3Q2YA

Crystal structure of bmrr bound to ethidium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q2yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q2yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q2yA03
3Q2YA 3GP4A 1R8DA 2OQQA 1JBGA 4J2NA 1Q0AA 4AYZB 1Q08A 3Q5RA 3Q5PA 5D90A 3D70A 3R8JA 5D8CA 1Q06A 1EXJA 2J5UA 3QAOA 3IAOA 5I41B 3Q3DA 1JYHA 3E0HA 3Q1MA 5KATA 5KCBA 3UCSA 5GQQA 4AYZA 1Q09A 1EXIA 5KAVA 5KAWA 4B0YA 2DG6A 1Q05A 2ZHHA 4R24B 4R4EA 1BOWA 1Q07A 2BOWA 2HVAA 3G9RA 3GK6A 4R4MA 4R4LA 3GPVA 2KCUA 4A1MA 5E01A 3D71A 3HH0A 3D6ZA 1R8EA 2ZHGA 2GOVA 2VZ4A 5KAXA 3Q5SA 3B49A 1DIPA 1D5YA 5KAUA 2JMLA 5I44A 3T97B 3R8KA 4R22B 4WLSA 3LURA 4WLWA 3D6YA
chains in the Genus database with same CATH superfamily
4GDOA 1E79H 1M56D 1IFJA 3PLNA 4B86A 1AJYA 1T8ZA 2HVAA 5CJ4A 4LLHA 2B87B 4LC1A 1AVOA 3GHGC 1SVFA 1G1JA 2WT7B 1J2JB 2FFDA 4H13C 1G2CA 1YIJP 5GTHE 2NPSB 5KLVE 1YJWP 3G3ZA 3TNUB 2K3RA 5I41B 2K9YA 1KFNA 3BCCE 1SQXJ 1U57A 2R3CA 3H1KE 4Y99B 3CWBD 5EFWB 4DT0A 1GK4A 3Q5RA 2QRXA 3H1HJ 1R5LA 2M8RA 2PP6A 4L75A 1FDOA 1NKNA 4WY4A 1E5WA 4JQ0D 2I1KA 2YO2A 4D6TD 1NHLA 3GPVA 2KCUA 1N7LA 2B9BA 3TGUG 3L4FA 4EDFA 2OQQA 1FBMA 4WY4D 1SQXE 3L73G 1R5SA 1HUCA 3H6PA 1HH0A 2IYOA 1GZLA 1K05A 3BASA 2M5AB 1VL2A 2BCCD 2I8DA 5KLIC 2HPCA 2KNCA 2KZJA 2YKPA 2FXMA 3IN6A 4U3FJ 1FS0E 1EDIA 1FU1A 1NO4A 1KILB 2Q3IA 3CI9A 2IPPA 3EWKA 2E5TA 1RE4A 3JCUH 2FXOA 3CLQA 4EYYQ 1OIPA 2D2CD 2P7JA 4PD4E 5KAIH 3EZ6A 3MGNA 1FZFA 2OTJP 1EDKA 4L76A 2W6JH 4R22B 3V2PA 3CCVP 1LNQA 4GODA 2QJKB 4W80A 3K5BA 3HUSA 1PP9J 4U3FE 2Z5IA 1Q06A 2O3JA 2R3SA 4LGDE 2KS1A 1G1IA 2LR2A 1S5LE 3GHGA 2Q9IA 1BDDA 4JBZA 2IZ1A 2NPSC 2A45G 1SQQG 1EQ7A 3G6EP 1GDTA 5KAUA 4L74A 3EZ7A 3BATA 3L72G 1NTZG 1HWTC 4DZOA 1D7MA 3NMDA 4H13D 3CCSP 3II6A 4Y99C 1J1DB 3VP8A 2Q6QA 1LT9A 1QL1A 3T97B 1IFPA 2QE7H 3FWNA 5APTA 2IBZE 3A0HE 1OVRA 1KILE 5GTHH 3CC2P 3QAOA 2O01J 4EIJA 3M06A 1KYOE 3L71E 1KZUB 1NTMG 1LP1B 5AW2B 1NTKG 2XV5A 3RGUA 2VZ4A 1LTSC 4I2LC 4IFDK 3L74G 3LW5J 1QEXA 2C0XA 4ZKPA 1QVGO 3UIAA 2LXBA 3I5CA 1DX7A 2P67A 3RK2B 3R2PA 3L70J 3D71A 1R8EA 4JYCA 5KLVD 1PGPA 2Z4EA 4HH2A 1YJ9P 2HLOA 2FKWB 3PJSK 2HODA 1BE3D 3B5NA 2Y0CA 2A45I 2I1JA 4WVZA 3BCCD 3MZWB 2A06G 1KILC 2H88C 1RH5B 3H1KD 2DG6A 1S3JA 1X22A 1NU1D 1PM6A 3AE4C 5GTIE 3CCMP 1K04A 2L91A 1KB9I 3AEEC 1SQPE 2WVRA 4OGQB 4C7NB 1BGYJ 3OAKA 4W7ZA 3LIDA 1OXZA 3PTZA 4O9BA 3IFMA 5KAWA 3CMAP 2M0BA 3M9HA 1PPJD 2QJKC 2ZXEB 3H1IJ 2YIUB 4DCKA 4UB6E 4AYZB 3VMYA 4WB4A 2WT7A 5KATA 1FDIA 2NPSA 4PJ0E 3L70G 1RQUA 4PD4H 1BOWA 4A1MA 3HH0A 2YMKA 3NTNA 1QLED 5APWA 1MFTA 1H88A 3BVHA 1ZXGA 1NKZB 2NPSD 2C9LY 3EZFA 1TU3F 3IAOA 1J1DC 1URQA 1L0LG 3R4YA 1GL2B 3H1IE 1YQ3C 3L37A 1S5LH 5KAFH 4IL6X 1SQQK 1KB9D 4ASVA 3S4RA 1XTGB 2Q3EA 2PRRA 3AE2C 1JYHA 2W90A 3JSVC 4H0LB 1N73B 1WT6A 2FBWC 5KAVA 2Y9YA 2MKVA 1RF1B 5K5GB 3SFEC 4BRYB 1DH3A 3D6YA 2FYUJ 2K88A 4J2NA 3ITKA 3RK2C 3CPWO 3Q3DA 3A0HH 1UIXA 1PFIA 1XTCC 1L0NE 3O6QA 1QX8A 2YNYA 1KYOH 1NTKK 1FE6A 2G3AA 2O1KA 4XA4A 3RBXA 5KAXA 1BSHA 1T3UA 1JTHB 4ZKUA 1ZW0A 2P1JA 1AA0A 2KK7A 1SP4A 3CCEP 3VYIA 3P8MC 3GG2A 1A02F 4R24B 5L8RJ 1OVUA 3CWBG 3VOPA 4OGQC 1NH4A 2IBZD 1NOHA 1VQLP 1KILD 4NPDA 3W67A 1Q82Q 2O01H 3L71D 1PV3A 4D6TG 1LTBC 2W27A 2W8ZA 2E75B 1KN7A 1KMIZ 5APYA 2JJLA 1P84I 4N78D 1Y8AA 1L4AA 2YIUC 1OW8A 2IFNA 1LTAC 5BVZA 3N7NA 2FY8A 1X79B 3KQGA 5AVXB 2WITA 1A02J 3L75D 2BOWA 2IZ0A 1FJKA 4RESB 2OG0A 1YTZI 1OW7A 2HYNA 1BCCE 2B89A 3AE6C 3MD0A 1GL2C 2WSCJ 1VQ6P 4UB6H 3T97A 3E0HA 3AEAC 3C1LA 1EDLA 2DW3A 3AE7C 2AEMA 1SQPD 3VN0A 5KLIB 4PJ0H 1N7SC 4H0LC 1N73C 4JF7A 3VMAA 1LP1A 2JMLA 1RQVA 3V2QA 2JO1A 1VDFA 2AXTE 3WUUA 1M7LA 2KSEA 1LT1A 1JY2N 3H1LE 1RF1C 3KZIE 1USDA 1L0LK 4M3LA 2ZHHA 4GT1A 3AEDC 1J1EB 2JP3A 2Z5HA 5DJTB 3TGUJ 1FOSF 5CCHC 2IYPA 3CMEP 2AEJA 2V4HA 3M9BA 3JC22 1YTZT 3L73J 3ZDMA 4HKZH 3H1JD 3RK2D 1Q7YQ 1KC8Q 1HVVA 2WSFH 2K37A 3AE1C 1JM0A 2WWWA 4JPZB 1FDMA 3RBZA 3CXHE 1EZVE 2J5UA 4DOJA 1VQ9P 1SQVD 1LTIC 1OFCX 3A3YB 3HD7B 4C7NA 1NJIQ 1YI2P 5APUA 3TGUE 2JWDA 4JYBA 4GIFA 1QVFO 2E75C 1JY3N 1Q0AA 4OGQD 1PGQA 4KJMA 4AYZA 1ZN5A 2XNDH 2WPVB 3V2NA 4YXDC 3Q5SA 2GM4A 2KOGA 1IK9A 2BEQD 2SPZA 1L0ND 3P7KA 1ZRTE 2C0WA 2QVAA 1GK6A 2UWJE 3EFFK 5KLVG 2AXCA 1BE3G 3KDPB 1LWUB 1GL2A 3H1HE 4A7PA 1QL2A 2FYUK 5CBOA 1S72P 1LGHB 3OA7A 1SQQJ 1OWAA 1NU1G 2R5BA 3E1RA 3RL0C 2E43A 2XDJA 1GL2D 2GUVA 1KQFB 4IFMA 5CMZA 5KJ7C 3L72J 2H8PD 2VRSA 1NTZJ 3HE5B 1JB0J 2KSJA 3AE5C 1IFDA 3CX5E 4C46A 1JY2P 1RF1A 2ITAA 4YXWH 5E79E 1N7SD 1PPJG 4H0LD 2XZRA 1J1EC 1OZHA 1NAFA 2WQYC 1SS1A 3HRNA 1YHQP 1SQQE 1M90Q 2CPSA 1KQGB 1NTMJ 2OYOA 1NTKJ 1RE3C 5CCHA 3CCUP 3S1KA 3FWLA 1JTHA 2AXTH 3L74J 1FZGA 2WPRA 1BCCD 3KZIH 5CCHD 5KAFE 3CC4P 1PGJA 2WSCH 1IFNA 3GMAA 3HD7C 1ZOYC 3SWFA 5H2FE 2XNXA 3MIWA 2PFXA 1T2KC 3E1IA 4TLFA 1SQBD 1NTKE 3A7OA 1GU4A 3IR9A 1PP9E 3L74E 1NWQA 4YPCA 2WPSA 3H1LD 3EZ9A 4KT0J 2OYIB 5D8CA 2E74C 3L35A 2GUSA 2E75D 3CXHH 2POHA 3PH0A 2RN0A 2KZIA 2C9NY 1WMKA 1USEA 1GW3A 1CW5A 2QM8A 1RF0C 3OJAB 5APXA 3AEGC 1LWUC 1H0TB 1BDCA 2JKVA 1QGKB 3NXSA 1EZVD 4N6JA 3G71P 3H32B 3RL0g 1JBGA 2N9YB 2Q1KA 2IBZG 1NAYA 3CCRP 3M0DC 5KJ7A 1FAVA 4AYCA 2E5YA 1VQPP 2ZVOB 4IOIH 1FZCB 1CSBA 1L0LJ 3GF7A 5M1BA 1JMBA 3RL0D 2GOVA 1CZQA 1M1JB 2V7QJ 2R32A 1S9KE 4PD4I 4C7RA 5KJ7D 5D90A 1NU1K 1PZQA 3L70E 3MP7B 5DJUB 3RK3E 3EQ2A 1RE3A 1Q05A 1Z56A 5AW3B 3F5HA 1FZEA 4BWNA 2OTLP 2H7HA 3L75G 1SQXD 1DIPA 2B87A 3CX5H 4ZMDA 1L0LE 2ZT9B 5AVSB 4IFFA 5AVUB 5E79H 2XU6A 1HJBA 2LXCB 3CCQP 2JWAA 3H1HD 5B66H 3TNUA 2JDIH 1BGYE 2Y9ZA 2QSIA 4WLSA 4WLWA 5AW1B 3VMZA 1SQPG 5AW9B 3HD7D 3CX5D 3CD6P 1GW4A 4LHFA 2IBZI 1T2KD 3FXDA 2OYIC 3CWBJ 3Q2YA 2KXPB 1KYOI 2Q5UA 4PD4D 1N7SB 3D70A 1M57D 5H2FH 1VQ7P 4D6TJ 4UB8H 4I6MC 4EOTA 1ZV8A 1YITP 2YKQA 1NTZK 2QA4P 1RF0A 2E74D 1MZ9A 4U3FD 2FYNB 1KFMA 1JY2O 5CCGC 3U59A 3S9OA 3H1JG 2ZYGA 1Q81Q 2M5AA 3C8VA 1JNMA 1H8AA 1NTMK 4I1LA 4KHXA 2BCCJ 5AVWB 1SQVG 4D6TE 2M3BA 4BXLA 2ZYAA 5AW8B 2RH0A 1FZCC 3M0DA 1KILA 4ASWA 2QM7A 1W5CE 1M1JC 1PP9D 1Q07A 2GA1A 1LTTC 2FYUE 3EZ2A 1ZLLA 2AEFA 2KVVA 3HUSB 1IO4A 5I44A 2KS1B 2KB7P 3P32A 1KYOD 4HB1A 4PV1B 1Q09A 3A2AA 2L5GB 3KHUA 3PP5A 1L0NG 2ZT9C 3M91A 2CK3H 4K35A 3LW5H 3SSUA 2P58A 1RY3A 4HJGH 2IX7C 1IFMA 1LT9B 5AW5B 2BCCG 2QJPB 3U1CA 4HYTB 1S5LX 2O1JA 1VQKP 1VQ5P 2LKMA 3CCJP 3KXDA 1AV1A 2V7QH 1S9KD 1VQNP 3RL0B 3L36A 4DCZA 3L70D 1P84H 3FX0A 2WZ7A 1YQ4C 4H44B 4Y28J 1MFZA 3HE4B 1SFCB 2FYNC 1JMMA 5TISH 3M0AA 5CBNA 1JUNA 2W6AA 3CCLP 1AQTA 1PGOA 1H0TA 2HODB 3TDKA 3AEFC 1VQOP 1Y6UA 1VQ8P 3R8JA 1RE4C 2ZVNB 3H32A 1BGYD 3V5BA 2K9JB 2MJZA 5CCGD 5KLVJ 2XKMA 1JO5A 3D6ZA 2K1AA 2KP8A 2E76B 1FZCA 4OH8B 1BE3J 1SQBG 1U7JA 1AFOA 3BCCJ 1R8DA 3VTPC 1M1JA 1MUUA 1FZBA 1IZNB 3H1ID 3H1KJ 3GF3A 4NPFX 1NU1J 3HUSC 2WMMA 3H1LG 2NZ2A 1N2DC 4DJGA 1FJPA 2HFED 1UIIA 3QH9A 4PV1C 3B49A 1SQVK 1YBKA 1OVVA 3L73E 4AQRD 4IL6E 5KKZB 2PAJA 3F89A 3UCSA 1DD3A 1BE3E 2KIKA 3M9QA 2E74B 2ZHGA 1IJDB 4RKUJ 1NU1E 4GOEA 1URQB 2N1TB 1LT9C 3FGAD 3MUDC 5APVA 2HR3A 2ZT9D 4Z1MH 5BU5A 2QJPC 2OYHB 1EZVG 4L73A 1FOSE 3TSIA 4CPGA 1GD2E 2YKOA 5APSA 4R4MA 1K8AQ 1L0NK 5CJ0A 2ZYDA 1D5YA 3BCCG 1JCDA 1PPJE 2WTYA 1IFIA 1RHZB 3C9IA 3H1KG 3B71A 2FYUD 5B5EE 1ZR4A 5KTBA 5KCBA 1N7SA 1ZR2A 1N73A 1Q90D 1L2PA 1Q2NA 1GMJA 4H44C 1KD1Q 3GP4A 1SFCC 3PHLA 1HTLC 3O6QB 1EDJA 4BRYA 3G4SP 3B5NC 5B66E 1T3JA 2WSSH 1SQXG 1JEKA 2R5DA 2YMYA 3KPEA 2NRGA 3AE3C 3H1HG 1CI6B 5AVZB 3FXEA 1SLQA 3ABVC 1KB9E 1FZAA 3L72E 1NTZE 3Q1MA 2E76C 5AVTB 3G9RA 2M3EA 3V4QA 3SFDC 4K3AA 3V4WA 1KORA 3CXHI 3VMXA 1EZVI 2IDBA 3B4SA 5AW6B 2KI7B 1L4AB 4UB8E 2H43A 2N9BA 1LTJB 1NTME 1MKMA 2Y0EA 5AW7B 3WUTA 4GKGA 1HJ0A 1ZP0C 4XE5B 3L71J 1JY3P 1M1KQ 5KKZC 1SQBK 2OGUA 3RK3B 1X0TA 2PGDA 3AECC 3U1AA 2E42A 4PV1D 3NFQA 4U3FG 2W83C 3H25A 2OARA 3EFGA 1URQC 1VF5B 2N1TC 3BRVB 1OX3A 2KYVA 3MUDA 2OYHC 1N8RQ 2QJYB 3L75J 1K9MQ 2A06E 2RMZA 2Y0DA 4IL6H 1HF9A 3W68A 2BASA 4OWFA 2QG4A 2HG5D 5AVYB 4MN4C 2W6BA 2CPBA 4N78E 3P8CE 3TF5A 2OTKE 3CXHD 3R8KA 3WUVA 1PP9G 4EI2A 4NPEA 1GTWA 3Q5PA 3HTKB 3TGUD 1SQPJ 2KUBA 5KLVK 1EXIA 2O01N 4B0YA 4OVNF 4R4EA 3CX5I 3L75E 3L71G 5E01A 3L73D 3HE4A 3SWYA 1SFCA 2Q7CA 1T6AA 1HBWA 5AVQB 1M8OB 4RO0A 2YXQB 5B5EH 1X8YA 4H44D 1NGMB 1SFCD 3GK6A 1JCCA 1PL5A 2FFDB 2K9JA 1G2CB 2WSEJ 3B5ND 1ZRTD 4I7ZB 4ZNCA 5BU8B 3H1JJ 2RKLA 1SQXK 3N4XA 5AVVB 3LIEA 2A45H 1VPCA 3B8EB 3HD7A 1L4AC 4RJTA 1P84E 2E76D 1YYCA 3QWOC 1LTJC 1PIXA 3PRJA 2ZAEB 1SQVJ 4WY4B 4U7JA 1VQMP 2QEXP 1N86A 1KB9H 2FXPA 3AEBC 2IFMA 2QIWA 5TISE 1X9VA 3TYYA 2B88A 4WWIA 3RK3C 1EC5A 1DEBA 1AVYA 3H1JE 3A0BE 3WU2E 2WSFJ 1VF5C 1SQQD 1KQSO 1LX8A 1W2EA 2N1TA 3MTUE 1YJNP 5GQQA 2KLVA 1SQVE 2QJYC 1DD4A 2OYHA 3V6IA 1L0NJ 2HPCB 2KNCB 2G8YA 1BGYG 1S2EA 3L72D 1NTZD 1URQD 1LWUA 2N1TD 2D2CB 3GLMA 5TJHA 3CWBE 3GW6A 1KV4A 3H1IG 1HGZA 3TK1A 1OW6A 1VQ4P 1RH6A 1NTMD 2WPQA 3AE8C 1NTKD 2P2UA 1H89A 3HE5A 2H89C 4QMAA 2P10A 5AVRB 3L74D 4XFJA 3O8ZA 1KTMA 2YXRB 3V2RA 4W7YA 3CC7P 1LTGC 1S1CX 3KYQA 1CI6A 3GHGB 2JR8A 5AW4B 2FFDC 2BCCE 2IEFA 3I55P 4H13B 1Y9BA 3WMM0 4I7ZC 2A06D 1JY3O 2J59M 2YO3A 1KQLA 1MV8A 3BRTB 1U7MA 1BCCJ 1WRGA 3E7KA 1NYHA 1ZMEC 2FYZA 3P8CD 5C39A 2JEEA 1LTJA 1OMIA 4WY4C 1GU5A 2FYUG 5GTIH 3IF4A 3A5TA 1AQ5A 2ZFCA 2KLUA 1SQBJ 4TT3H 1Q08A 3SWKA 2ZXXA 1K73Q 1JOCA 1L4AD 2ZJSE 1W2BO 2OYIA 3OW2O 3CL3D 3H1LJ 4R4LA 4N3YB 1Y47A 1IC2A 1S4XA 1IK7A 3JCUE 3USSA 1LJ2A 1FC2C 3LURA 3RK3D 3I56P 1Q86Q 1DEEG 3VP9A 1SQPK 1EXJA 1HGVA 5KAIE 5CHXA 1NVOA 2R44A 2BEZF 1BSNA 2WSEH 1VF5D 1SQBE 5AW0B 2D2CC 5CCGA 1L0LD 3B5NB 4AUWA 3MHVA 1BCCG 5APQA 3A0BH 3WU2H 4YTPC 3HTKA 4WBAA 1P84D 4GOFA 3AE9C 2J58A
chains in the Genus database with same CATH topology
2JO1A 1ZOYC 4GDOA 2BEQD 1S5LX 3ABVC 2WSFJ 4AYZB 5KLIC 1VF5C 3S9OA 3Q5PA 5D90A 1ZRTE 1KILE 1LX8A 3QAOA 2O01J 3C8VA 3RK3E 3Q1MA 5KATA 2E76C 3UCSA 1FDIA 1NYHA 1DD3A 1ZMEC 1EXIA 5GQQA 4B0YA 2ZHHA 1Q05A 4R24B 1RQUA 4R4EA 5L8RJ 1AJYA 1BOWA 3IN6A 3G9RA 2HVAA 3GMAA 2QJYC 1DD4A 4A1MA 4OGQC 1OMIA 5E01A 3AEDC 3HH0A 2YMKA 3SFDC 2E74B 1KORA 2ZHGA 2VZ4A 2JP3A 4DCZA 4RKUJ 3EWKA 2G8YA 1DIPA 3EZ9A 2IDBA 4KT0J 1PV3A 3FGAD 4H13C 4TT3H 1Q08A 2ZT9B 2D2CB 5D8CA 2ZT9D 1YQ4C 3LW5J 4Z1MH 3EZFA 1TU3F 2D2CD 2E74C 3IAOA 5I41B 3GLMA 2E75B 2QJPC 1KMIZ 2K9YA 2E75D 4H44B 3R4YA 4Y28J 4H44D 1NGMB 3EZ6A 2FYNC 1KQFB 1Q07A 2YIUC 3GK6A 1OW8A 1MKMA 1YQ3C 4R4MA 4R4LA 1PL5A 3EZ2A 3D71A 1R8EA 1HJ0A 2KVVA 1JB0J 1ZP0C 2WSEJ 3AE5C 4IL6X 2QSIA 1D5YA 1IK7A 1U57A 1OW6A 1RH6A 1WMKA 5KKZC 3AEFC 4R22B 5I44A 4WLSA 4WLWA 3AE1C 3AE2C 1Y6UA 3AE8C 1JYHA 3LURA 4I7ZB 4H0LB 3AECC 3Q5RA 2H89C 4H0LD 3R8JA 3B71A 1Q06A 4PV1B 3AEGC 1EXJA 2J5UA 4PV1D 1FDOA 5KCBA 1Q09A 2FBWC 2H88C 2WQYC 2P10A 5KAVA 2BEZF 2MKVA 1Q90D 3H25A 2DG6A 2BOWA 4XFJA 1VF5B 1PM6A 1VF5D 1KTMA 3AE4C 3GPVA 2KCUA 1KQGB 3D6ZA 4LHFA 2OG0A 1K04A 1OW7A 2ZT9C 1GMJA 2D2CC 2E76B 3SFEC 2E76D 5KAUA 3AEEC 2E75C 1PIXA 4H44C 3D6YA 3AE6C 3Q2YA 3GP4A 3RL0g 1R8DA 2OQQA 1JBGA 3EZ7A 1Q0AA 4J2NA 2WSCJ 4OGQB 4U7JA 4OGQD 1S1CX 3D70A 3GF3A 3Q3DA 3E0HA 1UIXA 2FXPA 3AEBC 3AEAC 2QIWA 4YTPC 1HF9A 4AYZA 2IEFA 2NZ2A 3O6QA 5KAWA 3AE7C 4H13B 4H13D 1Y9BA 2G3AA 2WPVB 2QJKC 4I7ZC 3GF7A 4H0LC 5M1BA 2E74D 2GOVA 4YXDC 5KAXA 1K05A 3Q5SA 3AE9C 4PV1C 3B49A 3AE3C 2JMLA 2V7QJ 3T97B 3R8KA 1VL2A 1RQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2Y A;  3GP4 A;  1R8D A;  2OQQ A;  1JBG A;  4J2N A;  1Q0A A;  4AYZ B;  1Q08 A;  3Q5R A;  3Q5P A;  5D90 A;  3D70 A;  3R8J A;  5D8C A;  1Q06 A;  1EXJ A;  2J5U A;  3QAO A;  3IAO A;  5I41 B;  3Q3D A;  1JYH A;  3E0H A;  3Q1M A;  5KAT A;  5KCB A;  3UCS A;  5GQQ A;  4AYZ A;  1Q09 A;  1EXI A;  5KAV A;  5KAW A;  4B0Y A;  2DG6 A;  1Q05 A;  2ZHH A;  4R24 B;  4R4E A;  1BOW A;  1Q07 A;  2BOW A;  2HVA A;  3G9R A;  3GK6 A;  4R4M A;  4R4L A;  3GPV A;  2KCU A;  4A1M A;  5E01 A;  3D71 A;  3HH0 A;  3D6Z A;  1R8E A;  2ZHG A;  2GOV A;  2VZ4 A;  5KAX A;  3Q5S A;  3B49 A;  1DIP A;  1D5Y A;  5KAU A;  2JML A;  5I44 A;  3T97 B;  3R8K A;  4R22 B;  4WLS A;  3LUR A;  4WLW A;  3D6Y A; 
#chains in the Genus database with same CATH topology
 4GDO A;  1E79 H;  1M56 D;  1IFJ A;  3PLN A;  4B86 A;  1AJY A;  1T8Z A;  2HVA A;  5CJ4 A;  4LLH A;  2B87 B;  4LC1 A;  1AVO A;  3GHG C;  1SVF A;  1G1J A;  2WT7 B;  1J2J B;  2FFD A;  4H13 C;  1G2C A;  1YIJ P;  5GTH E;  2NPS B;  5KLV E;  1YJW P;  3G3Z A;  3TNU B;  2K3R A;  5I41 B;  2K9Y A;  1KFN A;  3BCC E;  1SQX J;  1U57 A;  2R3C A;  3H1K E;  4Y99 B;  3CWB D;  5EFW B;  4DT0 A;  1GK4 A;  3Q5R A;  2QRX A;  3H1H J;  1R5L A;  2M8R A;  2PP6 A;  4L75 A;  1FDO A;  1NKN A;  4WY4 A;  1E5W A;  4JQ0 D;  2I1K A;  2YO2 A;  4D6T D;  1NHL A;  3GPV A;  2KCU A;  1N7L A;  2B9B A;  3TGU G;  3L4F A;  4EDF A;  2OQQ A;  1FBM A;  4WY4 D;  1SQX E;  3L73 G;  1R5S A;  1HUC A;  3H6P A;  1HH0 A;  2IYO A;  1GZL A;  1K05 A;  3BAS A;  2M5A B;  1VL2 A;  2BCC D;  2I8D A;  5KLI C;  2HPC A;  2KNC A;  2KZJ A;  2YKP A;  2FXM A;  3IN6 A;  4U3F J;  1FS0 E;  1EDI A;  1FU1 A;  1NO4 A;  1KIL B;  2Q3I A;  3CI9 A;  2IPP A;  3EWK A;  2E5T A;  1RE4 A;  3JCU H;  2FXO A;  3CLQ A;  4EYY Q;  1OIP A;  2D2C D;  2P7J A;  4PD4 E;  5KAI H;  3EZ6 A;  3MGN A;  1FZF A;  2OTJ P;  1EDK A;  4L76 A;  2W6J H;  4R22 B;  3V2P A;  3CCV P;  1LNQ A;  4GOD A;  2QJK B;  4W80 A;  3K5B A;  3HUS A;  1PP9 J;  4U3F E;  2Z5I A;  1Q06 A;  2O3J A;  2R3S A;  4LGD E;  2KS1 A;  1G1I A;  2LR2 A;  1S5L E;  3GHG A;  2Q9I A;  1BDD A;  4JBZ A;  2IZ1 A;  2NPS C;  2A45 G;  1SQQ G;  1EQ7 A;  3G6E P;  1GDT A;  5KAU A;  4L74 A;  3EZ7 A;  3BAT A;  3L72 G;  1NTZ G;  1HWT C;  4DZO A;  1D7M A;  3NMD A;  4H13 D;  3CCS P;  3II6 A;  4Y99 C;  1J1D B;  3VP8 A;  2Q6Q A;  1LT9 A;  1QL1 A;  3T97 B;  1IFP A;  2QE7 H;  3FWN A;  5APT A;  2IBZ E;  3A0H E;  1OVR A;  1KIL E;  5GTH H;  3CC2 P;  3QAO A;  2O01 J;  4EIJ A;  3M06 A;  1KYO E;  3L71 E;  1KZU B;  1NTM G;  1LP1 B;  5AW2 B;  1NTK G;  2XV5 A;  3RGU A;  2VZ4 A;  1LTS C;  4I2L C;  4IFD K;  3L74 G;  3LW5 J;  1QEX A;  2C0X A;  4ZKP A;  1QVG O;  3UIA A;  2LXB A;  3I5C A;  1DX7 A;  2P67 A;  3RK2 B;  3R2P A;  3L70 J;  3D71 A;  1R8E A;  4JYC A;  5KLV D;  1PGP A;  2Z4E A;  4HH2 A;  1YJ9 P;  2HLO A;  2FKW B;  3PJS K;  2HOD A;  1BE3 D;  3B5N A;  2Y0C A;  2A45 I;  2I1J A;  4WVZ A;  3BCC D;  3MZW B;  2A06 G;  1KIL C;  2H88 C;  1RH5 B;  3H1K D;  2DG6 A;  1S3J A;  1X22 A;  1NU1 D;  1PM6 A;  3AE4 C;  5GTI E;  3CCM P;  1K04 A;  2L91 A;  1KB9 I;  3AEE C;  1SQP E;  2WVR A;  4OGQ B;  4C7N B;  1BGY J;  3OAK A;  4W7Z A;  3LID A;  1OXZ A;  3PTZ A;  4O9B A;  3IFM A;  5KAW A;  3CMA P;  2M0B A;  3M9H A;  1PPJ D;  2QJK C;  2ZXE B;  3H1I J;  2YIU B;  4DCK A;  4UB6 E;  4AYZ B;  3VMY A;  4WB4 A;  2WT7 A;  5KAT A;  1FDI A;  2NPS A;  4PJ0 E;  3L70 G;  1RQU A;  4PD4 H;  1BOW A;  4A1M A;  3HH0 A;  2YMK A;  3NTN A;  1QLE D;  5APW A;  1MFT A;  1H88 A;  3BVH A;  1ZXG A;  1NKZ B;  2NPS D;  2C9L Y;  3EZF A;  1TU3 F;  3IAO A;  1J1D C;  1URQ A;  1L0L G;  3R4Y A;  1GL2 B;  3H1I E;  1YQ3 C;  3L37 A;  1S5L H;  5KAF H;  4IL6 X;  1SQQ K;  1KB9 D;  4ASV A;  3S4R A;  1XTG B;  2Q3E A;  2PRR A;  3AE2 C;  1JYH A;  2W90 A;  3JSV C;  4H0L B;  1N73 B;  1WT6 A;  2FBW C;  5KAV A;  2Y9Y A;  2MKV A;  1RF1 B;  5K5G B;  3SFE C;  4BRY B;  1DH3 A;  3D6Y A;  2FYU J;  2K88 A;  4J2N A;  3ITK A;  3RK2 C;  3CPW O;  3Q3D A;  3A0H H;  1UIX A;  1PFI A;  1XTC C;  1L0N E;  3O6Q A;  1QX8 A;  2YNY A;  1KYO H;  1NTK K;  1FE6 A;  2G3A A;  2O1K A;  4XA4 A;  3RBX A;  5KAX A;  1BSH A;  1T3U A;  1JTH B;  4ZKU A;  1ZW0 A;  2P1J A;  1AA0 A;  2KK7 A;  1SP4 A;  3CCE P;  3VYI A;  3P8M C;  3GG2 A;  1A02 F;  4R24 B;  5L8R J;  1OVU A;  3CWB G;  3VOP A;  4OGQ C;  1NH4 A;  2IBZ D;  1NOH A;  1VQL P;  1KIL D;  4NPD A;  3W67 A;  1Q82 Q;  2O01 H;  3L71 D;  1PV3 A;  4D6T G;  1LTB C;  2W27 A;  2W8Z A;  2E75 B;  1KN7 A;  1KMI Z;  5APY A;  2JJL A;  1P84 I;  4N78 D;  1Y8A A;  1L4A A;  2YIU C;  1OW8 A;  2IFN A;  1LTA C;  5BVZ A;  3N7N A;  2FY8 A;  1X79 B;  3KQG A;  5AVX B;  2WIT A;  1A02 J;  3L75 D;  2BOW A;  2IZ0 A;  1FJK A;  4RES B;  2OG0 A;  1YTZ I;  1OW7 A;  2HYN A;  1BCC E;  2B89 A;  3AE6 C;  3MD0 A;  1GL2 C;  2WSC J;  1VQ6 P;  4UB6 H;  3T97 A;  3E0H A;  3AEA C;  3C1L A;  1EDL A;  2DW3 A;  3AE7 C;  2AEM A;  1SQP D;  3VN0 A;  5KLI B;  4PJ0 H;  1N7S C;  4H0L C;  1N73 C;  4JF7 A;  3VMA A;  1LP1 A;  2JML A;  1RQV A;  3V2Q A;  2JO1 A;  1VDF A;  2AXT E;  3WUU A;  1M7L A;  2KSE A;  1LT1 A;  1JY2 N;  3H1L E;  1RF1 C;  3KZI E;  1USD A;  1L0L K;  4M3L A;  2ZHH A;  4GT1 A;  3AED C;  1J1E B;  2JP3 A;  2Z5H A;  5DJT B;  3TGU J;  1FOS F;  5CCH C;  2IYP A;  3CME P;  2AEJ A;  2V4H A;  3M9B A;  3JC2 2;  1YTZ T;  3L73 J;  3ZDM A;  4HKZ H;  3H1J D;  3RK2 D;  1Q7Y Q;  1KC8 Q;  1HVV A;  2WSF H;  2K37 A;  3AE1 C;  1JM0 A;  2WWW A;  4JPZ B;  1FDM A;  3RBZ A;  3CXH E;  1EZV E;  2J5U A;  4DOJ A;  1VQ9 P;  1SQV D;  1LTI C;  1OFC X;  3A3Y B;  3HD7 B;  4C7N A;  1NJI Q;  1YI2 P;  5APU A;  3TGU E;  2JWD A;  4JYB A;  4GIF A;  1QVF O;  2E75 C;  1JY3 N;  1Q0A A;  4OGQ D;  1PGQ A;  4KJM A;  4AYZ A;  1ZN5 A;  2XND H;  2WPV B;  3V2N A;  4YXD C;  3Q5S A;  2GM4 A;  2KOG A;  1IK9 A;  2BEQ D;  2SPZ A;  1L0N D;  3P7K A;  1ZRT E;  2C0W A;  2QVA A;  1GK6 A;  2UWJ E;  3EFF K;  5KLV G;  2AXC A;  1BE3 G;  3KDP B;  1LWU B;  1GL2 A;  3H1H E;  4A7P A;  1QL2 A;  2FYU K;  5CBO A;  1S72 P;  1LGH B;  3OA7 A;  1SQQ J;  1OWA A;  1NU1 G;  2R5B A;  3E1R A;  3RL0 C;  2E43 A;  2XDJ A;  1GL2 D;  2GUV A;  1KQF B;  4IFM A;  5CMZ A;  5KJ7 C;  3L72 J;  2H8P D;  2VRS A;  1NTZ J;  3HE5 B;  1JB0 J;  2KSJ A;  3AE5 C;  1IFD A;  3CX5 E;  4C46 A;  1JY2 P;  1RF1 A;  2ITA A;  4YXW H;  5E79 E;  1N7S D;  1PPJ G;  4H0L D;  2XZR A;  1J1E C;  1OZH A;  1NAF A;  2WQY C;  1SS1 A;  3HRN A;  1YHQ P;  1SQQ E;  1M90 Q;  2CPS A;  1KQG B;  1NTM J;  2OYO A;  1NTK J;  1RE3 C;  5CCH A;  3CCU P;  3S1K A;  3FWL A;  1JTH A;  2AXT H;  3L74 J;  1FZG A;  2WPR A;  1BCC D;  3KZI H;  5CCH D;  5KAF E;  3CC4 P;  1PGJ A;  2WSC H;  1IFN A;  3GMA A;  3HD7 C;  1ZOY C;  3SWF A;  5H2F E;  2XNX A;  3MIW A;  2PFX A;  1T2K C;  3E1I A;  4TLF A;  1SQB D;  1NTK E;  3A7O A;  1GU4 A;  3IR9 A;  1PP9 E;  3L74 E;  1NWQ A;  4YPC A;  2WPS A;  3H1L D;  3EZ9 A;  4KT0 J;  2OYI B;  5D8C A;  2E74 C;  3L35 A;  2GUS A;  2E75 D;  3CXH H;  2POH A;  3PH0 A;  2RN0 A;  2KZI A;  2C9N Y;  1WMK A;  1USE A;  1GW3 A;  1CW5 A;  2QM8 A;  1RF0 C;  3OJA B;  5APX A;  3AEG C;  1LWU C;  1H0T B;  1BDC A;  2JKV A;  1QGK B;  3NXS A;  1EZV D;  4N6J A;  3G71 P;  3H32 B;  3RL0 g;  1JBG A;  2N9Y B;  2Q1K A;  2IBZ G;  1NAY A;  3CCR P;  3M0D C;  5KJ7 A;  1FAV A;  4AYC A;  2E5Y A;  1VQP P;  2ZVO B;  4IOI H;  1FZC B;  1CSB A;  1L0L J;  3GF7 A;  5M1B A;  1JMB A;  3RL0 D;  2GOV A;  1CZQ A;  1M1J B;  2V7Q J;  2R32 A;  1S9K E;  4PD4 I;  4C7R A;  5KJ7 D;  5D90 A;  1NU1 K;  1PZQ A;  3L70 E;  3MP7 B;  5DJU B;  3RK3 E;  3EQ2 A;  1RE3 A;  1Q05 A;  1Z56 A;  5AW3 B;  3F5H A;  1FZE A;  4BWN A;  2OTL P;  2H7H A;  3L75 G;  1SQX D;  1DIP A;  2B87 A;  3CX5 H;  4ZMD A;  1L0L E;  2ZT9 B;  5AVS B;  4IFF A;  5AVU B;  5E79 H;  2XU6 A;  1HJB A;  2LXC B;  3CCQ P;  2JWA A;  3H1H D;  5B66 H;  3TNU A;  2JDI H;  1BGY E;  2Y9Z A;  2QSI A;  4WLS A;  4WLW A;  5AW1 B;  3VMZ A;  1SQP G;  5AW9 B;  3HD7 D;  3CX5 D;  3CD6 P;  1GW4 A;  4LHF A;  2IBZ I;  1T2K D;  3FXD A;  2OYI C;  3CWB J;  3Q2Y A;  2KXP B;  1KYO I;  2Q5U A;  4PD4 D;  1N7S B;  3D70 A;  1M57 D;  5H2F H;  1VQ7 P;  4D6T J;  4UB8 H;  4I6M C;  4EOT A;  1ZV8 A;  1YIT P;  2YKQ A;  1NTZ K;  2QA4 P;  1RF0 A;  2E74 D;  1MZ9 A;  4U3F D;  2FYN B;  1KFM A;  1JY2 O;  5CCG C;  3U59 A;  3S9O A;  3H1J G;  2ZYG A;  1Q81 Q;  2M5A A;  3C8V A;  1JNM A;  1H8A A;  1NTM K;  4I1L A;  4KHX A;  2BCC J;  5AVW B;  1SQV G;  4D6T E;  2M3B A;  4BXL A;  2ZYA A;  5AW8 B;  2RH0 A;  1FZC C;  3M0D A;  1KIL A;  4ASW A;  2QM7 A;  1W5C E;  1M1J C;  1PP9 D;  1Q07 A;  2GA1 A;  1LTT C;  2FYU E;  3EZ2 A;  1ZLL A;  2AEF A;  2KVV A;  3HUS B;  1IO4 A;  5I44 A;  2KS1 B;  2KB7 P;  3P32 A;  1KYO D;  4HB1 A;  4PV1 B;  1Q09 A;  3A2A A;  2L5G B;  3KHU A;  3PP5 A;  1L0N G;  2ZT9 C;  3M91 A;  2CK3 H;  4K35 A;  3LW5 H;  3SSU A;  2P58 A;  1RY3 A;  4HJG H;  2IX7 C;  1IFM A;  1LT9 B;  5AW5 B;  2BCC G;  2QJP B;  3U1C A;  4HYT B;  1S5L X;  2O1J A;  1VQK P;  1VQ5 P;  2LKM A;  3CCJ P;  3KXD A;  1AV1 A;  2V7Q H;  1S9K D;  1VQN P;  3RL0 B;  3L36 A;  4DCZ A;  3L70 D;  1P84 H;  3FX0 A;  2WZ7 A;  1YQ4 C;  4H44 B;  4Y28 J;  1MFZ A;  3HE4 B;  1SFC B;  2FYN C;  1JMM A;  5TIS H;  3M0A A;  5CBN A;  1JUN A;  2W6A A;  3CCL P;  1AQT A;  1PGO A;  1H0T A;  2HOD B;  3TDK A;  3AEF C;  1VQO P;  1Y6U A;  1VQ8 P;  3R8J A;  1RE4 C;  2ZVN B;  3H32 A;  1BGY D;  3V5B A;  2K9J B;  2MJZ A;  5CCG D;  5KLV J;  2XKM A;  1JO5 A;  3D6Z A;  2K1A A;  2KP8 A;  2E76 B;  1FZC A;  4OH8 B;  1BE3 J;  1SQB G;  1U7J A;  1AFO A;  3BCC J;  1R8D A;  3VTP C;  1M1J A;  1MUU A;  1FZB A;  1IZN B;  3H1I D;  3H1K J;  3GF3 A;  4NPF X;  1NU1 J;  3HUS C;  2WMM A;  3H1L G;  2NZ2 A;  1N2D C;  4DJG A;  1FJP A;  2HFE D;  1UII A;  3QH9 A;  4PV1 C;  3B49 A;  1SQV K;  1YBK A;  1OVV A;  3L73 E;  4AQR D;  4IL6 E;  5KKZ B;  2PAJ A;  3F89 A;  3UCS A;  1DD3 A;  1BE3 E;  2KIK A;  3M9Q A;  2E74 B;  2ZHG A;  1IJD B;  4RKU J;  1NU1 E;  4GOE A;  1URQ B;  2N1T B;  1LT9 C;  3FGA D;  3MUD C;  5APV A;  2HR3 A;  2ZT9 D;  4Z1M H;  5BU5 A;  2QJP C;  2OYH B;  1EZV G;  4L73 A;  1FOS E;  3TSI A;  4CPG A;  1GD2 E;  2YKO A;  5APS A;  4R4M A;  1K8A Q;  1L0N K;  5CJ0 A;  2ZYD A;  1D5Y A;  3BCC G;  1JCD A;  1PPJ E;  2WTY A;  1IFI A;  1RHZ B;  3C9I A;  3H1K G;  3B71 A;  2FYU D;  5B5E E;  1ZR4 A;  5KTB A;  5KCB A;  1N7S A;  1ZR2 A;  1N73 A;  1Q90 D;  1L2P A;  1Q2N A;  1GMJ A;  4H44 C;  1KD1 Q;  3GP4 A;  1SFC C;  3PHL A;  1HTL C;  3O6Q B;  1EDJ A;  4BRY A;  3G4S P;  3B5N C;  5B66 E;  1T3J A;  2WSS H;  1SQX G;  1JEK A;  2R5D A;  2YMY A;  3KPE A;  2NRG A;  3AE3 C;  3H1H G;  1CI6 B;  5AVZ B;  3FXE A;  1SLQ A;  3ABV C;  1KB9 E;  1FZA A;  3L72 E;  1NTZ E;  3Q1M A;  2E76 C;  5AVT B;  3G9R A;  2M3E A;  3V4Q A;  3SFD C;  4K3A A;  3V4W A;  1KOR A;  3CXH I;  3VMX A;  1EZV I;  2IDB A;  3B4S A;  5AW6 B;  2KI7 B;  1L4A B;  4UB8 E;  2H43 A;  2N9B A;  1LTJ B;  1NTM E;  1MKM A;  2Y0E A;  5AW7 B;  3WUT A;  4GKG A;  1HJ0 A;  1ZP0 C;  4XE5 B;  3L71 J;  1JY3 P;  1M1K Q;  5KKZ C;  1SQB K;  2OGU A;  3RK3 B;  1X0T A;  2PGD A;  3AEC C;  3U1A A;  2E42 A;  4PV1 D;  3NFQ A;  4U3F G;  2W83 C;  3H25 A;  2OAR A;  3EFG A;  1URQ C;  1VF5 B;  2N1T C;  3BRV B;  1OX3 A;  2KYV A;  3MUD A;  2OYH C;  1N8R Q;  2QJY B;  3L75 J;  1K9M Q;  2A06 E;  2RMZ A;  2Y0D A;  4IL6 H;  1HF9 A;  3W68 A;  2BAS A;  4OWF A;  2QG4 A;  2HG5 D;  5AVY B;  4MN4 C;  2W6B A;  2CPB A;  4N78 E;  3P8C E;  3TF5 A;  2OTK E;  3CXH D;  3R8K A;  3WUV A;  1PP9 G;  4EI2 A;  4NPE A;  1GTW A;  3Q5P A;  3HTK B;  3TGU D;  1SQP J;  2KUB A;  5KLV K;  1EXI A;  2O01 N;  4B0Y A;  4OVN F;  4R4E A;  3CX5 I;  3L75 E;  3L71 G;  5E01 A;  3L73 D;  3HE4 A;  3SWY A;  1SFC A;  2Q7C A;  1T6A A;  1HBW A;  5AVQ B;  1M8O B;  4RO0 A;  2YXQ B;  5B5E H;  1X8Y A;  4H44 D;  1NGM B;  1SFC D;  3GK6 A;  1JCC A;  1PL5 A;  2FFD B;  2K9J A;  1G2C B;  2WSE J;  3B5N D;  1ZRT D;  4I7Z B;  4ZNC A;  5BU8 B;  3H1J J;  2RKL A;  1SQX K;  3N4X A;  5AVV B;  3LIE A;  2A45 H;  1VPC A;  3B8E B;  3HD7 A;  1L4A C;  4RJT A;  1P84 E;  2E76 D;  1YYC A;  3QWO C;  1LTJ C;  1PIX A;  3PRJ A;  2ZAE B;  1SQV J;  4WY4 B;  4U7J A;  1VQM P;  2QEX P;  1N86 A;  1KB9 H;  2FXP A;  3AEB C;  2IFM A;  2QIW A;  5TIS E;  1X9V A;  3TYY A;  2B88 A;  4WWI A;  3RK3 C;  1EC5 A;  1DEB A;  1AVY A;  3H1J E;  3A0B E;  3WU2 E;  2WSF J;  1VF5 C;  1SQQ D;  1KQS O;  1LX8 A;  1W2E A;  2N1T A;  3MTU E;  1YJN P;  5GQQ A;  2KLV A;  1SQV E;  2QJY C;  1DD4 A;  2OYH A;  3V6I A;  1L0N J;  2HPC B;  2KNC B;  2G8Y A;  1BGY G;  1S2E A;  3L72 D;  1NTZ D;  1URQ D;  1LWU A;  2N1T D;  2D2C B;  3GLM A;  5TJH A;  3CWB E;  3GW6 A;  1KV4 A;  3H1I G;  1HGZ A;  3TK1 A;  1OW6 A;  1VQ4 P;  1RH6 A;  1NTM D;  2WPQ A;  3AE8 C;  1NTK D;  2P2U A;  1H89 A;  3HE5 A;  2H89 C;  4QMA A;  2P10 A;  5AVR B;  3L74 D;  4XFJ A;  3O8Z A;  1KTM A;  2YXR B;  3V2R A;  4W7Y A;  3CC7 P;  1LTG C;  1S1C X;  3KYQ A;  1CI6 A;  3GHG B;  2JR8 A;  5AW4 B;  2FFD C;  2BCC E;  2IEF A;  3I55 P;  4H13 B;  1Y9B A;  3WMM 0;  4I7Z C;  2A06 D;  1JY3 O;  2J59 M;  2YO3 A;  1KQL A;  1MV8 A;  3BRT B;  1U7M A;  1BCC J;  1WRG A;  3E7K A;  1NYH A;  1ZME C;  2FYZ A;  3P8C D;  5C39 A;  2JEE A;  1LTJ A;  1OMI A;  4WY4 C;  1GU5 A;  2FYU G;  5GTI H;  3IF4 A;  3A5T A;  1AQ5 A;  2ZFC A;  2KLU A;  1SQB J;  4TT3 H;  1Q08 A;  3SWK A;  2ZXX A;  1K73 Q;  1JOC A;  1L4A D;  2ZJS E;  1W2B O;  2OYI A;  3OW2 O;  3CL3 D;  3H1L J;  4R4L A;  4N3Y B;  1Y47 A;  1IC2 A;  1S4X A;  1IK7 A;  3JCU E;  3USS A;  1LJ2 A;  1FC2 C;  3LUR A;  3RK3 D;  3I56 P;  1Q86 Q;  1DEE G;  3VP9 A;  1SQP K;  1EXJ A;  1HGV A;  5KAI E;  5CHX A;  1NVO A;  2R44 A;  2BEZ F;  1BSN A;  2WSE H;  1VF5 D;  1SQB E;  5AW0 B;  2D2C C;  5CCG A;  1L0L D;  3B5N B;  4AUW A;  3MHV A;  1BCC G;  5APQ A;  3A0B H;  3WU2 H;  4YTP C;  3HTK A;  4WBA A;  1P84 D;  4GOF A;  3AE9 C;  2J58 A; 
#chains in the Genus database with same CATH homology
 2JO1 A;  1ZOY C;  4GDO A;  2BEQ D;  1S5L X;  3ABV C;  2WSF J;  4AYZ B;  5KLI C;  1VF5 C;  3S9O A;  3Q5P A;  5D90 A;  1ZRT E;  1KIL E;  1LX8 A;  3QAO A;  2O01 J;  3C8V A;  3RK3 E;  3Q1M A;  5KAT A;  2E76 C;  3UCS A;  1FDI A;  1NYH A;  1DD3 A;  1ZME C;  1EXI A;  5GQQ A;  4B0Y A;  2ZHH A;  1Q05 A;  4R24 B;  1RQU A;  4R4E A;  5L8R J;  1AJY A;  1BOW A;  3IN6 A;  3G9R A;  2HVA A;  3GMA A;  2QJY C;  1DD4 A;  4A1M A;  4OGQ C;  1OMI A;  5E01 A;  3AED C;  3HH0 A;  2YMK A;  3SFD C;  2E74 B;  1KOR A;  2ZHG A;  2VZ4 A;  2JP3 A;  4DCZ A;  4RKU J;  3EWK A;  2G8Y A;  1DIP A;  3EZ9 A;  2IDB A;  4KT0 J;  1PV3 A;  3FGA D;  4H13 C;  4TT3 H;  1Q08 A;  2ZT9 B;  2D2C B;  5D8C A;  2ZT9 D;  1YQ4 C;  3LW5 J;  4Z1M H;  3EZF A;  1TU3 F;  2D2C D;  2E74 C;  3IAO A;  5I41 B;  3GLM A;  2E75 B;  2QJP C;  1KMI Z;  2K9Y A;  2E75 D;  4H44 B;  3R4Y A;  4Y28 J;  4H44 D;  1NGM B;  3EZ6 A;  2FYN C;  1KQF B;  1Q07 A;  2YIU C;  3GK6 A;  1OW8 A;  1MKM A;  1YQ3 C;  4R4M A;  4R4L A;  1PL5 A;  3EZ2 A;  3D71 A;  1R8E A;  1HJ0 A;  2KVV A;  1JB0 J;  1ZP0 C;  2WSE J;  3AE5 C;  4IL6 X;  2QSI A;  1D5Y A;  1IK7 A;  1U57 A;  1OW6 A;  1RH6 A;  1WMK A;  5KKZ C;  3AEF C;  4R22 B;  5I44 A;  4WLS A;  4WLW A;  3AE1 C;  3AE2 C;  1Y6U A;  3AE8 C;  1JYH A;  3LUR A;  4I7Z B;  4H0L B;  3AEC C;  3Q5R A;  2H89 C;  4H0L D;  3R8J A;  3B71 A;  1Q06 A;  4PV1 B;  3AEG C;  1EXJ A;  2J5U A;  4PV1 D;  1FDO A;  5KCB A;  1Q09 A;  2FBW C;  2H88 C;  2WQY C;  2P10 A;  5KAV A;  2BEZ F;  2MKV A;  1Q90 D;  3H25 A;  2DG6 A;  2BOW A;  4XFJ A;  1VF5 B;  1PM6 A;  1VF5 D;  1KTM A;  3AE4 C;  3GPV A;  2KCU A;  1KQG B;  3D6Z A;  4LHF A;  2OG0 A;  1K04 A;  1OW7 A;  2ZT9 C;  1GMJ A;  2D2C C;  2E76 B;  3SFE C;  2E76 D;  5KAU A;  3AEE C;  2E75 C;  1PIX A;  4H44 C;  3D6Y A;  3AE6 C;  3Q2Y A;  3GP4 A;  3RL0 g;  1R8D A;  2OQQ A;  1JBG A;  3EZ7 A;  1Q0A A;  4J2N A;  2WSC J;  4OGQ B;  4U7J A;  4OGQ D;  1S1C X;  3D70 A;  3GF3 A;  3Q3D A;  3E0H A;  1UIX A;  2FXP A;  3AEB C;  3AEA C;  2QIW A;  4YTP C;  1HF9 A;  4AYZ A;  2IEF A;  2NZ2 A;  3O6Q A;  5KAW A;  3AE7 C;  4H13 B;  4H13 D;  1Y9B A;  2G3A A;  2WPV B;  2QJK C;  4I7Z C;  3GF7 A;  4H0L C;  5M1B A;  2E74 D;  2GOV A;  4YXD C;  5KAX A;  1K05 A;  3Q5S A;  3AE9 C;  4PV1 C;  3B49 A;  3AE3 C;  2JML A;  2V7Q J;  3T97 B;  3R8K A;  1VL2 A;  1RQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...