFE C;  3A7O A;  4D6T E;  2XZR A;  1VQN P;  2KVV A;  1IO4 A;  1N73 A;  2QG4 A;  3CD6 P;  2B88 A;  1OIP A;  1PGO A;  5AW2 B;  3B49 A;  1GL2 B;  3FWL A;  4D6T G;  3TNU A;  2K37 A;  2OYH A;  3AE1 C;  2Q5U A;  1Z56 A;  4WBA A;  3P8C E;  4MN4 C;  3AE6 C;  1JUN A;  1BGY E;  3W67 A;  1LWU C;  2HYN A;  3W68 A;  1SQX J;  5GTH E;  1VF5 C;  1P84 I;  4HJG H;  1R5S A;  1LT9 C;  2AEJ A;  3RK3 C;  2WT7 B;  1WRG A;  1KIL E;  3HE4 A;  3SWY A;  3L72 J;  1NTK G;  2M8R A;  1AA0 A;  4IOI H;  3L71 D;  2WSC J;  1LTJ B;  3CCS P;  3EZF A;  2C0W A;  1U57 A;  1R5L A;  3RK2 D;  1OW6 A;  3AE8 C;  1QL2 A;  4Y99 B;  1QX8 A;  1SQB D;  1BDC A;  1S5L X;  1KD1 Q;  1JO5 A;  1N7S D;  1KOR A;  2WSE H;  3EFG A;  1LT9 B;  5GTI H;  3L70 G;  3TDK A;  3A5T A;  3UCS A;  5E79 E;  4U3F J;  1NU1 K;  1PM6 A;  3CPW O;  5DJT B;  2POH A;  3L71 G;  2KP8 A;  2P58 A;  3IN6 A;  1NTM G;  3TGU J;  1Q05 A;  1FBM A;  5CMZ A;  2V7Q H;  4L74 A;  2WQY C;  1JB0 J;  3HD7 D;  1DD4 A;  4DT0 A;  1RE4 A;  1T3J A;  1U7M A;  4K35 A;  1FJP A;  1SQQ D;  1RH6 A;  3H32 B;  1H88 A;  1SQV E;  1SQP D;  4OGQ D;  3CXH I;  2KXP B;  3KQG A;  3I56 P;  3SWK A;  3T97 A;  2QJP B;  3H1H J;  4RO0 A;  5B5E E;  2ZT9 C;  1R8E A;  3HD7 A;  1L0L G;  1OW8 A;  1OVU A;  1PGP A;  5AW8 B;  1IFD A;  1CI6 A;  1S9K D;  3OW2 O;  2QA4 P;  3L75 G;  2DW3 A;  1AQ5 A;  1S3J A;  5I41 B;  3GLM A;  4Y28 J;  1FZC C;  1N86 A;  2YO3 A;  3VTP C;  4WLS A;  2BEQ D;  1NTZ D;  1QL1 A;  2K1A A;  4B86 A;  1J2J B;  1KQG B;  4R24 B;  3H1H E;  5KAF E;  3MTU E;  3G4S P;  3VMZ A;  5KAU A;  1L0N D;  1X8Y A;  1BCC G;  4GOD A;  2P67 A;  3RK3 D;  1M90 Q;  3CWB D;  1M56 D;  4U3F E;  3AE3 C;  1M1J A;  2NPS B;  5EFW B;  3IF4 A;  3SWF A;  3M0D C;  5AVR B;  3VMA A;  5TIS H;  1R8D A;  1RE3 A;  3OA7 A;  3L35 A;  1EDJ A;  3I55 P;  3RL0 C;  4L75 A;  1N7S B;  1M8O B;  3IFM A;  5M1B A;  3PJS K;  1IK7 A;  1OW7 A;  3L70 E;  2XNX A;  2E76 B;  5AVY B;  4U3F D;  1JMM A;  1PPJ G;  4EI2 A;  3LW5 J;  4JPZ B;  2FFD A;  1YYC A;  3F89 A;  3CMA P;  2G8Y A;  1DIP A;  2J59 M;  1LTJ C;  2HOD B;  1T8Z A;  5KLV E;  1SQB J;  3EZ2 A;  1N2D C;  1J1E C;  4JQ0 D;  1PFI A;  1KYO E;  1SQV D;  1LTT C;  3M91 A;  4K3A A;  1SQQ G;  1OVV A;  2FY8 A;  2WWW A;  3HD7 C;  5AW7 B;  1SFC D;  3KXD A;  4H44 C;  3TGU G;  2BEZ F;  4IL6 E;  1NAY A;  2FXM A;  2WMM A;  1YTZ I;  4PD4 D;  2VZ4 A;  2H43 A;  4WB4 A;  2A45 H;  2Z5H A;  3WUT A;  1RF0 C;  5TIS E;  3Q5S A;  1N8R Q;  2WZ7 A;  2KB7 P;  4KHX A;  3R8J A;  4W7Y A;  1S1C X;  2WSE J;  1YI2 P;  2D2C B;  1LTA C;  3OAK A;  4L76 A;  4UB8 H;  2E5T A;  4YPC A;  2H88 C;  2K3R A;  2B9B A;  1L0N E;  2ZT9 B;  3NFQ A;  2JWD A;  3OJA B;  1FDM A;  1L0L J;  4H44 D;  3CXH D;  2LKM A;  1M1J C;  3VYI A;  3LID A;  2K88 A;  1MZ9 A;  2Q6Q A;  3V5B A;  2ZXX A;  3L75 D;  2M3E A;  2KNC A;  3AE9 C;  5AW9 B;  2FFD C;  1Q09 A;  3M0A A;  1NU1 D;  2Y0D A;  2KZI A;  1JBG A;  2P10 A;  5APV A;  1IFN A;  2BAS A;  1WT6 A;  2IBZ D;  1L0L E;  1KFN A;  4IL6 X;  5AVU B;  2IBZ I;  2CPB A;  3H1J J;  3HUS B;  3FX0 A;  1QEX A;  3CXH H;  4M3L A;  2M5A B;  2E5Y A;  1VQP P;  2NRG A;  2R44 A;  1SS1 A;  2IYO A;  3H1L G;  3L73 E;  3R2P A;  2HG5 D;  2YXQ B;  4XFJ A;  5KAV A;  1RHZ B;  2KI7 B;  1KV4 A;  1IZN B;  3CME P;  5CJ4 A;  1SQX D;  1L0N K;  1HF9 A;  3Q5R A;  1LT1 A;  2OYO A;  2Q9I A;  3E1R A;  4DCZ A;  3L74 G;  1K73 Q;  3RBX A;  3CXH E;  3U1C A;  1KQF B;  3MUD A;  3D6Z A;  1RF1 A;  2N1T B;  3R8K A;  1Q06 A;  2E75 D;  1YJ9 P;  1NJI Q;  1JCD A;  2KLU A;  3PHL A;  2ZHH A;  4H13 D;  3B5N B;  5GTH H;  1N7S C;  4W80 A;  1NTZ J;  1ZME C;  4AUW A;  4KT0 J;  3WMM 0;  2KS1 B;  1NAF A;  1DD3 A;  1NTM E;  1LWU B;  3KHU A;  2HPC A;  2ZFC A;  4OGQ C;  5KLI C;  1Q86 Q;  2OYI C;  2P2U A;  3N4X A;  1RH5 B;  5CCG C;  2WT7 A;  3ZDM A;  2WSC H;  1LTI C;  4PV1 B;  1ZN5 A;  3QAO A;  2WVR A;  1FE6 A;  1CSB A;  3A3Y B;  5AVX B;  3L73 J;  2RH0 A;  2OYI B;  1PPJ E;  1EXJ A;  2E74 C;  2IZ1 A;  3P8C D;  3AEF C;  1L4A B;  2QSI A;  5CCG A;  3KDP B;  3EZ9 A;  2O01 N;  4H44 B;  1SQP E;  1E5W A;  2M3B A;  4YXW H;  2YKQ A;  4I6M C;  2L91 A;  3PP5 A;  1KYO D;  5KJ7 D;  5KLI B;  3S1K A;  2IPP A;  2KLV A;  1S2E A;  2E74 D;  3CC7 P;  1JNM A;  1IFP A;  3GF3 A;  1VQ8 P;  4I1L A;  2W8Z A;  3BCC G;  1Q90 D;  1BGY D;  4NPE A;  3EFF K;  5AW3 B;  2YO2 A;  1P84 E;  3TF5 A;  2A45 G;  2Z5I A;  4J2N A;  2KYV A;  2WIT A;  3L73 G;  1HUC A;  1ZOY C;  2JWA A;  2Y9Y A;  1URQ A;  2QM8 A;  5H2F H;  3H1L D;  1AQT A;  3V2R A;  1G1J A;  2GOV A;  4TT3 H;  3PLN A;  3C1L A;  3L71 E;  1A02 J;  3BCC J;  5CJ0 A;  5BU5 A;  3L36 A;  1S9K E;  2IZ0 A;  1RF0 A;  4LC1 A;  1L0N G;  1XTG B;  2YXR B;  2OTL P;  5KLV G;  3BCC D;  1FS0 E;  2YNY A;  3AED C;  1RQV A;  1VDF A;  3B5N D;  2ZAE B;  1KIL C;  1SQQ E;  5CHX A;  4I2L C;  2K9J A;  2BCC J;  4R22 B;  3L75 J;  2OYH B;  1X0T A;  1HJ0 A;  1EXI A;  1FZF A;  5BU8 B;  1N73 C;  1EZV E;  3RK2 B;  1NU1 E;  1PPJ D;  3H1K D;  2QE7 H;  5KCB A;  1BDD A;  2QVA A;  2OGU A;  2W6A A;  3GW6 A;  4ZMD A;  1GD2 E;  2QJY C;  4XE5 B;  4NPD A;  3VN0 A;  1LGH B;  3HE4 B;  1M1J B;  1DX7 A;  3MD0 A;  3VOP A;  2GA1 A;  1SLQ A;  1LJ2 A;  1SQX K;  1OXZ A;  3L72 G;  3CX5 E;  5GTI E;  2VRS A;  3H1L E;  1N7S A;  5KJ7 C;  1AFO A;  3EWK A;  3JCU H;  3M0D A;  1MKM A;  3FXD A;  1RE3 C;  3NXS A;  2N9Y B;  1K05 A;  3P7K A;  5E79 H;  2FKW B;  2B89 A;  4L73 A;  2QJK B;  1Q81 Q;  3H1J E;  1GL2 C;  2FFD B;  1Y6U A;  1GW4 A;  1NTK D;  1JY3 N;  2O1K A;  1VQ9 P;  3CC4 P;  3U59 A;  3CX5 D;  1KYO I;  2ITA A;  3LUR A;  2R32 A;  5KAT A;  3BAT A;  1RY3 A;  1VPC A;  1ZV8 A;  3USS A;  5I44 A;  3FXE A;  2OG0 A;  1LP1 B;  4DZO A;  3LW5 H;  4WWI A;  1VQM P;  1JEK A;  2R3S A;  5AVW B;  2A06 D;  2JJL A;  3EQ2 A;  1SQB G;  4IFD K;  4I7Z B;  2IX7 C;  1TU3 F;  1VQO P;  1GMJ A;  4A1M A;  1RF1 C;  1FU1 A;  1CI6 B;  3VP8 A;  3WU2 E;  2OAR A;  2G3A A;  2B87 B;  1UII A;  1HWT C;  2E43 A;  4O9B A;  1SQX G;  1NU1 G;  1X79 B;  3CCR P;  1BCC E;  2PGD A;  3CWB J;  2AXC A;  5CCG D;  2A45 I;  1OZH A;  1L0N J;  1QGK B;  2OTJ P;  4QMA A;  1FZC B;  2AEF A;  3GHG A;  1OFC X;  1SFC A;  1VQ4 P;  4C7R A;  1W5C E;  1NO4 A;  2SPZ A;  5K5G B;  1EDK A;  3A0B H;  3L73 D;  1LTB C;  1BE3 J;  2XDJ A;  1EDL A;  1SVF A;  2KOG A;  5GQQ A;  2E74 B;  2OQQ A;  2H7H A;  3Q5P A;  5KLV J;  3LIE A;  1NGM B;  3HUS C;  3MP7 B;  5APS A;  5AW1 B;  5APX A;  1L4A C;  3CL3 D;  4RKU J;  3H1H D;  5BVZ A;  1SQX E;  5APT A;  2FYU G;  1GDT A;  1FOS F;  5AVV B;  2V7Q J;  1SQQ J;  2DG6 A;  2KUB A;  2UWJ E;  1IFI A;  1KMI Z;  1GU5 A;  3TGU E;  2HOD A;  3JSV C;  3WU2 H;  3B8E B;  3P32 A;  2BCC D;  1Q07 A;  1EZV I;  1KB9 H;  2K9Y A;  3II6 A;  3O8Z A;  3CCL P;  4H0L C;  3H1H G;  1M7L A;  1S5L E;  3L74 D;  3H6P A;  2N1T C;  5KAW A;  4OVN F;  3V2P A;  1CZQ A;  1URQ D;  3QWO C;  3L70 J;  3A2A A;  1KQS O;  2JP3 A;  3MGN A;  1PZQ A;  1SQV J;  2KSJ A;  3CCE P;  4HKZ H;  1BE3 E;  4IL6 H;  4IFF A;  4PJ0 E;  4DOJ A;  1ZRT E;  2ZXE B;  1HGV A;  3L70 D;  2KS1 A;  1SQB K;  3L72 E;  1EQ7 A;  1LWU A;  3N7N A;  3AE7 C;  3Q1M A;  1J1E B;  4WY4 A;  3BRV B;  1M57 D;  3HTK A;  2E42 A;  1S4X A;  1Q7Y Q;  3G71 P;  2ZYD A;  2A06 G;  3RGU A;  3KPE A;  4AYZ A;  1J1D B;  1L4A A;  2AXT E;  1LTS C;  2YKO A;  1NTK E;  4WY4 C;  5AW4 B;  2FXP A;  3CLQ A;  4PV1 C;  3V4Q A;  2R3C A;  2KNC B;  4GIF A;  1ZP0 C;  2FXO A;  1KFM A;  1PP9 G;  2P7J A;  2O3J A;  3D70 A;  1SQV K;  4D6T J;  1Q0A A;  2YKP A;  2IYP A;  3O6Q A;  3H1K G;  5H2F E;  4C7N A;  3JC2 2;  2YIU C;  1KN7 A;  2P1J A;  1L2P A;  3AEG C;  1KYO H;  4RES B;  1N7L A;  3FGA D;  3GF7 A;  2KZJ A;  1U7J A;  5KLV D;  1FZB A;  1VF5 D;  3MZW B;  5AVZ B;  2QJK C;  2MJZ A;  2O1J A;  3IAO A;  1BSH A;  3HE5 B;  1HTL C;  1JM0 A;  4LLH A;  2W6J H;  3G6E P;  1NOH A;  1JY3 P;  1JTH B;  1FDO A;  3S4R A;  3H1J G;  3PRJ A;  1OMI A;  2FYU K;  4U3F G;  3CX5 H;  4D6T D;  1GU4 A;  4EIJ A;  1QVG O;  2PP6 A;  1PGJ A;  3GPV A;  1SQP J;  2Y0C A;  1MUU A;  3B5N C;  3H1K E;  2J5U A;  1ZRT D;  3C9I A;  3U1A A;  5B5E H;  2Q7C A;  2ZJS E;  4ASW A;  1Q2N A;  5KAX A;  2OYH C;  2Q1K A;  3AE5 C;  1RF1 B;  1BE3 G;  1NWQ A;  1K8A Q;  1ZLL A;  3A0B E;  4JYB A;  2K9J B;  3UIA A;  1T2K C;  1DEB A;  2KIK A;  2OTK E;  4I7Z C;  3B5N A;  2WTY A;  1PP9 J;  1W2B O;  1S72 P;  2BCC G;  3EZ7 A;  1NYH A;  1Y8A A;  1Y9B A;  2IFN A;  4UB6 H;  4JBZ A;  2NZ2 A;  1ZR4 A;  1N73 B;  2QEX P;  1KIL D;  1YHQ P;  1PGQ A;  1GL2 A;  3AEB C;  4N78 E;  4JYC A;  4YTP C;  4N78 D;  1S5L H;  1H0T B;  5KAI H;  1EZV G;  3M9B A;  2BOW A;  5KLV K;  2FYU E;  2OYI A;  3V6I A;  1G2C B;  1EZV D;  4GDO A;  1PV3 A;  1Y47 A;  4EYY Q;  1ZW0 A;  1YIJ P;  3H1I G;  4EDF A;  5D8C A;  1GL2 D;  1K04 A;  2IBZ E;  2ZT9 D;  3M9Q A;  4ZKU A;  5L8R J;  1P84 H;  5AVT B;  1YTZ T;  3CWB E;  1LTJ A;  4XA4 A;  1SQP G;  1JOC A;  2ZVN B;  2C9N Y;  2R5B A;  2O01 J;  3V4W A;  5CCH A;  2HLO A;  2ZHG A;  1Q08 A;  2WSS H;  3K5B A;  4H13 B;  2YMK A;  2WPS A;  1YQ4 C;  1AVO A;  2JO1 A;  4BRY A;  1LT9 A;  2AXT H;  2I1J A;  1URQ B;  1T2K D;  3I5C A;  2L5G B;  3A0H H;  3S9O A;  4AQR D;  3D6Y A;  3AEC C;  3R4Y A;  1YJW P;  1MFT A;  2W6B A;  5TJH A;  1GK4 A;  4H0L D;  1LX8 A;  3AEE C;  3PTZ A;  3TK1 A;  2C0X A;  2W83 C;  2I1K A;  2FYU J;  1E79 H;  3CCV P;  3MHV A;  2D2C D;  3GMA A;  4NPF X;  1FAV A;  2WSF H;  1BGY G;  3H32 A;  1SQB E;  5B66 H;  1FC2 C;  3HRN A;  2A06 E;  1BOW A;  2WPR A;  3PH0 A;  2PRR A;  2XKM A;  1IFM A;  4R4E A;  3E0H A;  2Q3I A;  3CX5 I;  3T97 B;  3CCM P;  2CPS A;  4GKG A;  1T6A A;  4PD4 E;  1IFJ A;  1KTM A;  4UB8 E;  4IFM A;  3HD7 B;  1NTM D;  1HGZ A;  1KIL A;  1FZC A;  1MV8 A;  3GHG B;  5AW6 B;  1AJY A;  1A02 F;  1T3U A;  2E76 C;  3L71 J;  3BCC E;  3BRT B;  1YQ3 C;  2JML A;  3TNU B;  3L74 J;  3GHG C;  1JYH A;  2M0B A;  2W90 A;  5KKZ C;  4DJG A;  1J1D C;  4TLF A;  5B66 E;  4A7P A;  1SQV G;  3B71 A;  2KCU A;  1JY2 N;  3HH0 A;  1GW3 A;  4WY4 D;  1EC5 A;  3V2N A;  1VF5 B;  5AW5 B;  4WVZ A;  5CBO A;  5CCH C;  1NVO A;  2NPS A;  3CCQ P;  1GK6 A;  2I8D A;  5KAF H;  2WPQ A;  1X22 A;  3L75 E;  2NPS D;  1KB9 I;  2YIU B;  1BCC D;  3TSI A;  1AVY A;  1SP4 A;  2RN0 A;  1HJB A;  1Q82 Q;  5APQ A;  2AEM A; 
#chains in the Genus database with same CATH homology
 4R4L A;  1DD3 A;  1BOW A;  3EZF A;  4GDO A;  1PV3 A;  1U57 A;  1Y6U A;  1VF5 D;  4OGQ C;  5KLI C;  5I41 B;  2E76 D;  4IL6 X;  4R4E A;  3E0H A;  3T97 B;  3GLM A;  2QJK C;  2JP3 A;  3ABV C;  4H44 C;  4Y28 J;  2BEZ F;  5D8C A;  1OW6 A;  4WLS A;  2BEQ D;  3IAO A;  2IEF A;  1K04 A;  5GQQ A;  1RQU A;  2E75 B;  3AE8 C;  1KTM A;  2ZT9 D;  2E74 B;  3LUR A;  4PV1 B;  2OQQ A;  3QAO A;  3EZ6 A;  3AED C;  2WSF J;  5KAT A;  1RQV A;  1ZRT E;  5L8R J;  1S5L X;  3AEA C;  5D90 A;  1KQG B;  2H89 C;  3Q5P A;  1FDO A;  4U7J A;  1AJY A;  1EXJ A;  2E74 C;  4LHF A;  4R24 B;  1KOR A;  3AEF C;  1OMI A;  5I44 A;  2E76 C;  2FBW C;  3C8V A;  4AYZ B;  5E01 A;  2QSI A;  1YQ3 C;  3AE4 C;  2JML A;  2OG0 A;  1NGM B;  3AE7 C;  3AE2 C;  2VZ4 A;  2O01 J;  5KAU A;  4R22 B;  3UCS A;  3GPV A;  3Q1M A;  4H13 C;  4Z1M H;  4OGQ B;  3D71 A;  1HJ0 A;  1EXI A;  4B0Y A;  3EZ9 A;  2ZHG A;  1UIX A;  1JYH A;  4H44 B;  3Q5S A;  2D2C C;  1PM6 A;  3AE3 C;  5KKZ C;  1Q08 A;  4RKU J;  3SFE C;  4H0L B;  2QIW A;  4H13 B;  2YMK A;  4XFJ A;  2J5U A;  2HVA A;  5KAV A;  2IDB A;  3R8J A;  2KVV A;  1YQ4 C;  1S1C X;  2WSE J;  2JO1 A;  1R8D A;  2D2C B;  4I7Z B;  3IN6 A;  3B71 A;  5KAX A;  2KCU A;  3AE5 C;  5KCB A;  1Q05 A;  1TU3 F;  2QJP C;  4YXD C;  4AYZ A;  1HF9 A;  2H88 C;  3HH0 A;  3B49 A;  2V7Q J;  1VL2 A;  2WQY C;  1JB0 J;  2DG6 A;  3GP4 A;  3Q5R A;  1GMJ A;  2E74 D;  1DD4 A;  2FXP A;  1KMI Z;  2ZT9 B;  4I7Z C;  4PV1 D;  3AE1 C;  3S9O A;  4A1M A;  4PV1 C;  3D6Y A;  1VF5 B;  3GF3 A;  4DCZ A;  2QJY C;  5M1B A;  4WLW A;  3EZ7 A;  1Q90 D;  1NYH A;  2WPV B;  1WMK A;  1Y9B A;  3AEC C;  1IK7 A;  1OW7 A;  2NZ2 A;  3AE6 C;  1RH6 A;  3R4Y A;  1ZP0 C;  1KQF B;  2E76 B;  4H44 D;  3G9R A;  4J2N A;  3D6Z A;  1Q07 A;  4H0L D;  3Q2Y A;  3Q3D A;  1VF5 C;  4OGQ D;  3LW5 J;  3R8K A;  3D70 A;  1Q06 A;  1ZOY C;  2G3A A;  2E75 D;  1PL5 A;  1Q0A A;  1LX8 A;  1D5Y A;  2G8Y A;  3AEE C;  1DIP A;  3O6Q A;  2K9Y A;  3AEB C;  1FDI A;  2E75 C;  3RK3 E;  3GK6 A;  2ZHH A;  3SFD C;  3EWK A;  4H13 D;  1PIX A;  2ZT9 C;  4YTP C;  1MKM A;  4H0L C;  2YIU C;  3EZ2 A;  1R8E A;  4R4M A;  3H25 A;  1KIL E;  4TT3 H;  2GOV A;  2FYN C;  1OW8 A;  1K05 A;  3AEG C;  2D2C D;  3GMA A;  3AE9 C;  2BOW A;  2MKV A;  1Q09 A;  5KAW A;  3FGA D;  1ZME C;  3RL0 g;  1JBG A;  2P10 A;  4KT0 J;  3GF7 A;  2WSC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...