3Q2YA

Crystal structure of bmrr bound to ethidium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
b'KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q2yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q2yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q2yA03
4R24B 1Q0AA 1DIPA 1BOWA 2J5UA 3R8KA 1EXIA 3D71A 1Q08A 1Q05A 2JMLA 3GPVA 2BOWA 5E01A 5KAUA 1Q06A 1JYHA 3QAOA 3Q5RA 4R22B 1JBGA 3Q5SA 5I41B 3D6ZA 4R4LA 3T97B 1Q09A 3GP4A 2VZ4A 5GQQA 1Q07A 2GOVA 4WLWA 3B49A 4R4MA 4B0YA 3LURA 5KAWA 3R8JA 2ZHGA 2ZHHA 3IAOA 5D90A 5KAVA 5KAXA 2HVAA 4AYZB 5D8CA 5I44A 3Q5PA 4J2NA 2KCUA 3D6YA 1R8DA 2OQQA 4R4EA 3Q3DA 3D70A 4WLSA 4A1MA 3Q2YA 3GK6A 1EXJA 3G9RA 4AYZA 1D5YA 3HH0A 2DG6A 3E0HA 3Q1MA 1R8EA 3UCSA 5KATA 5KCBA
chains in the Genus database with same CATH superfamily
3WMM0 1SP4A 4IFDK 4PD4E 4N3YB 3W68A 2P58A 4RJTA 3HUSA 1Q07A 2KZIA 4WY4B 1FU1A 1OWAA 1VL2A 3R4YA 1L0NE 1RY3A 1YJ9P 1SQBD 3L73D 1OW8A 1P84H 1OMIA 5CBOA 1JOCA 1FDOA 1SQVE 2D2CB 1PFIA 1GL2C 4Y99C 1L0LD 2AXCA 1EZVD 3L70G 3L73E 3AEBC 5E79H 1QL2A 2Q9IA 3M0AA 3KZIE 1Y9BA 3TSIA 3HD7D 4OGQB 5KJ7D 2PRRA 1HGVA 1L4AB 3H1KJ 3RK2C 2ZXEB 2XZRA 1JMMA 1NTME 2FY8A 2W90A 1JEKA 3L4FA 2WSSH 1OW6A 2WTYA 3LIEA 3L74J 2ZT9C 3AE2C 5KAUA 3VP9A 3VMAA 3CMEP 2WMMA 4QMAA 2NPSC 2Q3IA 4W80A 3H1HE 3C9IA 3MUDC 4GDOA 5KCBA 5C39A 4M3LA 2FYNB 4NPEA 2FYUG 3USSA 2Q6QA 1RE3C 2ZYAA 1MFZA 3L37A 3GLMA 2H7HA 3KZIH 2IBZI 1X8YA 1QVFO 5AVXB 1JO5A 1Z56A 1CSBA 1AVOA 1DD3A 1FOSE 2C9LY 2WSEJ 2G8YA 3M9QA 1SQXE 1FBMA 3T97B 4WWIA 3GP4A 2J58A 5B5EE 1A02J 1KILE 3C1LA 2QG4A 2NZ2A 5CJ4A 3H1LJ 3I56P 1HVVA 4WY4C 2N9YB 1KYOI 2DG6A 5AVYB 3PJSK 5H2FE 1MZ9A 5K5GB 1N8RQ 3L70D 3VP8A 4OWFA 4LHFA 2O3JA 3LW5H 1AV1A 2JWDA 2Y0CA 4LGDE 1CZQA 3EFGA 1VDFA 4WB4A 4BWNA 1PV3A 1S3JA 2W27A 1BE3J 1RQVA 2XV5A 3L70E 1G2CA 4DOJA 1U57A 5AW5B 1Y47A 2HG5D 4OGQC 3TNUA 2K3RA 1LTBC 1IK7A 1J2JB 1FS0E 3RK3D 1L4AC 2KZJA 2YKPA 4D6TJ 3L75D 1A02F 1JUNA 4J2NA 1URQB 1XTCC 2O01H 3H1IJ 2KK7A 2LKMA 3R2PA 2J5UA 4HKZH 1JYHA 1UIIA 2HPCA 3AE4C 2PP6A 1NJIQ 5B5EH 1NTKK 4A7PA 5AVTB 1N7LA 4IFFA 2QA4P 2B87A 1VQ6P 5H2FH 2JWAA 1L0NJ 2BCCD 3S9OA 5E01A 2QM7A 4K35A 3H1KG 3Q5RA 1OIPA 2FYNC 1SQVJ 2WSFJ 3IN6A 1JY2P 2C0WA 1N73A 4W7YA 2A45I 1MV8A 2FYUE 3PTZA 3AEGC 1PP9G 1KQFB 3CX5D 4ASVA 4EDFA 1EXIA 1ZRTE 3HE5A 4PV1C 2KIKA 2ZVNB 1SQBK 1GU4A 3AE9C 3CX5E 1FZFA 2KS1B 1KORA 3WUTA 1QLED 4H0LD 5APTA 1Q81Q 1SFCB 2OARA 1H0TA 2WWWA 1L0LK 3QWOC 2WSCJ 1JM0A 1NU1D 3U59A 3I55P 1PL5A 1DEBA 2QJYB 2I1JA 5I44A 2K9JB 5AVSB 1VQLP 3PP5A 1FC2C 3NMDA 2HYNA 3GF7A 1AFOA 4R24B 3H1HJ 2ZVOB 1VQ8P 4I7ZC 1LWUA 1E5WA 2YXRB 1VQOP 1NTZD 3Q2YA 3OJAB 1URQC 2Q1KA 4H13B 4EOTA 2R44A 3IR9A 1LTAC 4C46A 1LTTC 5BU8B 3GHGC 5TISE 1EC5A 1JBGA 3KYQA 1Q09A 1LJ2A 4R4MA 3LURA 2SPZA 5KAVA 3VTPC 4W7ZA 2HR3A 2XNDH 4L75A 3MTUE 3CX5H 3TF5A 1M1JB 4U3FJ 3H1KD 5M1BA 2QRXA 1NWQA 2I1KA 2IZ1A 1PGJA 4EI2A 3P7KA 2OYIB 1MFTA 1CI6B 1S5LX 3E1RA 2C0XA 1KB9D 3HRNA 3LIDA 4D6TG 2IYOA 3D6YA 2YO3A 3L74D 3H1KE 3CWBG 1LGHB 3H1IG 2K37A 1KC8Q 3H25A 1YTZI 1SQPJ 1NAFA 1S5LE 1KB9E 2FXOA 1PP9E 3O6QA 2FFDB 2J59M 2WT7B 1VQPP 1PGQA 1PM6A 5GTIH 3ITKA 1RF1C 1AA0A 3GPVA 5AW2B 2W6JH 4BRYB 1T8ZA 2GM4A 2K9YA 4JYCA 3QH9A 2PAJA 2B9BA 1ZV8A 2FXMA 3CC7P 3A3YB 1N7SB 3EZ2A 1Q05A 3KHUA 2E43A 1WRGA 2FBWC 3H1LD 1VQ4P 5AVQB 2R3SA 3HTKB 5B66E 3M0DC 1J1DB 2E75B 1P84I 2ITAA 2ZYDA 4NPFX 1IO4A 2OYOA 1OXZA 2K1AA 1KB9H 2YIUC 1BE3D 4Y28J 2E5TA 1RF0C 3HH0A 3TGUJ 3CL3D 3BRVB 1M1JC 4N6JA 5AW3B 1ZP0C 1DX7A 2OYIC 3H1ID 3JC22 1K04A 4WVZA 1EXJA 2KP8A 1VF5C 2YXQB 2QEXP 1JNMA 3GG2A 2CPSA 3PHLA 4D6TE 3CWBE 3HD7B 3D6ZA 3H1IE 4PD4D 1T2KC 5APQA 2HODB 1SQQK 3B5NA 1N86A 4ASWA 4JQ0D 1L0ND 1LTJC 1YHQP 2FFDC 3AE1C 2WSEH 2WPQA 2KLVA 4U3FG 5AVRB 1NU1K 1SQVD 3TDKA 5KLVJ 2E74D 1M57D 1JY2N 4DCZA 3CCJP 1PGOA 2V4HA 3H32B 4AQRD 2BEZF 5CMZA 3M9HA 2IBZG 1QVGO 3H1JJ 2P10A 1PZQA 3O8ZA 1OZHA 1SQPG 1N7SC 2IZ0A 3VMYA 1U7JA 1EZVI 1IJDB 2O1KA 4I1LA 4H44C 3IAOA 5AW7B 3KXDA 1NTZK 1NTMD 5L8RJ 2E5YA 1BGYJ 4AUWA 4ZMDA 3B5ND 3V2NA 1M8OB 1J1DC 2E75C 3C8VA 3RGUA 1KILA 1QX8A 1R5LA 2IYPA 3CLQA 4K3AA 2A06G 4XE5B 4UB6E 1NAYA 2W83C 1PP9J 3H1HD 2WQYC 4GKGA 2QVAA 3AEDC 3BCCJ 1HH0A 1W2BO 2ZYGA 1Q0AA 4UB8E 2E42A 3CD6P 2N1TA 4PD4H 1NOHA 3B49A 1JY3P 2N9BA 2ZHHA 3W67A 3UIAA 1GD2E 2QM8A 2BASA 3NXSA 1R5SA 1EQ7A 1FZGA 2CPBA 2D2CD 3V4WA 1SQXD 3RBZA 3HD7C 4U3FD 1G1JA 5KJ7C 1KILD 3CI9A 5AW0B 1MKMA 1IK9A 4O9BA 3RK3B 1PPJG 3V2PA 3TGUG 4PV1B 2XNXA 1KFMA 1SLQA 1JMBA 2KLUA 1GK6A 4OGQD 2RN0A 3HUSC 2V7QJ 4IL6X 2OGUA 2N1TD 4U3FE 1FZCA 2IBZD 2WSCH 2A45G 4KT0J 5CCGA 1SQPD 3AEFC 4IFMA 3BATA 2P7JA 2XU6A 4IL6E 3HE4A 2FXPA 2IBZE 3K5BA 2KSEA 3CMAP 1KYOD 2ZXXA 3TK1A 1OVUA 1IFMA 1SQPE 4YXWH 2H43A 3EZ9A 3AECC 4I7ZB 1YTZT 1IFNA 2OG0A 1LTIC 2A06D 5KAFE 5KLVG 2R5BA 1VQ7P 1YITP 2AXTE 1KYOE 1LTSC 5CCHA 1VQ9P 3BVHA 3FX0A 3CWBJ 4AYZA 3GHGB 3H1JG 1ZR4A 3P8CD 1GK4A 4HB1A 2A06E 2YKQA 3ZDMA 5CCGD 5I41B 4H0LB 1EDLA 1ZN5A 2AEMA 1XTGB 1HBWA 2B87B 1ZXGA 3AE3C 2OQQA 1S72P 1BGYG 1NTKJ 2JJLA 2JP3A 3OAKA 1YBKA 2FYUD 3P8CE 3U1CA 3CCUP 1OX3A 3IFMA 3A2AA 1ZRTD 1N73B 4IL6H 5TJHA 4LC1A 1NYHA 3BASA 1L0NK 3TGUD 2AEJA 2JO1A 1JTHA 2YNYA 4XFJA 5CCHD 3CX5I 1SQVK 5APYA 3BCCG 2OYHA 4TLFA 3V4QA 3PLNA 3RK3C 3MHVA 3CPWO 1BCCJ 1PPJE 3EFFK 1ZOYC 3TGUE 3V2QA 2AXTH 1KYOH 1ZMEC 1OVVA 1H0TB 1RF1B 1H8AA 3Q1MA 1IZNB 1L2PA 3KQGA 5AW9B 1J1EB 1EDJA 1L0LJ 1NTMK 1ZLLA 1OFCX 3D70A 1D5YA 3CXHD 1USEA 4AYCA 2KS1A 3JSVC 2Q5UA 5KLVD 1SFCA 2YO2A 5CHXA 1KN7A 1HWTC 1AQTA 3R8JA 2WZ7A 2DW3A 1KD1Q 4I6MC 4GT1A 3CXHE 1R8DA 1SVFA 3H1JD 2K9JA 3AE8C 5KLVE 2KNCA 1LNQA 1YYCA 2UWJE 1D7MA 2E76B 2KB7P 2YIUB 1USDA 3H1JE 1U7MA 3S4RA 4H0LC 3GK6A 2NRGA 1SS1A 5KLIB 3WU2E 4GIFA 2ZAEB 3QAOA 2W6BA 1SQXK 4EYYQ 1BGYE 4R4LA 1GW3A 1SFCD 2W6AA 1DEEG 1PP9D 1VF5B 2Z5HA 1VQMP 2M0BA 1N73C 3BCCD 1KMIZ 1LP1A 1QEXA 2WITA 4JBZA 5KATA 5AW4B 4KJMA 3V6IA 2LXBA 3TYYA 3KPEA 3O6QB 4R22B 3MZWB 2OTJP 2Q3EA 4YXDC 4GOFA 4NPDA 1LT9A 3BCCE 1LTJB 3RL0D 3CXHH 1JB0J 2MKVA 1NTKG 1RE4A 5DJTB 1UIXA 5APSA 5APUA 3S1KA 5TISH 2PGDA 5KTBA 1PGPA 3V5BA 1GMJA 4H13D 4GOEA 2OTLP 1J1EC 1ZR2A 3B4SA 1T3UA 1K73Q 1W2EA 1FDMA 1N2DC 4H44B 4C7NA 3U1AA 1LWUC 1DD4A 1BCCG 2ZHGA 5D90A 3CCEP 4BRYA 2C9NY 3L75J 5AW6B 1SQBG 1GL2A 2QIWA 2GUVA 2IPPA 2M8RA 1BSHA 5EFWB 3M06A 1S5LH 3L35A 2QJPC 1L0LG 2E76C 1E79H 1H88A 1EZVG 1KQLA 2FYUK 3IF4A 1M7LA 1Q90D 3VN0A 1IFJA 4KHXA 2BCCJ 5KLIC 4D6TD 3CWBD 1EDKA 4MN4C 3V2RA 3E1IA 1BDCA 1GU5A 2Y0EA 3R8KA 3MIWA 4EIJA 4OH8B 1S9KD 3NFQA 1FJKA 1KQSO 1GL2D 2WPSA 4PD4I 2NPSA 1LT9C 1JCCA 1NTKD 2M3EA 4Z1MH 3A5TA 1NVOA 3MUDA 5B66H 4YPCA 1BSNA 4JF7A 1SQQJ 3CCSP 2V7QH 1S9KE 2YKOA 1GTWA 3HUSB 5AVWB 3WUVA 2BOWA 3L71J 3FWLA 1RE3A 3RK2D 1WT6A 1NU1J 1NO4A 1NTKE 1HGZA 5AVZB 2M5AA 1KV4A 2HODA 4PJ0E 2FYZA 2LXCB 5KLVK 3G6EP 3MGNA 1BCCD 2ZT9D 1Q06A 4HJGH 2Z5IA 2RMZA 5DJUB 1FE6A 3AEEC 4ZKUA 1FDIA 3FGAD 1YJNP 4WY4A 3H32A 2Q7CA 1JY2O 2NPSD 4DJGA 1NTZJ 1BCCE 2H88C 1KILB 4L76A 3B71A 1YJWP 3Q5SA 5GQQA 5AW8B 2POHA 5BVZA 1SQBE 3KDPB 5APVA 1GZLA 2KOGA 2QE7H 4WBAA 2IEFA 2N1TB 1RH6A 1L0LE 2E74C 4TT3H 2GUSA 1EZVE 2YMYA 4YTPC 1L4AA 2BEQD 1S2EA 2JKVA 1X22A 4DCKA 2CK3H 2K88A 4PJ0H 4RKUJ 3L75G 1HTLC 2L5GB 4WY4D 3D71A 1Q08A 2WSFH 3VOPA 3PRJA 1NHLA 2KVVA 3EWKA 1LX8A 1IFPA 3B5NC 1OVRA 3Q3DA 4DT0A 2ZFCA 1OW7A 1DH3A 4JPZB 4JYBA 3SFDC 1QGKB 5KKZB 4RO0A 1FZCB 3AE5C 2BCCG 1CW5A 1KTMA 5KAXA 1W5CE 1L4AD 4UB6H 3N7NA 3FXEA 2KYVA 3F5HA 3GF3A 2O01N 3HE4B 4UB8H 1VPCA 1VQNP 1NH4A 2P67A 5CJ0A 2GA1A 2AEFA 2XKMA 3T97A 3II6A 2KCUA 1Y8AA 1G2CB 1KQGB 3N4XA 2MJZA 3E0HA 4HYTB 3TNUB 1NGMB 1SQQG 3SWYA 1NKZB 2W8ZA 2JMLA 3L36A 2D2CC 1BDDA 3L71G 1T6AA 1KILC 1NU1G 3A0BE 2KSJA 1AVYA 3CCRP 4AYZB 4BXLA 1G1IA 3VMZA 3A7OA 1JCDA 1YIJP 3EZ7A 2QJKB 2HPCB 3B8EB 2N1TC 2R3CA 4PV1D 1IFIA 5D8CA 2JEEA 4IOIH 1URQA 3RBXA 3L72J 1VQ5P 1NTZG 3G4SP 1HJ0A 2KUBA 3GHGA 3RK3E 3WUUA 2I8DA 3JCUE 3L75E 1Q2NA 1JTHB 3MD0A 4OVNF 1PPJD 1WMKA 2HFED 4WLSA 2RKLA 2OYHB 3G9RA 3I5CA 3OW2O 3UCSA 2IX7C 2R32A 1M90Q 1M1KQ 3HE5B 3E7KA 1X9VA 2WPRA 5KAFH 1GW4A 1Q82Q 2KI7B 3A0BH 5KKZC 3RL0g 1FZCC 1RQUA 2O1JA 1H89A 4R4EA 3EZFA 4L74A 3P8MC 1SQBJ 2BCCE 3L73J 3VMXA 4ZKPA 3L74G 1YI2P 5CCGC 3P32A 2JDIH 5BU5A 1URQD 2H8PD 2HLOA 1QL1A 2PFXA 3CCQP 3A0HE 4WLWA 2H89C 1S4XA 1MUUA 4I2LC 1SQQD 4GODA 1IC2A 2Y0DA 1Q86Q 1NTMJ 2LR2A 3CXHI 1AQ5A 1M56D 3H6PA 3L71D 1RF1A 4RESB 3FWNA 1LWUB 3JCUH 2G3AA 1FJPA 5AVUB 1SQQE 5CCHC 2B88A 3LW5J 1LTGC 2KNCB 3L71E 3PH0A 1R8EA 3RL0B 1NU1E 1YQ3C 2QJPB 3SSUA 2YMKA 2QJKC 3ABVC 4ZNCA 1RHZB 1FAVA 2RH0A 2OTKE 1BGYD 3GW6A 5APWA 2P2UA 1X79B 1VQKP 3M0DA 3H1LG 1KZUB 5GTIE 2O01J 3BRTB 1FZAA 3A0HH 3SWKA 1FZEA 1LP1B 2A45H 5KAIE 1NTZE 1KB9I 1SQXJ 3F89A 1RF0A 3M9BA 1K8AQ 1BE3G 2OYHC 1M1JA 1RH5B 3FXDA 3OA7A 1LT9B 2OYIA 1JY3N 3MP7B 4B0YA 1CI6A 1HUCA 1SQPK 5AW1B 3L72G 1T3JA 1S1CX 2WVRA 3L70J 2Y9YA 3L74E 1FOSF 3CC4P 2WPVB 2E76D 2ZJSE 1JY3O 1LTJA 2FFDA 4B86A 2WT7A 2B89A 1L0NG 4C7NB 3WU2H 1KFNA 1SFCC 2GOVA 1NKNA 3CCVP 1SQVG 3EQ2A 5KAWA 5KAIH 1EDIA 1TU3F 3Q5PA 5GTHE 3EZ6A 1K9MQ 2QJYC 1GL2B 1HJBA 4Y99B 4CPGA 2KXPB 1IFDA 3L73G 1DIPA 1VF5D 1X0TA 4U7JA 3GMAA 1N7SA 3RL0C 2VZ4A 2Z4EA 1GDTA 2HVAA 1T2KD 2E74B 2XDJA 3RK2B 1P84D 3G3ZA 3HTKA 1NTMG 4C7RA 2M3BA 2FYUJ 3SWFA 2VRSA 2R5DA 1YQ4C 3H1LE 1ZW0A 4LLHA 4H13C 3G71P 1HF9A 4HH2A 1LT1A 1Y6UA 2P1JA 1Q7YQ 2QSIA 2ZT9B 3NTNA 1P84E 4N78D 3AEAC 4A1MA 3SFEC 1AJYA 2JR8A 1BOWA 1K05A 3H1HG 4DZOA 2NPSB 5CBNA 5APXA 1PIXA 1BE3E 3CCMP 3B5NB 5E79E 2IFMA 1N7SD 4N78E 2FKWB 2L91A 3AE7C 4H44D 3L72D 5GTHH 2IDBA 3CC2P 3VYIA 5AVVB 1FZBA 4XA4A 1RE4C 4L73A 2Y9ZA 2E75D 2M5AB 3HD7A 3L72E 3AE6C 5KJ7A 3M91A 1SQXG 3CCLP 2IFNA
chains in the Genus database with same CATH topology
3AECC 4I7ZB 1PM6A 4R24B 1Q0AA 1Q90D 2O01J 2J5UA 1VF5D 3GF3A 1DIPA 2OG0A 2H88C 3GPVA 4U7JA 3B71A 1JYHA 4I7ZC 3Q5SA 4R22B 3GMAA 5KLIC 3D6ZA 5GQQA 3AE4C 2VZ4A 1Q07A 4YXDC 3B49A 2ZHHA 5KKZC 1VL2A 3GLMA 3R4YA 2K9YA 3RL0g 2HVAA 1RQUA 2KCUA 1OW8A 1OMIA 4R4EA 3D70A 3EZFA 1D5YA 3Q2YA 2E74B 1KQGB 4AYZA 3AE1C 1JB0J 2MKVA 3E0HA 1FDOA 2IEFA 2D2CB 1NGMB 1RH6A 2E74C 4H13B 1UIXA 3EZ2A 3R8KA 1DD3A 4TT3H 1Q05A 2JMLA 3S9OA 5E01A 2D2CC 4YTPC 1YQ4C 2WSEJ 2G8YA 2E74D 3Q5RA 3T97B 1JBGA 4H13C 5I41B 2FYNC 4H0LB 1Q09A 3GP4A 4WLWA 4DCZA 2BEQD 2FBWC 2D2CD 4R4MA 1HF9A 3LURA 4B0YA 3R8JA 1KILE 2H89C 1Y6UA 2WSFJ 1GMJA 3IN6A 4H13D 3AEBC 5KAVA 4AYZB 2NZ2A 2QSIA 4Z1MH 2BEZF 2ZT9B 1R8DA 3AE3C 2OQQA 1Y9BA 3AEAC 4RKUJ 3SFEC 1AJYA 1MKMA 4A1MA 2E75B 3AEGC 2DG6A 3AE8C 4OGQB 1KQFB 2JP3A 5M1BA 3EZ7A 4PV1B 1BOWA 1K05A 1EXIA 1ZRTE 2P10A 3D71A 1Q08A 2BOWA 2E76B 1S1CX 4H44B 4LHFA 4PV1C 2G3AA 4OGQD 1S5LX 2V7QJ 2KVVA 1DD4A 1PIXA 4IL6X 4PV1D 4H44C 2ZHGA 3IAOA 5D90A 3EWKA 1LX8A 2YIUC 1NYHA 5D8CA 4H0LC 3D6YA 2WPVB 2E76D 2JO1A 3AE7C 3AE9C 3LW5J 4H44D 5L8RJ 4Y28J 3Q3DA 1PV3A 2IDBA 3GK6A 1KORA 1OW6A 4XFJA 3HH0A 1OW7A 4H0LD 1R8EA 2ZT9C 1RQVA 3AE2C 4KT0J 3SFDC 1U57A 1HJ0A 2QIWA 2E75C 4OGQC 2ZT9D 5KAUA 3AEFC 3RK3E 2WSCJ 1Q06A 1YQ3C 3H25A 3QAOA 3C8VA 2YMKA 4R4LA 1IK7A 2QJKC 3AE5C 2E75D 3ABVC 1ZP0C 2GOVA 3O6QA 1PL5A 2FXPA 5KAWA 1KTMA 1ZOYC 2QJPC 2E76C 1TU3F 1K04A 1ZMEC 3AE6C 5KAXA 5I44A 3Q5PA 1VF5B 4J2NA 3AEEC 1FDIA 3FGAD 1WMKA 1KMIZ 3EZ6A 2QJYC 4WLSA 4GDOA 1EXJA 3G9RA 2WQYC 1VF5C 3Q1MA 3AEDC 3EZ9A 3UCSA 3GF7A 5KATA 5KCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R24 B;  1Q0A A;  1DIP A;  1BOW A;  2J5U A;  3R8K A;  1EXI A;  3D71 A;  1Q08 A;  1Q05 A;  2JML A;  3GPV A;  2BOW A;  5E01 A;  5KAU A;  1Q06 A;  1JYH A;  3QAO A;  3Q5R A;  4R22 B;  1JBG A;  3Q5S A;  5I41 B;  3D6Z A;  4R4L A;  3T97 B;  1Q09 A;  3GP4 A;  2VZ4 A;  5GQQ A;  1Q07 A;  2GOV A;  4WLW A;  3B49 A;  4R4M A;  4B0Y A;  3LUR A;  5KAW A;  3R8J A;  2ZHG A;  2ZHH A;  3IAO A;  5D90 A;  5KAV A;  5KAX A;  2HVA A;  4AYZ B;  5D8C A;  5I44 A;  3Q5P A;  4J2N A;  2KCU A;  3D6Y A;  1R8D A;  2OQQ A;  4R4E A;  3Q3D A;  3D70 A;  4WLS A;  4A1M A;  3Q2Y A;  3GK6 A;  1EXJ A;  3G9R A;  4AYZ A;  1D5Y A;  3HH0 A;  2DG6 A;  3E0H A;  3Q1M A;  1R8E A;  3UCS A;  5KAT A;  5KCB A; 
#chains in the Genus database with same CATH topology
 3WMM 0;  1SP4 A;  4IFD K;  4PD4 E;  4N3Y B;  3W68 A;  2P58 A;  4RJT A;  3HUS A;  1Q07 A;  2KZI A;  4WY4 B;  1FU1 A;  1OWA A;  1VL2 A;  3R4Y A;  1L0N E;  1RY3 A;  1YJ9 P;  1SQB D;  3L73 D;  1OW8 A;  1P84 H;  1OMI A;  5CBO A;  1JOC A;  1FDO A;  1SQV E;  2D2C B;  1PFI A;  1GL2 C;  4Y99 C;  1L0L D;  2AXC A;  1EZV D;  3L70 G;  3L73 E;  3AEB C;  5E79 H;  1QL2 A;  2Q9I A;  3M0A A;  3KZI E;  1Y9B A;  3TSI A;  3HD7 D;  4OGQ B;  5KJ7 D;  2PRR A;  1HGV A;  1L4A B;  3H1K J;  3RK2 C;  2ZXE B;  2XZR A;  1JMM A;  1NTM E;  2FY8 A;  2W90 A;  1JEK A;  3L4F A;  2WSS H;  1OW6 A;  2WTY A;  3LIE A;  3L74 J;  2ZT9 C;  3AE2 C;  5KAU A;  3VP9 A;  3VMA A;  3CME P;  2WMM A;  4QMA A;  2NPS C;  2Q3I A;  4W80 A;  3H1H E;  3C9I A;  3MUD C;  4GDO A;  5KCB A;  5C39 A;  4M3L A;  2FYN B;  4NPE A;  2FYU G;  3USS A;  2Q6Q A;  1RE3 C;  2ZYA A;  1MFZ A;  3L37 A;  3GLM A;  2H7H A;  3KZI H;  2IBZ I;  1X8Y A;  1QVF O;  5AVX B;  1JO5 A;  1Z56 A;  1CSB A;  1AVO A;  1DD3 A;  1FOS E;  2C9L Y;  2WSE J;  2G8Y A;  3M9Q A;  1SQX E;  1FBM A;  3T97 B;  4WWI A;  3GP4 A;  2J58 A;  5B5E E;  1A02 J;  1KIL E;  3C1L A;  2QG4 A;  2NZ2 A;  5CJ4 A;  3H1L J;  3I56 P;  1HVV A;  4WY4 C;  2N9Y B;  1KYO I;  2DG6 A;  5AVY B;  3PJS K;  5H2F E;  1MZ9 A;  5K5G B;  1N8R Q;  3L70 D;  3VP8 A;  4OWF A;  4LHF A;  2O3J A;  3LW5 H;  1AV1 A;  2JWD A;  2Y0C A;  4LGD E;  1CZQ A;  3EFG A;  1VDF A;  4WB4 A;  4BWN A;  1PV3 A;  1S3J A;  2W27 A;  1BE3 J;  1RQV A;  2XV5 A;  3L70 E;  1G2C A;  4DOJ A;  1U57 A;  5AW5 B;  1Y47 A;  2HG5 D;  4OGQ C;  3TNU A;  2K3R A;  1LTB C;  1IK7 A;  1J2J B;  1FS0 E;  3RK3 D;  1L4A C;  2KZJ A;  2YKP A;  4D6T J;  3L75 D;  1A02 F;  1JUN A;  4J2N A;  1URQ B;  1XTC C;  2O01 H;  3H1I J;  2KK7 A;  2LKM A;  3R2P A;  2J5U A;  4HKZ H;  1JYH A;  1UII A;  2HPC A;  3AE4 C;  2PP6 A;  1NJI Q;  5B5E H;  1NTK K;  4A7P A;  5AVT B;  1N7L A;  4IFF A;  2QA4 P;  2B87 A;  1VQ6 P;  5H2F H;  2JWA A;  1L0N J;  2BCC D;  3S9O A;  5E01 A;  2QM7 A;  4K35 A;  3H1K G;  3Q5R A;  1OIP A;  2FYN C;  1SQV J;  2WSF J;  3IN6 A;  1JY2 P;  2C0W A;  1N73 A;  4W7Y A;  2A45 I;  1MV8 A;  2FYU E;  3PTZ A;  3AEG C;  1PP9 G;  1KQF B;  3CX5 D;  4ASV A;  4EDF A;  1EXI A;  1ZRT E;  3HE5 A;  4PV1 C;  2KIK A;  2ZVN B;  1SQB K;  1GU4 A;  3AE9 C;  3CX5 E;  1FZF A;  2KS1 B;  1KOR A;  3WUT A;  1QLE D;  4H0L D;  5APT A;  1Q81 Q;  1SFC B;  2OAR A;  1H0T A;  2WWW A;  1L0L K;  3QWO C;  2WSC J;  1JM0 A;  1NU1 D;  3U59 A;  3I55 P;  1PL5 A;  1DEB A;  2QJY B;  2I1J A;  5I44 A;  2K9J B;  5AVS B;  1VQL P;  3PP5 A;  1FC2 C;  3NMD A;  2HYN A;  3GF7 A;  1AFO A;  4R24 B;  3H1H J;  2ZVO B;  1VQ8 P;  4I7Z C;  1LWU A;  1E5W A;  2YXR B;  1VQO P;  1NTZ D;  3Q2Y A;  3OJA B;  1URQ C;  2Q1K A;  4H13 B;  4EOT A;  2R44 A;  3IR9 A;  1LTA C;  4C46 A;  1LTT C;  5BU8 B;  3GHG C;  5TIS E;  1EC5 A;  1JBG A;  3KYQ A;  1Q09 A;  1LJ2 A;  4R4M A;  3LUR A;  2SPZ A;  5KAV A;  3VTP C;  4W7Z A;  2HR3 A;  2XND H;  4L75 A;  3MTU E;  3CX5 H;  3TF5 A;  1M1J B;  4U3F J;  3H1K D;  5M1B A;  2QRX A;  1NWQ A;  2I1K A;  2IZ1 A;  1PGJ A;  4EI2 A;  3P7K A;  2OYI B;  1MFT A;  1CI6 B;  1S5L X;  3E1R A;  2C0X A;  1KB9 D;  3HRN A;  3LID A;  4D6T G;  2IYO A;  3D6Y A;  2YO3 A;  3L74 D;  3H1K E;  3CWB G;  1LGH B;  3H1I G;  2K37 A;  1KC8 Q;  3H25 A;  1YTZ I;  1SQP J;  1NAF A;  1S5L E;  1KB9 E;  2FXO A;  1PP9 E;  3O6Q A;  2FFD B;  2J59 M;  2WT7 B;  1VQP P;  1PGQ A;  1PM6 A;  5GTI H;  3ITK A;  1RF1 C;  1AA0 A;  3GPV A;  5AW2 B;  2W6J H;  4BRY B;  1T8Z A;  2GM4 A;  2K9Y A;  4JYC A;  3QH9 A;  2PAJ A;  2B9B A;  1ZV8 A;  2FXM A;  3CC7 P;  3A3Y B;  1N7S B;  3EZ2 A;  1Q05 A;  3KHU A;  2E43 A;  1WRG A;  2FBW C;  3H1L D;  1VQ4 P;  5AVQ B;  2R3S A;  3HTK B;  5B66 E;  3M0D C;  1J1D B;  2E75 B;  1P84 I;  2ITA A;  2ZYD A;  4NPF X;  1IO4 A;  2OYO A;  1OXZ A;  2K1A A;  1KB9 H;  2YIU C;  1BE3 D;  4Y28 J;  2E5T A;  1RF0 C;  3HH0 A;  3TGU J;  3CL3 D;  3BRV B;  1M1J C;  4N6J A;  5AW3 B;  1ZP0 C;  1DX7 A;  2OYI C;  3H1I D;  3JC2 2;  1K04 A;  4WVZ A;  1EXJ A;  2KP8 A;  1VF5 C;  2YXQ B;  2QEX P;  1JNM A;  3GG2 A;  2CPS A;  3PHL A;  4D6T E;  3CWB E;  3HD7 B;  3D6Z A;  3H1I E;  4PD4 D;  1T2K C;  5APQ A;  2HOD B;  1SQQ K;  3B5N A;  1N86 A;  4ASW A;  4JQ0 D;  1L0N D;  1LTJ C;  1YHQ P;  2FFD C;  3AE1 C;  2WSE H;  2WPQ A;  2KLV A;  4U3F G;  5AVR B;  1NU1 K;  1SQV D;  3TDK A;  5KLV J;  2E74 D;  1M57 D;  1JY2 N;  4DCZ A;  3CCJ P;  1PGO A;  2V4H A;  3H32 B;  4AQR D;  2BEZ F;  5CMZ A;  3M9H A;  2IBZ G;  1QVG O;  3H1J J;  2P10 A;  1PZQ A;  3O8Z A;  1OZH A;  1SQP G;  1N7S C;  2IZ0 A;  3VMY A;  1U7J A;  1EZV I;  1IJD B;  2O1K A;  4I1L A;  4H44 C;  3IAO A;  5AW7 B;  3KXD A;  1NTZ K;  1NTM D;  5L8R J;  2E5Y A;  1BGY J;  4AUW A;  4ZMD A;  3B5N D;  3V2N A;  1M8O B;  1J1D C;  2E75 C;  3C8V A;  3RGU A;  1KIL A;  1QX8 A;  1R5L A;  2IYP A;  3CLQ A;  4K3A A;  2A06 G;  4XE5 B;  4UB6 E;  1NAY A;  2W83 C;  1PP9 J;  3H1H D;  2WQY C;  4GKG A;  2QVA A;  3AED C;  3BCC J;  1HH0 A;  1W2B O;  2ZYG A;  1Q0A A;  4UB8 E;  2E42 A;  3CD6 P;  2N1T A;  4PD4 H;  1NOH A;  3B49 A;  1JY3 P;  2N9B A;  2ZHH A;  3W67 A;  3UIA A;  1GD2 E;  2QM8 A;  2BAS A;  3NXS A;  1R5S A;  1EQ7 A;  1FZG A;  2CPB A;  2D2C D;  3V4W A;  1SQX D;  3RBZ A;  3HD7 C;  4U3F D;  1G1J A;  5KJ7 C;  1KIL D;  3CI9 A;  5AW0 B;  1MKM A;  1IK9 A;  4O9B A;  3RK3 B;  1PPJ G;  3V2P A;  3TGU G;  4PV1 B;  2XNX A;  1KFM A;  1SLQ A;  1JMB A;  2KLU A;  1GK6 A;  4OGQ D;  2RN0 A;  3HUS C;  2V7Q J;  4IL6 X;  2OGU A;  2N1T D;  4U3F E;  1FZC A;  2IBZ D;  2WSC H;  2A45 G;  4KT0 J;  5CCG A;  1SQP D;  3AEF C;  4IFM A;  3BAT A;  2P7J A;  2XU6 A;  4IL6 E;  3HE4 A;  2FXP A;  2IBZ E;  3K5B A;  2KSE A;  3CMA P;  1KYO D;  2ZXX A;  3TK1 A;  1OVU A;  1IFM A;  1SQP E;  4YXW H;  2H43 A;  3EZ9 A;  3AEC C;  4I7Z B;  1YTZ T;  1IFN A;  2OG0 A;  1LTI C;  2A06 D;  5KAF E;  5KLV G;  2R5B A;  1VQ7 P;  1YIT P;  2AXT E;  1KYO E;  1LTS C;  5CCH A;  1VQ9 P;  3BVH A;  3FX0 A;  3CWB J;  4AYZ A;  3GHG B;  3H1J G;  1ZR4 A;  3P8C D;  1GK4 A;  4HB1 A;  2A06 E;  2YKQ A;  3ZDM A;  5CCG D;  5I41 B;  4H0L B;  1EDL A;  1ZN5 A;  2AEM A;  1XTG B;  1HBW A;  2B87 B;  1ZXG A;  3AE3 C;  2OQQ A;  1S72 P;  1BGY G;  1NTK J;  2JJL A;  2JP3 A;  3OAK A;  1YBK A;  2FYU D;  3P8C E;  3U1C A;  3CCU P;  1OX3 A;  3IFM A;  3A2A A;  1ZRT D;  1N73 B;  4IL6 H;  5TJH A;  4LC1 A;  1NYH A;  3BAS A;  1L0N K;  3TGU D;  2AEJ A;  2JO1 A;  1JTH A;  2YNY A;  4XFJ A;  5CCH D;  3CX5 I;  1SQV K;  5APY A;  3BCC G;  2OYH A;  4TLF A;  3V4Q A;  3PLN A;  3RK3 C;  3MHV A;  3CPW O;  1BCC J;  1PPJ E;  3EFF K;  1ZOY C;  3TGU E;  3V2Q A;  2AXT H;  1KYO H;  1ZME C;  1OVV A;  1H0T B;  1RF1 B;  1H8A A;  3Q1M A;  1IZN B;  1L2P A;  3KQG A;  5AW9 B;  1J1E B;  1EDJ A;  1L0L J;  1NTM K;  1ZLL A;  1OFC X;  3D70 A;  1D5Y A;  3CXH D;  1USE A;  4AYC A;  2KS1 A;  3JSV C;  2Q5U A;  5KLV D;  1SFC A;  2YO2 A;  5CHX A;  1KN7 A;  1HWT C;  1AQT A;  3R8J A;  2WZ7 A;  2DW3 A;  1KD1 Q;  4I6M C;  4GT1 A;  3CXH E;  1R8D A;  1SVF A;  3H1J D;  2K9J A;  3AE8 C;  5KLV E;  2KNC A;  1LNQ A;  1YYC A;  2UWJ E;  1D7M A;  2E76 B;  2KB7 P;  2YIU B;  1USD A;  3H1J E;  1U7M A;  3S4R A;  4H0L C;  3GK6 A;  2NRG A;  1SS1 A;  5KLI B;  3WU2 E;  4GIF A;  2ZAE B;  3QAO A;  2W6B A;  1SQX K;  4EYY Q;  1BGY E;  4R4L A;  1GW3 A;  1SFC D;  2W6A A;  1DEE G;  1PP9 D;  1VF5 B;  2Z5H A;  1VQM P;  2M0B A;  1N73 C;  3BCC D;  1KMI Z;  1LP1 A;  1QEX A;  2WIT A;  4JBZ A;  5KAT A;  5AW4 B;  4KJM A;  3V6I A;  2LXB A;  3TYY A;  3KPE A;  3O6Q B;  4R22 B;  3MZW B;  2OTJ P;  2Q3E A;  4YXD C;  4GOF A;  4NPD A;  1LT9 A;  3BCC E;  1LTJ B;  3RL0 D;  3CXH H;  1JB0 J;  2MKV A;  1NTK G;  1RE4 A;  5DJT B;  1UIX A;  5APS A;  5APU A;  3S1K A;  5TIS H;  2PGD A;  5KTB A;  1PGP A;  3V5B A;  1GMJ A;  4H13 D;  4GOE A;  2OTL P;  1J1E C;  1ZR2 A;  3B4S A;  1T3U A;  1K73 Q;  1W2E A;  1FDM A;  1N2D C;  4H44 B;  4C7N A;  3U1A A;  1LWU C;  1DD4 A;  1BCC G;  2ZHG A;  5D90 A;  3CCE P;  4BRY A;  2C9N Y;  3L75 J;  5AW6 B;  1SQB G;  1GL2 A;  2QIW A;  2GUV A;  2IPP A;  2M8R A;  1BSH A;  5EFW B;  3M06 A;  1S5L H;  3L35 A;  2QJP C;  1L0L G;  2E76 C;  1E79 H;  1H88 A;  1EZV G;  1KQL A;  2FYU K;  3IF4 A;  1M7L A;  1Q90 D;  3VN0 A;  1IFJ A;  4KHX A;  2BCC J;  5KLI C;  4D6T D;  3CWB D;  1EDK A;  4MN4 C;  3V2R A;  3E1I A;  1BDC A;  1GU5 A;  2Y0E A;  3R8K A;  3MIW A;  4EIJ A;  4OH8 B;  1S9K D;  3NFQ A;  1FJK A;  1KQS O;  1GL2 D;  2WPS A;  4PD4 I;  2NPS A;  1LT9 C;  1JCC A;  1NTK D;  2M3E A;  4Z1M H;  3A5T A;  1NVO A;  3MUD A;  5B66 H;  4YPC A;  1BSN A;  4JF7 A;  1SQQ J;  3CCS P;  2V7Q H;  1S9K E;  2YKO A;  1GTW A;  3HUS B;  5AVW B;  3WUV A;  2BOW A;  3L71 J;  3FWL A;  1RE3 A;  3RK2 D;  1WT6 A;  1NU1 J;  1NO4 A;  1NTK E;  1HGZ A;  5AVZ B;  2M5A A;  1KV4 A;  2HOD A;  4PJ0 E;  2FYZ A;  2LXC B;  5KLV K;  3G6E P;  3MGN A;  1BCC D;  2ZT9 D;  1Q06 A;  4HJG H;  2Z5I A;  2RMZ A;  5DJU B;  1FE6 A;  3AEE C;  4ZKU A;  1FDI A;  3FGA D;  1YJN P;  4WY4 A;  3H32 A;  2Q7C A;  1JY2 O;  2NPS D;  4DJG A;  1NTZ J;  1BCC E;  2H88 C;  1KIL B;  4L76 A;  3B71 A;  1YJW P;  3Q5S A;  5GQQ A;  5AW8 B;  2POH A;  5BVZ A;  1SQB E;  3KDP B;  5APV A;  1GZL A;  2KOG A;  2QE7 H;  4WBA A;  2IEF A;  2N1T B;  1RH6 A;  1L0L E;  2E74 C;  4TT3 H;  2GUS A;  1EZV E;  2YMY A;  4YTP C;  1L4A A;  2BEQ D;  1S2E A;  2JKV A;  1X22 A;  4DCK A;  2CK3 H;  2K88 A;  4PJ0 H;  4RKU J;  3L75 G;  1HTL C;  2L5G B;  4WY4 D;  3D71 A;  1Q08 A;  2WSF H;  3VOP A;  3PRJ A;  1NHL A;  2KVV A;  3EWK A;  1LX8 A;  1IFP A;  3B5N C;  1OVR A;  3Q3D A;  4DT0 A;  2ZFC A;  1OW7 A;  1DH3 A;  4JPZ B;  4JYB A;  3SFD C;  1QGK B;  5KKZ B;  4RO0 A;  1FZC B;  3AE5 C;  2BCC G;  1CW5 A;  1KTM A;  5KAX A;  1W5C E;  1L4A D;  4UB6 H;  3N7N A;  3FXE A;  2KYV A;  3F5H A;  3GF3 A;  2O01 N;  3HE4 B;  4UB8 H;  1VPC A;  1VQN P;  1NH4 A;  2P67 A;  5CJ0 A;  2GA1 A;  2AEF A;  2XKM A;  3T97 A;  3II6 A;  2KCU A;  1Y8A A;  1G2C B;  1KQG B;  3N4X A;  2MJZ A;  3E0H A;  4HYT B;  3TNU B;  1NGM B;  1SQQ G;  3SWY A;  1NKZ B;  2W8Z A;  2JML A;  3L36 A;  2D2C C;  1BDD A;  3L71 G;  1T6A A;  1KIL C;  1NU1 G;  3A0B E;  2KSJ A;  1AVY A;  3CCR P;  4AYZ B;  4BXL A;  1G1I A;  3VMZ A;  3A7O A;  1JCD A;  1YIJ P;  3EZ7 A;  2QJK B;  2HPC B;  3B8E B;  2N1T C;  2R3C A;  4PV1 D;  1IFI A;  5D8C A;  2JEE A;  4IOI H;  1URQ A;  3RBX A;  3L72 J;  1VQ5 P;  1NTZ G;  3G4S P;  1HJ0 A;  2KUB A;  3GHG A;  3RK3 E;  3WUU A;  2I8D A;  3JCU E;  3L75 E;  1Q2N A;  1JTH B;  3MD0 A;  4OVN F;  1PPJ D;  1WMK A;  2HFE D;  4WLS A;  2RKL A;  2OYH B;  3G9R A;  3I5C A;  3OW2 O;  3UCS A;  2IX7 C;  2R32 A;  1M90 Q;  1M1K Q;  3HE5 B;  3E7K A;  1X9V A;  2WPR A;  5KAF H;  1GW4 A;  1Q82 Q;  2KI7 B;  3A0B H;  5KKZ C;  3RL0 g;  1FZC C;  1RQU A;  2O1J A;  1H89 A;  4R4E A;  3EZF A;  4L74 A;  3P8M C;  1SQB J;  2BCC E;  3L73 J;  3VMX A;  4ZKP A;  3L74 G;  1YI2 P;  5CCG C;  3P32 A;  2JDI H;  5BU5 A;  1URQ D;  2H8P D;  2HLO A;  1QL1 A;  2PFX A;  3CCQ P;  3A0H E;  4WLW A;  2H89 C;  1S4X A;  1MUU A;  4I2L C;  1SQQ D;  4GOD A;  1IC2 A;  2Y0D A;  1Q86 Q;  1NTM J;  2LR2 A;  3CXH I;  1AQ5 A;  1M56 D;  3H6P A;  3L71 D;  1RF1 A;  4RES B;  3FWN A;  1LWU B;  3JCU H;  2G3A A;  1FJP A;  5AVU B;  1SQQ E;  5CCH C;  2B88 A;  3LW5 J;  1LTG C;  2KNC B;  3L71 E;  3PH0 A;  1R8E A;  3RL0 B;  1NU1 E;  1YQ3 C;  2QJP B;  3SSU A;  2YMK A;  2QJK C;  3ABV C;  4ZNC A;  1RHZ B;  1FAV A;  2RH0 A;  2OTK E;  1BGY D;  3GW6 A;  5APW A;  2P2U A;  1X79 B;  1VQK P;  3M0D A;  3H1L G;  1KZU B;  5GTI E;  2O01 J;  3BRT B;  1FZA A;  3A0H H;  3SWK A;  1FZE A;  1LP1 B;  2A45 H;  5KAI E;  1NTZ E;  1KB9 I;  1SQX J;  3F89 A;  1RF0 A;  3M9B A;  1K8A Q;  1BE3 G;  2OYH C;  1M1J A;  1RH5 B;  3FXD A;  3OA7 A;  1LT9 B;  2OYI A;  1JY3 N;  3MP7 B;  4B0Y A;  1CI6 A;  1HUC A;  1SQP K;  5AW1 B;  3L72 G;  1T3J A;  1S1C X;  2WVR A;  3L70 J;  2Y9Y A;  3L74 E;  1FOS F;  3CC4 P;  2WPV B;  2E76 D;  2ZJS E;  1JY3 O;  1LTJ A;  2FFD A;  4B86 A;  2WT7 A;  2B89 A;  1L0N G;  4C7N B;  3WU2 H;  1KFN A;  1SFC C;  2GOV A;  1NKN A;  3CCV P;  1SQV G;  3EQ2 A;  5KAW A;  5KAI H;  1EDI A;  1TU3 F;  3Q5P A;  5GTH E;  3EZ6 A;  1K9M Q;  2QJY C;  1GL2 B;  1HJB A;  4Y99 B;  4CPG A;  2KXP B;  1IFD A;  3L73 G;  1DIP A;  1VF5 D;  1X0T A;  4U7J A;  3GMA A;  1N7S A;  3RL0 C;  2VZ4 A;  2Z4E A;  1GDT A;  2HVA A;  1T2K D;  2E74 B;  2XDJ A;  3RK2 B;  1P84 D;  3G3Z A;  3HTK A;  1NTM G;  4C7R A;  2M3B A;  2FYU J;  3SWF A;  2VRS A;  2R5D A;  1YQ4 C;  3H1L E;  1ZW0 A;  4LLH A;  4H13 C;  3G71 P;  1HF9 A;  4HH2 A;  1LT1 A;  1Y6U A;  2P1J A;  1Q7Y Q;  2QSI A;  2ZT9 B;  3NTN A;  1P84 E;  4N78 D;  3AEA C;  4A1M A;  3SFE C;  1AJY A;  2JR8 A;  1BOW A;  1K05 A;  3H1H G;  4DZO A;  2NPS B;  5CBN A;  5APX A;  1PIX A;  1BE3 E;  3CCM P;  3B5N B;  5E79 E;  2IFM A;  1N7S D;  4N78 E;  2FKW B;  2L91 A;  3AE7 C;  4H44 D;  3L72 D;  5GTH H;  2IDB A;  3CC2 P;  3VYI A;  5AVV B;  1FZB A;  4XA4 A;  1RE4 C;  4L73 A;  2Y9Z A;  2E75 D;  2M5A B;  3HD7 A;  3L72 E;  3AE6 C;  5KJ7 A;  3M91 A;  1SQX G;  3CCL P;  2IFN A; 
#chains in the Genus database with same CATH homology
 3AEC C;  4I7Z B;  1PM6 A;  4R24 B;  1Q0A A;  1Q90 D;  2O01 J;  2J5U A;  1VF5 D;  3GF3 A;  1DIP A;  2OG0 A;  2H88 C;  3GPV A;  4U7J A;  3B71 A;  1JYH A;  4I7Z C;  3Q5S A;  4R22 B;  3GMA A;  5KLI C;  3D6Z A;  5GQQ A;  3AE4 C;  2VZ4 A;  1Q07 A;  4YXD C;  3B49 A;  2ZHH A;  5KKZ C;  1VL2 A;  3GLM A;  3R4Y A;  2K9Y A;  3RL0 g;  2HVA A;  1RQU A;  2KCU A;  1OW8 A;  1OMI A;  4R4E A;  3D70 A;  3EZF A;  1D5Y A;  3Q2Y A;  2E74 B;  1KQG B;  4AYZ A;  3AE1 C;  1JB0 J;  2MKV A;  3E0H A;  1FDO A;  2IEF A;  2D2C B;  1NGM B;  1RH6 A;  2E74 C;  4H13 B;  1UIX A;  3EZ2 A;  3R8K A;  1DD3 A;  4TT3 H;  1Q05 A;  2JML A;  3S9O A;  5E01 A;  2D2C C;  4YTP C;  1YQ4 C;  2WSE J;  2G8Y A;  2E74 D;  3Q5R A;  3T97 B;  1JBG A;  4H13 C;  5I41 B;  2FYN C;  4H0L B;  1Q09 A;  3GP4 A;  4WLW A;  4DCZ A;  2BEQ D;  2FBW C;  2D2C D;  4R4M A;  1HF9 A;  3LUR A;  4B0Y A;  3R8J A;  1KIL E;  2H89 C;  1Y6U A;  2WSF J;  1GMJ A;  3IN6 A;  4H13 D;  3AEB C;  5KAV A;  4AYZ B;  2NZ2 A;  2QSI A;  4Z1M H;  2BEZ F;  2ZT9 B;  1R8D A;  3AE3 C;  2OQQ A;  1Y9B A;  3AEA C;  4RKU J;  3SFE C;  1AJY A;  1MKM A;  4A1M A;  2E75 B;  3AEG C;  2DG6 A;  3AE8 C;  4OGQ B;  1KQF B;  2JP3 A;  5M1B A;  3EZ7 A;  4PV1 B;  1BOW A;  1K05 A;  1EXI A;  1ZRT E;  2P10 A;  3D71 A;  1Q08 A;  2BOW A;  2E76 B;  1S1C X;  4H44 B;  4LHF A;  4PV1 C;  2G3A A;  4OGQ D;  1S5L X;  2V7Q J;  2KVV A;  1DD4 A;  1PIX A;  4IL6 X;  4PV1 D;  4H44 C;  2ZHG A;  3IAO A;  5D90 A;  3EWK A;  1LX8 A;  2YIU C;  1NYH A;  5D8C A;  4H0L C;  3D6Y A;  2WPV B;  2E76 D;  2JO1 A;  3AE7 C;  3AE9 C;  3LW5 J;  4H44 D;  5L8R J;  4Y28 J;  3Q3D A;  1PV3 A;  2IDB A;  3GK6 A;  1KOR A;  1OW6 A;  4XFJ A;  3HH0 A;  1OW7 A;  4H0L D;  1R8E A;  2ZT9 C;  1RQV A;  3AE2 C;  4KT0 J;  3SFD C;  1U57 A;  1HJ0 A;  2QIW A;  2E75 C;  4OGQ C;  2ZT9 D;  5KAU A;  3AEF C;  3RK3 E;  2WSC J;  1Q06 A;  1YQ3 C;  3H25 A;  3QAO A;  3C8V A;  2YMK A;  4R4L A;  1IK7 A;  2QJK C;  3AE5 C;  2E75 D;  3ABV C;  1ZP0 C;  2GOV A;  3O6Q A;  1PL5 A;  2FXP A;  5KAW A;  1KTM A;  1ZOY C;  2QJP C;  2E76 C;  1TU3 F;  1K04 A;  1ZME C;  3AE6 C;  5KAX A;  5I44 A;  3Q5P A;  1VF5 B;  4J2N A;  3AEE C;  1FDI A;  3FGA D;  1WMK A;  1KMI Z;  3EZ6 A;  2QJY C;  4WLS A;  4GDO A;  1EXJ A;  3G9R A;  2WQY C;  1VF5 C;  3Q1M A;  3AED C;  3EZ9 A;  3UCS A;  3GF7 A;  5KAT A;  5KCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...