3Q2YA

Crystal structure of bmrr bound to ethidium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q2yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q2yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q2yA03
5D8CA 4R24B 1R8EA 4R22B 3D71A 2J5UA 5E01A 3B49A 2DG6A 3GPVA 5KCBA 4B0YA 1JBGA 2VZ4A 3GP4A 3R8KA 4J2NA 2ZHGA 5KAUA 3Q2YA 1EXJA 3T97B 2HVAA 3R8JA 5I41B 5KAXA 1Q08A 3Q1MA 1R8DA 2KCUA 3G9RA 3D6ZA 3Q5PA 3D70A 5KAVA 5KATA 5I44A 2GOVA 5KAWA 4A1MA 1DIPA 3LURA 1D5YA 3Q3DA 2OQQA 1EXIA 3Q5RA 4WLSA 3IAOA 1Q06A 2JMLA 5D90A 4R4EA 3E0HA 3GK6A 5GQQA 4AYZA 2BOWA 4AYZB 3Q5SA 3D6YA 3HH0A 1Q09A 4R4LA 1Q07A 1Q0AA 3QAOA 3UCSA 1BOWA 1JYHA 2ZHHA 4WLWA 4R4MA 1Q05A
chains in the Genus database with same CATH superfamily
1LWUC 3CCJP 3L74D 2FYUK 4WB4A 4ZMDA 5KCBA 1E79H 2P58A 3MTUE 2SPZA 1J1EC 1Q7YQ 1H0TB 2FFDC 2KS1A 3JCUE 1SQPJ 1KD1Q 3S1KA 4LGDE 2FYUE 1BE3E 1HWTC 1EDIA 4L73A 3LIEA 2D2CC 3R2PA 1LTBC 2G8YA 2M5AA 1HJBA 1S9KD 2WPQA 4TLFA 3RK2B 3V2RA 1HF9A 2QM7A 3B8EB 3L72E 3H6PA 1T2KC 3Q5SA 1Q0AA 3BRTB 2O01H 2G3AA 2BCCJ 2YO3A 5AW6B 4L75A 4YXWH 3T97B 5CJ4A 3O6QA 1T2KD 3CX5I 2QIWA 1NTKK 2WQYC 2XKMA 1IFJA 1VQ4P 4PD4E 1GL2C 1CI6A 1GU5A 1NTKE 1JY2N 3L75J 1DH3A 1LTSC 2WMMA 5I44A 2Y0CA 1SFCC 1L4AB 5M1BA 4NPEA 1NU1D 1HUCA 2B87A 1OWAA 2OYHB 1S9KE 1XTCC 3FGAD 1N8RQ 1RQVA 3LW5H 1YTZT 1PZQA 1L0LJ 1FDMA 5CJ0A 2FYNB 2YXQB 4GOFA 3V2QA 3CCEP 5CBNA 1MFZA 3F89A 1HJ0A 3H1JJ 4I6MC 2BEZF 1SQBG 3WUTA 4D6TJ 1NTMG 1EQ7A 3M0AA 3AEAC 2NPSA 5E79H 3A5TA 1OX3A 1YITP 2P2UA 2Z4EA 2YXRB 5KATA 2E74D 3CXHH 1SQQG 1NU1K 1SQXG 3TNUA 5KJ7C 3E0HA 1UIXA 1AQTA 3D6YA 1CSBA 1M1JB 1OW7A 3M0DC 2YIUB 1NU1E 4A7PA 1VQ9P 3V4WA 3AE5C 1KILB 1ZP0C 2IPPA 3M9QA 1S5LE 4KT0J 5KLVD 1JB0J 1PV3A 2B9BA 3CCSP 3FWLA 4AQRD 2HPCB 3KZIE 1JY3P 5KAFE 2R3CA 1LP1A 1SS1A 2I1KA 3EZ2A 5B66H 1S1CX 3KDPB 3TGUG 4PV1C 1OIPA 5EFWB 3VMXA 3EQ2A 1KB9D 1LTTC 2IBZI 2KSEA 4Y99C 2QJKC 2HYNA 5AVXB 1JMBA 1J1EB 1ZW0A 4C7RA 1AJYA 2FYUJ 1BE3J 5CCHD 1WT6A 1VQ5P 1RF1B 3AEBC 4DCKA 2IZ1A 3WU2H 3ABVC 4OVNF 5KLVK 1URQA 2LXCB 2D2CB 2Q5UA 2KZIA 3A0HH 1JOCA 2GA1A 2ZAEB 5GTHE 5KLVE 3L72J 3S9OA 4I7ZB 1KYOH 3SFDC 2ZHGA 3H1IG 1T3JA 1SQBK 3WUUA 1XTGB 4YTPC 2JMLA 3KQGA 5TISE 3CCVP 3SSUA 2ZHHA 1FE6A 2OGUA 2XV5A 2N9YB 3PJSK 1BSHA 1KB9E 3V4QA 3HE4A 2OG0A 1M57D 3LIDA 1USDA 1NTKJ 4JYBA 2GOVA 2KUBA 1VQ8P 1VQNP 3HUSB 1LTJA 1M8OB 1DD4A 1W2BO 1HTLC 3FXEA 2IYPA 1M1KQ 2KI7B 1X0TA 2I8DA 1VF5C 1OVVA 3RL0g 5CCGA 3CMEP 1D5YA 2ZT9C 1SQPD 2BOWA 4WY4D 4XE5B 4OGQC 3P32A 2VZ4A 3H1LE 3CI9A 1FAVA 2ZT9D 1RE4A 3D6ZA 3MUDA 1IZNB 4W80A 3L75G 1N73C 1ZRTD 3VMYA 3CCLP 2W83C 2NPSC 1PFIA 3HTKB 2M3BA 1KTMA 5D8CA 1QVFO 2IBZG 3TSIA 1HGZA 4PD4H 4ZKUA 3M91A 2Q1KA 1PPJD 1N7SC 1R8DA 2KCUA 2I1JA 2WZ7A 1NU1J 2E42A 2IZ0A 2K9YA 4MN4C 1P84I 1YBKA 2ZYDA 1JTHB 3CXHD 1JYHA 1OVUA 2QJYB 1NTZG 5CMZA 5KAIE 1J1DC 3W68A 1KQLA 2R44A 4U3FG 1BCCD 1JCCA 3CLQA 4K35A 2KSJA 3CCUP 1OXZA 4PV1B 3L70E 3EWKA 3E1RA 1VQLP 1H8AA 1BGYD 3RK2C 3GPVA 4NPFX 4I2LC 1U57A 3MZWB 2OARA 3VP8A 2KS1B 1T8ZA 3A7OA 2PAJA 3NXSA 5GTIE 1JUNA 3RK2D 2A06E 2N1TD 3H1JD 4IL6X 1DEBA 1URQC 5E79E 2W90A 4JQ0D 4B0YA 3B5NC 4D6TD 3A0BH 5KLVJ 1IFDA 2M5AB 3HRNA 3CXHE 1CW5A 2FBWC 3WUVA 1S5LH 3NFQA 1Q90D 2WPSA 4H0LB 1BCCE 4EI2A 2LKMA 3BCCE 1FZCA 3VMZA 2FXMA 1L4AC 2K3RA 1EDJA 1KYOD 3H1HE 2JO1A 1BGYE 2C0WA 1VQKP 5D90A 1NKZB 1VQOP 2FYNC 3HD7D 2OTKE 3AE9C 1PL5A 2E43A 2O1JA 1PP9G 1CI6B 5AW7B 3CWBD 1SQVG 2Y0DA 4TT3H 1IK9A 3P8CE 1NTZK 1VF5B 2MJZA 2B87B 2Y0EA 4ZNCA 2K88A 3F5HA 5CCGC 5CHXA 3L74G 1EXJA 4GIFA 4OGQB 2Q6QA 3A0HE 4H13C 1ZR4A 1NGMB 2A45I 3H1LJ 1NKNA 2YIUC 3P8MC 4C7NA 3CC4P 2H43A 1KILC 1KYOE 5TISH 1NAYA 1N2DC 3L72D 3GW6A 1N73B 3MUDC 3L73D 2NPSB 5KAUA 4L76A 5KAWA 1R5SA 3CWBE 1KILD 3TNUB 1N7SB 4HYTB 1L2PA 1Z56A 3CD6P 3AE2C 2AEMA 3U1CA 2VRSA 5CCHA 4PD4D 3VTPC 1R5LA 3FWNA 1J1DB 1NTKD 4WBAA 1RF1C 2H88C 2WVRA 3H1KE 4IFMA 1LP1B 1FZEA 3L70J 1LT9A 2WPRA 3LW5J 3GP4A 5L8RJ 5AVVB 2E75B 2P1JA 1X79B 1MV8A 2WT7B 2KP8A 2FXPA 3V2PA 5BU5A 3L4FA 2FXOA 4I7ZC 5APWA 3L73E 2D2CD 1GTWA 2OTJP 4IL6E 5AW9B 2KVVA 2FYZA 1KILE 1YHQP 1VQ7P 1MKMA 3G6EP 1URQB 5APTA 3TK1A 1FC2C 3B5NB 1S2EA 2B89A 3LURA 1SP4A 4LHFA 3RK3B 1WMKA 4XFJA 4C46A 1GMJA 1G2CA 5H2FE 2YKOA 1RF0C 4DJGA 1VQPP 1BCCJ 3BCCJ 5KAIH 3HUSC 1JY3O 2WSEH 2YMKA 1OVRA 1PIXA 1GL2D 1LTIC 3H1HJ 3G3ZA 1BGYJ 2JKVA 2A45G 2ZXEB 2J59M 4K3AA 4HB1A 3CMAP 2ZVNB 3AEFC 1SFCD 1KQSO 5APYA 4WY4A 1ZLLA 3HE4B 1MUUA 5APVA 3KPEA 4BWNA 4RESB 2MKVA 4GOEA 2KLVA 2ZYGA 1LTJB 3QH9A 5GTIH 2RN0A 3MD0A 4LC1A 1L0NG 4HH2A 5AW5B 5APXA 3C1LA 1CZQA 5APSA 1NHLA 3Q5RA 5AW3B 1GK4A 2JR8A 2W27A 3HH0A 4H13B 3VYIA 3A0BE 5AW2B 3CC2P 1FOSF 3M9BA 1PGPA 5K5GB 2ITAA 1RE3A 4U7JA 3L71G 5KJ7D 4RJTA 3GHGA 2QJYC 2NZ2A 4KJMA 4GKGA 3CWBJ 1Y47A 2R3SA 5KLIB 3UIAA 3R8KA 1LT1A 1N7LA 4O9BA 1FS0E 3VMAA 1SQBD 2B88A 3OAKA 1DEEG 1QVGO 3AEDC 3IN6A 1VL2A 3RL0B 2BEQD 4PV1D 2QM8A 1HGVA 2Q3EA 1SQQD 1EZVI 1SQXD 2KNCA 1N86A 2N1TA 4DT0A 3H32A 1KORA 2P67A 3SWKA 1SVFA 4R4EA 4AYZA 1K8AQ 2ZVOB 1QX8A 4H44C 1Q05A 1UIIA 3L73J 3T97A 3A3YB 2PRRA 2POHA 1Q86Q 3WMM0 4H0LC 3EFGA 3I5CA 3QWOC 1NTMK 1A02J 1L0NK 1NWQA 3H1LD 3K5BA 1NVOA 2R5BA 3HE5A 2N9BA 1SQPG 3TGUD 4PJ0H 5AVUB 1SQBE 3N7NA 1YJNP 1KQGB 1SQQK 1NTME 1KQFB 4H0LD 1SQXK 5BU8B 2M8RA 3HD7A 3Q5PA 4A1MA 5B5EH 2JWAA 3SWYA 1KV4A 1SQQE 3GG2A 1SQXE 3AE3C 2FY8A 5AW1B 4R4MA 1JY2P 4YPCA 1BDDA 1FZCB 2HLOA 2QJPB 1GD2E 2HG5D 2QEXP 3AE4C 2BCCG 4WVZA 1PPJG 1S72P 2OYOA 4RKUJ 5AVWB 1OZHA 2LXBA 2R32A 1VQMP 1FDOA 2KXPB 1VF5D 3ZDMA 2OYIA 2IX7C 3AE6C 4IL6H 1H88A 3L70D 4DCZA 3AEGC 3TGUE 4QMAA 1OMIA 5AVQB 1M1JA 3G71P 4OGQD 1IFIA 2E74B 3B49A 1FZAA 4UB8H 5TJHA 3Q2YA 3I56P 5H2FH 2A06D 1L0LG 1Q81Q 5AVTB 5AW4B 1EZVG 2NPSD 5AVZB 3MGNA 3TYYA 4C7NB 2O01N 2XU6A 4OH8B 1N7SD 2ZJSE 1LWUA 3H1JG 1MZ9A 3GHGC 4PD4I 4BXLA 4D6TG 1FJPA 3H1IE 3BCCD 1GW4A 3SWFA 1K04A 2E5TA 2FFDA 1ZV8A 1Q09A 2E75C 2NRGA 3H1HD 5KKZB 1AA0A 1M7LA 1LTGC 5AW0B 4YXDC 4EYYQ 5KAXA 4IOIH 2HFED 1FU1A 2C9LY 2AEFA 1Q07A 1EDKA 2ZYAA 1BOWA 3CCQP 1R8EA 2H7HA 1AQ5A 3P8CD 4Z1MH 3JC22 4H44B 2C0XA 3RK3C 2WSSH 3N4XA 1AVYA 1EXIA 1NTZD 2QRXA 2HODA 3USSA 1FJKA 1URQD 3B5ND 1LX8A 2WPVB 3CCRP 1JBGA 2Y9ZA 1GL2A 4N6JA 1Q2NA 2FYUG 1BE3G 3CPWO 3O6QB 1SQBJ 1NTMJ 2K9JA 2WTYA 1SFCA 2JP3A 1U7JA 1L4AD 2JDIH 5AW8B 1SQQJ 4DZOA 2KZJA 1G2CB 1SQXJ 2IBZE 4EDFA 3L72G 1YJ9P 3FXDA 1QEXA 2JEEA 2WSCJ 1K9MQ 1LTJC 1VPCA 1ZXGA 2WITA 2CK3H 4IFFA 4HKZH 3NMDA 3D71A 3W67A 2JJLA 1NTZE 2IFMA 1FZFA 4WY4B 1LNQA 3H1KD 4U3FE 3RK3E 4W7YA 3PRJA 4AUWA 3TGUJ 5CCGD 1VDFA 5KJ7A 4JPZB 1NTKG 3GF3A 3RGUA 1RE4C 3M0DA 1IFPA 4H13D 4ASWA 2RH0A 3EFFK 1FBMA 1Y6UA 5KLIC 1PP9D 5DJUB 2BASA 4PJ0E 1W2EA 1JY3N 2YKPA 1SLQA 4NPDA 4N78D 2E76C 2PFXA 2WSCH 5B5EE 3BVHA 4GDOA 3RL0C 1KB9I 4BRYA 2JWDA 3GHGB 2W6AA 4XA4A 1YJWP 2WSEJ 1M90Q 1EC5A 5DJTB 5APUA 1J2JB 2KOGA 3RL0D 3E1IA 2YO2A 2DW3A 1MFTA 1GU4A 1YIJP 1KZUB 1SQVK 1KMIZ 1JM0A 1NU1G 2QSIA 2XDJA 4OWFA 1PP9E 1PGQA 1X8YA 3CX5H 1SQVE 3EZ9A 2KNCB 1IFMA 2N1TB 3V2NA 2QA4P 1DIPA 3H32B 4N78E 3Q3DA 2OQQA 1E5WA 1KFMA 2ZFCA 1NAFA 4AYZB 3QAOA 2CPBA 1YTZI 1HBWA 4UB8E 1NJIQ 1TU3F 1Y9BA 1RQUA 2YMYA 3KHUA 1P84E 2KLUA 1QGKB 1BDCA 2Q7CA 1LGHB 4L74A 5BVZA 3L74E 4JYCA 3GK6A 1FZCC 4I1LA 1H89A 2W6BA 3HE5B 2QJPC 3FX0A 2O1KA 1QLED 1RY3A 2R5DA 3JSVC 2Z5HA 3TF5A 1T3UA 2YKQA 4KHXA 3OJAB 3HD7B 2O3JA 3ITKA 1FDIA 2V4HA 5KLVG 2KYVA 3OW2O 3C9IA 2AXTE 1LTAC 5AVSB 1X9VA 2GUSA 1NTZJ 2E5YA 2E74C 1ZMEC 4U3FJ 1PGOA 1ZN5A 1N73A 3RBZA 2L5GB 2OYIB 2M0BA 1S4XA 3C8VA 1X22A 1N7SA 1FZBA 3CXHI 4JF7A 5E01A 1K73Q 1HVVA 2M3EA 1DD3A 1M56D 1H0TA 1FZGA 4ASVA 1RHZB 2E76B 2KK7A 2H89C 2AXCA 5KKZC 1JY2O 1NTMD 2ZXXA 1L0ND 3UCSA 1LJ2A 3SFEC 5KTBA 3H1LG 3MHVA 5CCHC 1JEKA 1LWUB 3R8JA 2WT7A 2Z5IA 3H1KJ 1YQ3C 3VOPA 3G9RA 2W6JH 3AE1C 1GW3A 3IAOA 3G4SP 1AV1A 3OA7A 2FFDB 1LT9C 5AVYB 1RH6A 2KB7P 3GF7A 3L71D 4GODA 1GZLA 2XZRA 2QVAA 3U59A 1YQ4C 3PH0A 4UB6H 1K05A 3B5NA 1PP9J 4B86A 4H44D 1SQVJ 3CCMP 3GMAA 4R4LA 4ZKPA 2K37A 4M3LA 1WRGA 1IFNA 1L0NE 3BATA 1KYOI 3Q1MA 5KAVA 1L4AA 1QL1A 3L70G 2Y9YA 3CX5D 2PGDA 2OYHA 3CC7P 1Q82Q 5GQQA 3L74J 2HODB 1KN7A 3H25A 1ZR2A 1YYCA 2J5UA 3AE7C 1AVOA 2IYOA 4WWIA 1GL2B 1OFCX 4DOJA 1OW6A 3L71E 3JCUH 2A06G 2K9JB 1A02F 2W8ZA 5AVRB 1SFCB 1W5CE 1NOHA 3H1ID 2H8PD 4WY4C 2GM4A 1D7MA 5CBOA 4EIJA 3P7KA 1BCCG 3BCCG 2CPSA 1G1IA 3EZ6A 1AFOA 3R4YA 2Q3IA 3CX5E 2J58A 1KILA 1JMMA 2PP6A 4J2NA 3H1HG 2XNDH 1IO4A 1BGYG 1Q08A 1P84H 2HPCA 1U7MA 2YNYA 3U1AA 2FKWB 1HH0A 2OTLP 3IR9A 1KFNA 3RBXA 1PGJA 3PLNA 3O8ZA 1RE3C 1PM6A 1JCDA 3EZ7A 2BCCD 3VN0A 1GDTA 2L91A 2RMZA 3M06A 4LLHA 1SQPK 4WLSA 1JO5A 1Q06A 4HJGH 3A2AA 2Q9IA 5APQA 2GUVA 2IFNA 1RF1A 1SQPE 3IFMA 4RO0A 2AXTH 3TDKA 3L75D 2AEJA 2V7QJ 3AEEC 4GT1A 1S3JA 4BRYB 2E75D 2IBZD 3D70A 2HR3A 2KIKA 4Y99B 2QJKB 1NH4A 2RKLA 2DG6A 2N1TC 2P10A 1LT9B 3BASA 1L0LD 1ZRTE 2WWWA 2HVAA 1EZVD 5I41B 3CWBG 1NYHA 1YI2P 2UWJE 3NTNA 1IC2A 2BCCE 1PPJE 4R24B 1NO4A 4Y28J 4U3FD 3RK3D 3GLMA 3PTZA 2WSFJ 3MIWA 3BRVB 1RF0A 4EOTA 1RH5B 3L36A 1L0NJ 3HUSA 3H1KG 4AYCA 3AE8C 3L75E 1ZOYC 3AECC 4WLWA 3KZIH 1G1JA 5KAFH 1IK7A 3S4RA 3HD7C 1L0LK 2V7QH 2OYHC 1DX7A 1IJDB 3KXDA 3L73G 3B71A 2QG4A 2C9NY 1Y8AA 1L0LE 1FOSE 1EZVE 2XNXA 5B66E 4N3YB 3L71J 3B4SA 3E7KA 4W7ZA 3L35A 1T6AA 2A45H 3H1JE 3MP7B 3I55P 4D6TE 1BSNA 2OYIC 3HTKA 3V5BA 2ZT9B 5C39A 3PHLA 5GTHH 3WU2E 3PP5A 4CPGA 2FYUD 1BE3D 2WSFH 3L37A 1JNMA 4UB6E 1USEA 3IF4A 3M9HA 1EDLA 1M1JC 1QL2A 3V6IA 2IDBA 2K1AA 1JTHA 2LR2A 1KC8Q 1SQVD 3EZFA 4R22B 2QE7H 3KYQA 2O01J 4IFDK 1KB9H 1VQ6P 1S5LX 1GK6A 2P7JA 4JBZA 3VP9A 2IEFA 1P84D 1OW8A 3II6A 3CL3D 3H1IJ 2E76D
chains in the Genus database with same CATH topology
1KMIZ 4IL6X 2QSIA 4OGQC 3D71A 1IK7A 1GMJA 5KCBA 4B0YA 1PM6A 3AEBC 2VZ4A 3R8KA 3EZ7A 3ABVC 5KAUA 4YXDC 3EZ9A 2ZT9D 5KAXA 3Q1MA 2D2CB 2FBWC 5KAVA 3D6ZA 3C8VA 5KAWA 3AE4C 1DIPA 3RK3E 3Q3DA 2OQQA 4RKUJ 4WLSA 1Q90D 1Q06A 2YMKA 3B71A 1PIXA 5GQQA 1HJ0A 4AYZB 2BEZF 3AEDC 3IN6A 1Q07A 3QAOA 1VL2A 1BOWA 4H0LB 3H25A 1KTMA 3GF3A 5D8CA 1TU3F 1FDOA 1Y9BA 1R8EA 2BEQD 2D2CC 2J5UA 5E01A 1RQUA 1VF5D 3AEAC 4I7ZB 3S9OA 3SFDC 4PV1D 4Z1MH 3AE7C 3AE6C 2G8YA 3AE2C 4H44B 2ZHGA 4H13D 3AEFC 1DD3A 4DCZA 3AEGC 1R8DA 2KCUA 1OW6A 5KATA 2E74D 2V7QJ 3AEEC 1HF9A 2E76B 1KORA 2JO1A 1OMIA 4YTPC 1EXIA 2K9YA 2H89C 2JMLA 1Y6UA 5D90A 4R4EA 2E75D 5KLIC 5KKZC 1UIXA 2MKVA 3E0HA 3GK6A 3Q5SA 2H88C 4OGQD 3D6YA 1JYHA 1Q0AA 4H44C 3UCSA 3D70A 2ZHHA 2FYNC 3SFEC 1Q05A 1OW7A 2ZT9B 1AJYA 2G3AA 1LX8A 2WPVB 2QJPC 3AE9C 1PL5A 2E74B 3B49A 2DG6A 1JBGA 2E76C 3LW5J 3GP4A 2P10A 3AE5C 5L8RJ 2E75B 1ZRTE 1ZP0C 3Q2YA 3T97B 3R8JA 2HVAA 3O6QA 4KT0J 5I41B 1JB0J 2OG0A 1PV3A 1YQ3C 3G9RA 1NYHA 4GDOA 4TT3H 2GOVA 2QIWA 3AE1C 4H0LC 2FXPA 1FDIA 3Q5RA 3IAOA 1VF5B 2IDBA 2WQYC 4PV1B 4I7ZC 2JP3A 1DD4A 3HH0A 2D2CD 3EWKA 2WSEJ 4R4MA 3EZ6A 4H13B 1RH6A 3R4YA 3EZFA 4R24B 4Y28J 4R22B 3GF7A 2KVVA 3EZ2A 2O01J 3GPVA 1KILE 1KQGB 1S1CX 4J2NA 3GLMA 2WSFJ 1YQ4C 1KQFB 1VF5C 1U57A 1EXJA 1K05A 1S5LX 4H0LD 4PV1C 1MKMA 3RL0g 4OGQB 1Q08A 4U7JA 3Q5PA 2WSCJ 4A1MA 4H13C 5I44A 1NGMB 3LURA 1D5YA 5M1BA 2ZT9C 1K04A 4H44D 4LHFA 2QJYC 2E74C 4AYZA 2QJKC 1ZMEC 1WMKA 2IEFA 2NZ2A 4XFJA 2YIUC 3GMAA 1OW8A 2BOWA 3AE8C 1Q09A 4R4LA 3AE3C 2E76D 1ZOYC 3AECC 3FGAD 4WLWA 2E75C 1RQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8C A;  4R24 B;  1R8E A;  4R22 B;  3D71 A;  2J5U A;  5E01 A;  3B49 A;  2DG6 A;  3GPV A;  5KCB A;  4B0Y A;  1JBG A;  2VZ4 A;  3GP4 A;  3R8K A;  4J2N A;  2ZHG A;  5KAU A;  3Q2Y A;  1EXJ A;  3T97 B;  2HVA A;  3R8J A;  5I41 B;  5KAX A;  1Q08 A;  3Q1M A;  1R8D A;  2KCU A;  3G9R A;  3D6Z A;  3Q5P A;  3D70 A;  5KAV A;  5KAT A;  5I44 A;  2GOV A;  5KAW A;  4A1M A;  1DIP A;  3LUR A;  1D5Y A;  3Q3D A;  2OQQ A;  1EXI A;  3Q5R A;  4WLS A;  3IAO A;  1Q06 A;  2JML A;  5D90 A;  4R4E A;  3E0H A;  3GK6 A;  5GQQ A;  4AYZ A;  2BOW A;  4AYZ B;  3Q5S A;  3D6Y A;  3HH0 A;  1Q09 A;  4R4L A;  1Q07 A;  1Q0A A;  3QAO A;  3UCS A;  1BOW A;  1JYH A;  2ZHH A;  4WLW A;  4R4M A;  1Q05 A; 
#chains in the Genus database with same CATH topology
 1LWU C;  3CCJ P;  3L74 D;  2FYU K;  4WB4 A;  4ZMD A;  5KCB A;  1E79 H;  2P58 A;  3MTU E;  2SPZ A;  1J1E C;  1Q7Y Q;  1H0T B;  2FFD C;  2KS1 A;  3JCU E;  1SQP J;  1KD1 Q;  3S1K A;  4LGD E;  2FYU E;  1BE3 E;  1HWT C;  1EDI A;  4L73 A;  3LIE A;  2D2C C;  3R2P A;  1LTB C;  2G8Y A;  2M5A A;  1HJB A;  1S9K D;  2WPQ A;  4TLF A;  3RK2 B;  3V2R A;  1HF9 A;  2QM7 A;  3B8E B;  3L72 E;  3H6P A;  1T2K C;  3Q5S A;  1Q0A A;  3BRT B;  2O01 H;  2G3A A;  2BCC J;  2YO3 A;  5AW6 B;  4L75 A;  4YXW H;  3T97 B;  5CJ4 A;  3O6Q A;  1T2K D;  3CX5 I;  2QIW A;  1NTK K;  2WQY C;  2XKM A;  1IFJ A;  1VQ4 P;  4PD4 E;  1GL2 C;  1CI6 A;  1GU5 A;  1NTK E;  1JY2 N;  3L75 J;  1DH3 A;  1LTS C;  2WMM A;  5I44 A;  2Y0C A;  1SFC C;  1L4A B;  5M1B A;  4NPE A;  1NU1 D;  1HUC A;  2B87 A;  1OWA A;  2OYH B;  1S9K E;  1XTC C;  3FGA D;  1N8R Q;  1RQV A;  3LW5 H;  1YTZ T;  1PZQ A;  1L0L J;  1FDM A;  5CJ0 A;  2FYN B;  2YXQ B;  4GOF A;  3V2Q A;  3CCE P;  5CBN A;  1MFZ A;  3F89 A;  1HJ0 A;  3H1J J;  4I6M C;  2BEZ F;  1SQB G;  3WUT A;  4D6T J;  1NTM G;  1EQ7 A;  3M0A A;  3AEA C;  2NPS A;  5E79 H;  3A5T A;  1OX3 A;  1YIT P;  2P2U A;  2Z4E A;  2YXR B;  5KAT A;  2E74 D;  3CXH H;  1SQQ G;  1NU1 K;  1SQX G;  3TNU A;  5KJ7 C;  3E0H A;  1UIX A;  1AQT A;  3D6Y A;  1CSB A;  1M1J B;  1OW7 A;  3M0D C;  2YIU B;  1NU1 E;  4A7P A;  1VQ9 P;  3V4W A;  3AE5 C;  1KIL B;  1ZP0 C;  2IPP A;  3M9Q A;  1S5L E;  4KT0 J;  5KLV D;  1JB0 J;  1PV3 A;  2B9B A;  3CCS P;  3FWL A;  4AQR D;  2HPC B;  3KZI E;  1JY3 P;  5KAF E;  2R3C A;  1LP1 A;  1SS1 A;  2I1K A;  3EZ2 A;  5B66 H;  1S1C X;  3KDP B;  3TGU G;  4PV1 C;  1OIP A;  5EFW B;  3VMX A;  3EQ2 A;  1KB9 D;  1LTT C;  2IBZ I;  2KSE A;  4Y99 C;  2QJK C;  2HYN A;  5AVX B;  1JMB A;  1J1E B;  1ZW0 A;  4C7R A;  1AJY A;  2FYU J;  1BE3 J;  5CCH D;  1WT6 A;  1VQ5 P;  1RF1 B;  3AEB C;  4DCK A;  2IZ1 A;  3WU2 H;  3ABV C;  4OVN F;  5KLV K;  1URQ A;  2LXC B;  2D2C B;  2Q5U A;  2KZI A;  3A0H H;  1JOC A;  2GA1 A;  2ZAE B;  5GTH E;  5KLV E;  3L72 J;  3S9O A;  4I7Z B;  1KYO H;  3SFD C;  2ZHG A;  3H1I G;  1T3J A;  1SQB K;  3WUU A;  1XTG B;  4YTP C;  2JML A;  3KQG A;  5TIS E;  3CCV P;  3SSU A;  2ZHH A;  1FE6 A;  2OGU A;  2XV5 A;  2N9Y B;  3PJS K;  1BSH A;  1KB9 E;  3V4Q A;  3HE4 A;  2OG0 A;  1M57 D;  3LID A;  1USD A;  1NTK J;  4JYB A;  2GOV A;  2KUB A;  1VQ8 P;  1VQN P;  3HUS B;  1LTJ A;  1M8O B;  1DD4 A;  1W2B O;  1HTL C;  3FXE A;  2IYP A;  1M1K Q;  2KI7 B;  1X0T A;  2I8D A;  1VF5 C;  1OVV A;  3RL0 g;  5CCG A;  3CME P;  1D5Y A;  2ZT9 C;  1SQP D;  2BOW A;  4WY4 D;  4XE5 B;  4OGQ C;  3P32 A;  2VZ4 A;  3H1L E;  3CI9 A;  1FAV A;  2ZT9 D;  1RE4 A;  3D6Z A;  3MUD A;  1IZN B;  4W80 A;  3L75 G;  1N73 C;  1ZRT D;  3VMY A;  3CCL P;  2W83 C;  2NPS C;  1PFI A;  3HTK B;  2M3B A;  1KTM A;  5D8C A;  1QVF O;  2IBZ G;  3TSI A;  1HGZ A;  4PD4 H;  4ZKU A;  3M91 A;  2Q1K A;  1PPJ D;  1N7S C;  1R8D A;  2KCU A;  2I1J A;  2WZ7 A;  1NU1 J;  2E42 A;  2IZ0 A;  2K9Y A;  4MN4 C;  1P84 I;  1YBK A;  2ZYD A;  1JTH B;  3CXH D;  1JYH A;  1OVU A;  2QJY B;  1NTZ G;  5CMZ A;  5KAI E;  1J1D C;  3W68 A;  1KQL A;  2R44 A;  4U3F G;  1BCC D;  1JCC A;  3CLQ A;  4K35 A;  2KSJ A;  3CCU P;  1OXZ A;  4PV1 B;  3L70 E;  3EWK A;  3E1R A;  1VQL P;  1H8A A;  1BGY D;  3RK2 C;  3GPV A;  4NPF X;  4I2L C;  1U57 A;  3MZW B;  2OAR A;  3VP8 A;  2KS1 B;  1T8Z A;  3A7O A;  2PAJ A;  3NXS A;  5GTI E;  1JUN A;  3RK2 D;  2A06 E;  2N1T D;  3H1J D;  4IL6 X;  1DEB A;  1URQ C;  5E79 E;  2W90 A;  4JQ0 D;  4B0Y A;  3B5N C;  4D6T D;  3A0B H;  5KLV J;  1IFD A;  2M5A B;  3HRN A;  3CXH E;  1CW5 A;  2FBW C;  3WUV A;  1S5L H;  3NFQ A;  1Q90 D;  2WPS A;  4H0L B;  1BCC E;  4EI2 A;  2LKM A;  3BCC E;  1FZC A;  3VMZ A;  2FXM A;  1L4A C;  2K3R A;  1EDJ A;  1KYO D;  3H1H E;  2JO1 A;  1BGY E;  2C0W A;  1VQK P;  5D90 A;  1NKZ B;  1VQO P;  2FYN C;  3HD7 D;  2OTK E;  3AE9 C;  1PL5 A;  2E43 A;  2O1J A;  1PP9 G;  1CI6 B;  5AW7 B;  3CWB D;  1SQV G;  2Y0D A;  4TT3 H;  1IK9 A;  3P8C E;  1NTZ K;  1VF5 B;  2MJZ A;  2B87 B;  2Y0E A;  4ZNC A;  2K88 A;  3F5H A;  5CCG C;  5CHX A;  3L74 G;  1EXJ A;  4GIF A;  4OGQ B;  2Q6Q A;  3A0H E;  4H13 C;  1ZR4 A;  1NGM B;  2A45 I;  3H1L J;  1NKN A;  2YIU C;  3P8M C;  4C7N A;  3CC4 P;  2H43 A;  1KIL C;  1KYO E;  5TIS H;  1NAY A;  1N2D C;  3L72 D;  3GW6 A;  1N73 B;  3MUD C;  3L73 D;  2NPS B;  5KAU A;  4L76 A;  5KAW A;  1R5S A;  3CWB E;  1KIL D;  3TNU B;  1N7S B;  4HYT B;  1L2P A;  1Z56 A;  3CD6 P;  3AE2 C;  2AEM A;  3U1C A;  2VRS A;  5CCH A;  4PD4 D;  3VTP C;  1R5L A;  3FWN A;  1J1D B;  1NTK D;  4WBA A;  1RF1 C;  2H88 C;  2WVR A;  3H1K E;  4IFM A;  1LP1 B;  1FZE A;  3L70 J;  1LT9 A;  2WPR A;  3LW5 J;  3GP4 A;  5L8R J;  5AVV B;  2E75 B;  2P1J A;  1X79 B;  1MV8 A;  2WT7 B;  2KP8 A;  2FXP A;  3V2P A;  5BU5 A;  3L4F A;  2FXO A;  4I7Z C;  5APW A;  3L73 E;  2D2C D;  1GTW A;  2OTJ P;  4IL6 E;  5AW9 B;  2KVV A;  2FYZ A;  1KIL E;  1YHQ P;  1VQ7 P;  1MKM A;  3G6E P;  1URQ B;  5APT A;  3TK1 A;  1FC2 C;  3B5N B;  1S2E A;  2B89 A;  3LUR A;  1SP4 A;  4LHF A;  3RK3 B;  1WMK A;  4XFJ A;  4C46 A;  1GMJ A;  1G2C A;  5H2F E;  2YKO A;  1RF0 C;  4DJG A;  1VQP P;  1BCC J;  3BCC J;  5KAI H;  3HUS C;  1JY3 O;  2WSE H;  2YMK A;  1OVR A;  1PIX A;  1GL2 D;  1LTI C;  3H1H J;  3G3Z A;  1BGY J;  2JKV A;  2A45 G;  2ZXE B;  2J59 M;  4K3A A;  4HB1 A;  3CMA P;  2ZVN B;  3AEF C;  1SFC D;  1KQS O;  5APY A;  4WY4 A;  1ZLL A;  3HE4 B;  1MUU A;  5APV A;  3KPE A;  4BWN A;  4RES B;  2MKV A;  4GOE A;  2KLV A;  2ZYG A;  1LTJ B;  3QH9 A;  5GTI H;  2RN0 A;  3MD0 A;  4LC1 A;  1L0N G;  4HH2 A;  5AW5 B;  5APX A;  3C1L A;  1CZQ A;  5APS A;  1NHL A;  3Q5R A;  5AW3 B;  1GK4 A;  2JR8 A;  2W27 A;  3HH0 A;  4H13 B;  3VYI A;  3A0B E;  5AW2 B;  3CC2 P;  1FOS F;  3M9B A;  1PGP A;  5K5G B;  2ITA A;  1RE3 A;  4U7J A;  3L71 G;  5KJ7 D;  4RJT A;  3GHG A;  2QJY C;  2NZ2 A;  4KJM A;  4GKG A;  3CWB J;  1Y47 A;  2R3S A;  5KLI B;  3UIA A;  3R8K A;  1LT1 A;  1N7L A;  4O9B A;  1FS0 E;  3VMA A;  1SQB D;  2B88 A;  3OAK A;  1DEE G;  1QVG O;  3AED C;  3IN6 A;  1VL2 A;  3RL0 B;  2BEQ D;  4PV1 D;  2QM8 A;  1HGV A;  2Q3E A;  1SQQ D;  1EZV I;  1SQX D;  2KNC A;  1N86 A;  2N1T A;  4DT0 A;  3H32 A;  1KOR A;  2P67 A;  3SWK A;  1SVF A;  4R4E A;  4AYZ A;  1K8A Q;  2ZVO B;  1QX8 A;  4H44 C;  1Q05 A;  1UII A;  3L73 J;  3T97 A;  3A3Y B;  2PRR A;  2POH A;  1Q86 Q;  3WMM 0;  4H0L C;  3EFG A;  3I5C A;  3QWO C;  1NTM K;  1A02 J;  1L0N K;  1NWQ A;  3H1L D;  3K5B A;  1NVO A;  2R5B A;  3HE5 A;  2N9B A;  1SQP G;  3TGU D;  4PJ0 H;  5AVU B;  1SQB E;  3N7N A;  1YJN P;  1KQG B;  1SQQ K;  1NTM E;  1KQF B;  4H0L D;  1SQX K;  5BU8 B;  2M8R A;  3HD7 A;  3Q5P A;  4A1M A;  5B5E H;  2JWA A;  3SWY A;  1KV4 A;  1SQQ E;  3GG2 A;  1SQX E;  3AE3 C;  2FY8 A;  5AW1 B;  4R4M A;  1JY2 P;  4YPC A;  1BDD A;  1FZC B;  2HLO A;  2QJP B;  1GD2 E;  2HG5 D;  2QEX P;  3AE4 C;  2BCC G;  4WVZ A;  1PPJ G;  1S72 P;  2OYO A;  4RKU J;  5AVW B;  1OZH A;  2LXB A;  2R32 A;  1VQM P;  1FDO A;  2KXP B;  1VF5 D;  3ZDM A;  2OYI A;  2IX7 C;  3AE6 C;  4IL6 H;  1H88 A;  3L70 D;  4DCZ A;  3AEG C;  3TGU E;  4QMA A;  1OMI A;  5AVQ B;  1M1J A;  3G71 P;  4OGQ D;  1IFI A;  2E74 B;  3B49 A;  1FZA A;  4UB8 H;  5TJH A;  3Q2Y A;  3I56 P;  5H2F H;  2A06 D;  1L0L G;  1Q81 Q;  5AVT B;  5AW4 B;  1EZV G;  2NPS D;  5AVZ B;  3MGN A;  3TYY A;  4C7N B;  2O01 N;  2XU6 A;  4OH8 B;  1N7S D;  2ZJS E;  1LWU A;  3H1J G;  1MZ9 A;  3GHG C;  4PD4 I;  4BXL A;  4D6T G;  1FJP A;  3H1I E;  3BCC D;  1GW4 A;  3SWF A;  1K04 A;  2E5T A;  2FFD A;  1ZV8 A;  1Q09 A;  2E75 C;  2NRG A;  3H1H D;  5KKZ B;  1AA0 A;  1M7L A;  1LTG C;  5AW0 B;  4YXD C;  4EYY Q;  5KAX A;  4IOI H;  2HFE D;  1FU1 A;  2C9L Y;  2AEF A;  1Q07 A;  1EDK A;  2ZYA A;  1BOW A;  3CCQ P;  1R8E A;  2H7H A;  1AQ5 A;  3P8C D;  4Z1M H;  3JC2 2;  4H44 B;  2C0X A;  3RK3 C;  2WSS H;  3N4X A;  1AVY A;  1EXI A;  1NTZ D;  2QRX A;  2HOD A;  3USS A;  1FJK A;  1URQ D;  3B5N D;  1LX8 A;  2WPV B;  3CCR P;  1JBG A;  2Y9Z A;  1GL2 A;  4N6J A;  1Q2N A;  2FYU G;  1BE3 G;  3CPW O;  3O6Q B;  1SQB J;  1NTM J;  2K9J A;  2WTY A;  1SFC A;  2JP3 A;  1U7J A;  1L4A D;  2JDI H;  5AW8 B;  1SQQ J;  4DZO A;  2KZJ A;  1G2C B;  1SQX J;  2IBZ E;  4EDF A;  3L72 G;  1YJ9 P;  3FXD A;  1QEX A;  2JEE A;  2WSC J;  1K9M Q;  1LTJ C;  1VPC A;  1ZXG A;  2WIT A;  2CK3 H;  4IFF A;  4HKZ H;  3NMD A;  3D71 A;  3W67 A;  2JJL A;  1NTZ E;  2IFM A;  1FZF A;  4WY4 B;  1LNQ A;  3H1K D;  4U3F E;  3RK3 E;  4W7Y A;  3PRJ A;  4AUW A;  3TGU J;  5CCG D;  1VDF A;  5KJ7 A;  4JPZ B;  1NTK G;  3GF3 A;  3RGU A;  1RE4 C;  3M0D A;  1IFP A;  4H13 D;  4ASW A;  2RH0 A;  3EFF K;  1FBM A;  1Y6U A;  5KLI C;  1PP9 D;  5DJU B;  2BAS A;  4PJ0 E;  1W2E A;  1JY3 N;  2YKP A;  1SLQ A;  4NPD A;  4N78 D;  2E76 C;  2PFX A;  2WSC H;  5B5E E;  3BVH A;  4GDO A;  3RL0 C;  1KB9 I;  4BRY A;  2JWD A;  3GHG B;  2W6A A;  4XA4 A;  1YJW P;  2WSE J;  1M90 Q;  1EC5 A;  5DJT B;  5APU A;  1J2J B;  2KOG A;  3RL0 D;  3E1I A;  2YO2 A;  2DW3 A;  1MFT A;  1GU4 A;  1YIJ P;  1KZU B;  1SQV K;  1KMI Z;  1JM0 A;  1NU1 G;  2QSI A;  2XDJ A;  4OWF A;  1PP9 E;  1PGQ A;  1X8Y A;  3CX5 H;  1SQV E;  3EZ9 A;  2KNC B;  1IFM A;  2N1T B;  3V2N A;  2QA4 P;  1DIP A;  3H32 B;  4N78 E;  3Q3D A;  2OQQ A;  1E5W A;  1KFM A;  2ZFC A;  1NAF A;  4AYZ B;  3QAO A;  2CPB A;  1YTZ I;  1HBW A;  4UB8 E;  1NJI Q;  1TU3 F;  1Y9B A;  1RQU A;  2YMY A;  3KHU A;  1P84 E;  2KLU A;  1QGK B;  1BDC A;  2Q7C A;  1LGH B;  4L74 A;  5BVZ A;  3L74 E;  4JYC A;  3GK6 A;  1FZC C;  4I1L A;  1H89 A;  2W6B A;  3HE5 B;  2QJP C;  3FX0 A;  2O1K A;  1QLE D;  1RY3 A;  2R5D A;  3JSV C;  2Z5H A;  3TF5 A;  1T3U A;  2YKQ A;  4KHX A;  3OJA B;  3HD7 B;  2O3J A;  3ITK A;  1FDI A;  2V4H A;  5KLV G;  2KYV A;  3OW2 O;  3C9I A;  2AXT E;  1LTA C;  5AVS B;  1X9V A;  2GUS A;  1NTZ J;  2E5Y A;  2E74 C;  1ZME C;  4U3F J;  1PGO A;  1ZN5 A;  1N73 A;  3RBZ A;  2L5G B;  2OYI B;  2M0B A;  1S4X A;  3C8V A;  1X22 A;  1N7S A;  1FZB A;  3CXH I;  4JF7 A;  5E01 A;  1K73 Q;  1HVV A;  2M3E A;  1DD3 A;  1M56 D;  1H0T A;  1FZG A;  4ASV A;  1RHZ B;  2E76 B;  2KK7 A;  2H89 C;  2AXC A;  5KKZ C;  1JY2 O;  1NTM D;  2ZXX A;  1L0N D;  3UCS A;  1LJ2 A;  3SFE C;  5KTB A;  3H1L G;  3MHV A;  5CCH C;  1JEK A;  1LWU B;  3R8J A;  2WT7 A;  2Z5I A;  3H1K J;  1YQ3 C;  3VOP A;  3G9R A;  2W6J H;  3AE1 C;  1GW3 A;  3IAO A;  3G4S P;  1AV1 A;  3OA7 A;  2FFD B;  1LT9 C;  5AVY B;  1RH6 A;  2KB7 P;  3GF7 A;  3L71 D;  4GOD A;  1GZL A;  2XZR A;  2QVA A;  3U59 A;  1YQ4 C;  3PH0 A;  4UB6 H;  1K05 A;  3B5N A;  1PP9 J;  4B86 A;  4H44 D;  1SQV J;  3CCM P;  3GMA A;  4R4L A;  4ZKP A;  2K37 A;  4M3L A;  1WRG A;  1IFN A;  1L0N E;  3BAT A;  1KYO I;  3Q1M A;  5KAV A;  1L4A A;  1QL1 A;  3L70 G;  2Y9Y A;  3CX5 D;  2PGD A;  2OYH A;  3CC7 P;  1Q82 Q;  5GQQ A;  3L74 J;  2HOD B;  1KN7 A;  3H25 A;  1ZR2 A;  1YYC A;  2J5U A;  3AE7 C;  1AVO A;  2IYO A;  4WWI A;  1GL2 B;  1OFC X;  4DOJ A;  1OW6 A;  3L71 E;  3JCU H;  2A06 G;  2K9J B;  1A02 F;  2W8Z A;  5AVR B;  1SFC B;  1W5C E;  1NOH A;  3H1I D;  2H8P D;  4WY4 C;  2GM4 A;  1D7M A;  5CBO A;  4EIJ A;  3P7K A;  1BCC G;  3BCC G;  2CPS A;  1G1I A;  3EZ6 A;  1AFO A;  3R4Y A;  2Q3I A;  3CX5 E;  2J58 A;  1KIL A;  1JMM A;  2PP6 A;  4J2N A;  3H1H G;  2XND H;  1IO4 A;  1BGY G;  1Q08 A;  1P84 H;  2HPC A;  1U7M A;  2YNY A;  3U1A A;  2FKW B;  1HH0 A;  2OTL P;  3IR9 A;  1KFN A;  3RBX A;  1PGJ A;  3PLN A;  3O8Z A;  1RE3 C;  1PM6 A;  1JCD A;  3EZ7 A;  2BCC D;  3VN0 A;  1GDT A;  2L91 A;  2RMZ A;  3M06 A;  4LLH A;  1SQP K;  4WLS A;  1JO5 A;  1Q06 A;  4HJG H;  3A2A A;  2Q9I A;  5APQ A;  2GUV A;  2IFN A;  1RF1 A;  1SQP E;  3IFM A;  4RO0 A;  2AXT H;  3TDK A;  3L75 D;  2AEJ A;  2V7Q J;  3AEE C;  4GT1 A;  1S3J A;  4BRY B;  2E75 D;  2IBZ D;  3D70 A;  2HR3 A;  2KIK A;  4Y99 B;  2QJK B;  1NH4 A;  2RKL A;  2DG6 A;  2N1T C;  2P10 A;  1LT9 B;  3BAS A;  1L0L D;  1ZRT E;  2WWW A;  2HVA A;  1EZV D;  5I41 B;  3CWB G;  1NYH A;  1YI2 P;  2UWJ E;  3NTN A;  1IC2 A;  2BCC E;  1PPJ E;  4R24 B;  1NO4 A;  4Y28 J;  4U3F D;  3RK3 D;  3GLM A;  3PTZ A;  2WSF J;  3MIW A;  3BRV B;  1RF0 A;  4EOT A;  1RH5 B;  3L36 A;  1L0N J;  3HUS A;  3H1K G;  4AYC A;  3AE8 C;  3L75 E;  1ZOY C;  3AEC C;  4WLW A;  3KZI H;  1G1J A;  5KAF H;  1IK7 A;  3S4R A;  3HD7 C;  1L0L K;  2V7Q H;  2OYH C;  1DX7 A;  1IJD B;  3KXD A;  3L73 G;  3B71 A;  2QG4 A;  2C9N Y;  1Y8A A;  1L0L E;  1FOS E;  1EZV E;  2XNX A;  5B66 E;  4N3Y B;  3L71 J;  3B4S A;  3E7K A;  4W7Z A;  3L35 A;  1T6A A;  2A45 H;  3H1J E;  3MP7 B;  3I55 P;  4D6T E;  1BSN A;  2OYI C;  3HTK A;  3V5B A;  2ZT9 B;  5C39 A;  3PHL A;  5GTH H;  3WU2 E;  3PP5 A;  4CPG A;  2FYU D;  1BE3 D;  2WSF H;  3L37 A;  1JNM A;  4UB6 E;  1USE A;  3IF4 A;  3M9H A;  1EDL A;  1M1J C;  1QL2 A;  3V6I A;  2IDB A;  2K1A A;  1JTH A;  2LR2 A;  1KC8 Q;  1SQV D;  3EZF A;  4R22 B;  2QE7 H;  3KYQ A;  2O01 J;  4IFD K;  1KB9 H;  1VQ6 P;  1S5L X;  1GK6 A;  2P7J A;  4JBZ A;  3VP9 A;  2IEF A;  1P84 D;  1OW8 A;  3II6 A;  3CL3 D;  3H1I J;  2E76 D; 
#chains in the Genus database with same CATH homology
 1KMI Z;  4IL6 X;  2QSI A;  4OGQ C;  3D71 A;  1IK7 A;  1GMJ A;  5KCB A;  4B0Y A;  1PM6 A;  3AEB C;  2VZ4 A;  3R8K A;  3EZ7 A;  3ABV C;  5KAU A;  4YXD C;  3EZ9 A;  2ZT9 D;  5KAX A;  3Q1M A;  2D2C B;  2FBW C;  5KAV A;  3D6Z A;  3C8V A;  5KAW A;  3AE4 C;  1DIP A;  3RK3 E;  3Q3D A;  2OQQ A;  4RKU J;  4WLS A;  1Q90 D;  1Q06 A;  2YMK A;  3B71 A;  1PIX A;  5GQQ A;  1HJ0 A;  4AYZ B;  2BEZ F;  3AED C;  3IN6 A;  1Q07 A;  3QAO A;  1VL2 A;  1BOW A;  4H0L B;  3H25 A;  1KTM A;  3GF3 A;  5D8C A;  1TU3 F;  1FDO A;  1Y9B A;  1R8E A;  2BEQ D;  2D2C C;  2J5U A;  5E01 A;  1RQU A;  1VF5 D;  3AEA C;  4I7Z B;  3S9O A;  3SFD C;  4PV1 D;  4Z1M H;  3AE7 C;  3AE6 C;  2G8Y A;  3AE2 C;  4H44 B;  2ZHG A;  4H13 D;  3AEF C;  1DD3 A;  4DCZ A;  3AEG C;  1R8D A;  2KCU A;  1OW6 A;  5KAT A;  2E74 D;  2V7Q J;  3AEE C;  1HF9 A;  2E76 B;  1KOR A;  2JO1 A;  1OMI A;  4YTP C;  1EXI A;  2K9Y A;  2H89 C;  2JML A;  1Y6U A;  5D90 A;  4R4E A;  2E75 D;  5KLI C;  5KKZ C;  1UIX A;  2MKV A;  3E0H A;  3GK6 A;  3Q5S A;  2H88 C;  4OGQ D;  3D6Y A;  1JYH A;  1Q0A A;  4H44 C;  3UCS A;  3D70 A;  2ZHH A;  2FYN C;  3SFE C;  1Q05 A;  1OW7 A;  2ZT9 B;  1AJY A;  2G3A A;  1LX8 A;  2WPV B;  2QJP C;  3AE9 C;  1PL5 A;  2E74 B;  3B49 A;  2DG6 A;  1JBG A;  2E76 C;  3LW5 J;  3GP4 A;  2P10 A;  3AE5 C;  5L8R J;  2E75 B;  1ZRT E;  1ZP0 C;  3Q2Y A;  3T97 B;  3R8J A;  2HVA A;  3O6Q A;  4KT0 J;  5I41 B;  1JB0 J;  2OG0 A;  1PV3 A;  1YQ3 C;  3G9R A;  1NYH A;  4GDO A;  4TT3 H;  2GOV A;  2QIW A;  3AE1 C;  4H0L C;  2FXP A;  1FDI A;  3Q5R A;  3IAO A;  1VF5 B;  2IDB A;  2WQY C;  4PV1 B;  4I7Z C;  2JP3 A;  1DD4 A;  3HH0 A;  2D2C D;  3EWK A;  2WSE J;  4R4M A;  3EZ6 A;  4H13 B;  1RH6 A;  3R4Y A;  3EZF A;  4R24 B;  4Y28 J;  4R22 B;  3GF7 A;  2KVV A;  3EZ2 A;  2O01 J;  3GPV A;  1KIL E;  1KQG B;  1S1C X;  4J2N A;  3GLM A;  2WSF J;  1YQ4 C;  1KQF B;  1VF5 C;  1U57 A;  1EXJ A;  1K05 A;  1S5L X;  4H0L D;  4PV1 C;  1MKM A;  3RL0 g;  4OGQ B;  1Q08 A;  4U7J A;  3Q5P A;  2WSC J;  4A1M A;  4H13 C;  5I44 A;  1NGM B;  3LUR A;  1D5Y A;  5M1B A;  2ZT9 C;  1K04 A;  4H44 D;  4LHF A;  2QJY C;  2E74 C;  4AYZ A;  2QJK C;  1ZME C;  1WMK A;  2IEF A;  2NZ2 A;  4XFJ A;  2YIU C;  3GMA A;  1OW8 A;  2BOW A;  3AE8 C;  1Q09 A;  4R4L A;  3AE3 C;  2E76 D;  1ZOY C;  3AEC C;  3FGA D;  4WLW A;  2E75 C;  1RQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...