3Q2YA

Crystal structure of bmrr bound to ethidium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q2yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q2yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q2yA03
3GP4A 3Q5PA 1BOWA 4WLSA 4R4EA 2KCUA 2ZHHA 5KATA 3Q1MA 1R8DA 5D8CA 4R4MA 1JBGA 2OQQA 3D6YA 3UCSA 1D5YA 3Q5RA 1EXJA 4R22B 4AYZA 5KAUA 2VZ4A 4R24B 2BOWA 3GK6A 3Q3DA 1R8EA 3Q2YA 5GQQA 2J5UA 3D6ZA 1JYHA 3Q5SA 5KAVA 3GPVA 4R4LA 5I41B 3E0HA 2ZHGA 2HVAA 2DG6A 5D90A 1Q05A 5E01A 3HH0A 1DIPA 2JMLA 3D71A 4B0YA 3IAOA 4WLWA 3G9RA 5KAWA 1Q0AA 3QAOA 4A1MA 3T97B 1Q08A 2GOVA 3B49A 5KAXA 3R8KA 4AYZB 4J2NA 1EXIA 5I44A 1Q07A 3R8JA 1Q06A 3D70A 3LURA 5KCBA 1Q09A
chains in the Genus database with same CATH superfamily
1LTIC 3P7KA 1L0ND 2RKLA 1EDIA 1NTKK 2NPSA 4EDFA 1N2DC 3C1LA 2VRSA 4DCKA 2DG6A 3CWBE 3PLNA 1KD1Q 3VMZA 3AECC 3EZ9A 1KILC 2WPVB 3I55P 2KVVA 3O6QA 3I5CA 1BCCE 2QJYB 2W6BA 2BOWA 2R32A 1ZP0C 1NU1D 1ZN5A 3OJAB 2A06E 2OYIA 1AJYA 4U3FE 1PP9E 1IZNB 1M57D 1AQ5A 3LIDA 3KXDA 4A1MA 1DD3A 1WRGA 2YKOA 3A0HH 4I6MC 1KB9H 3TK1A 1SQXE 1H0TA 3KDPB 1R8DA 3U1CA 2OQQA 1L0NG 5KJ7A 2QRXA 3AE2C 2O01J 3H25A 3IR9A 1VQ8P 1NTZE 2N1TB 1RF1B 4PD4E 1BSNA 2FFDB 5CBOA 2H7HA 1S2EA 2QSIA 4HB1A 2FXPA 3H1HE 4DT0A 2R44A 1EXJA 4R22B 3HUSC 1MUUA 1NU1G 1YYCA 5AVVB 3SSUA 2JMLA 1JMMA 1RY3A 2R5BA 1LX8A 2E74C 2ZJSE 1L0NJ 3GK6A 1N73A 2PFXA 1HJBA 3SWYA 1OVVA 2ZT9B 2XZRA 3VMXA 2A45G 1USDA 1LNQA 2N1TC 4U3FG 3TGUJ 5KLVG 1FAVA 1IFDA 1FOSF 2E76B 3VOPA 2IPPA 3RL0C 4PD4D 1NTZD 1JUNA 3Q2YA 4JF7A 1K8AQ 4GODA 2LXCB 4KHXA 3TYYA 3L72D 3S1KA 2Y9YA 3L73G 3AE1C 1FE6A 1EXIA 1JY3P 4JPZB 3CL3D 3HUSA 1LWUB 1SQBJ 3E1RA 1VQ4P 4UB8H 2B87B 1LT9B 4PV1C 2AXTH 4W80A 5B66E 4OWFA 3CXHD 3H1LJ 3BCCJ 1PP9J 1Q0AA 1BCCD 3CX5I 5I44A 3SWKA 1BGYD 2GM4A 2YIUC 5AW5B 3HD7A 3RGUA 4OVNF 3B5ND 1SQPE 3AEBC 4YTPC 3L4FA 2YKPA 3LW5J 4EI2A 1L0NE 5GTHH 1L4AC 1LT9C 2FFDA 3L70D 3EFGA 1WMKA 3O8ZA 2KSJA 2I1JA 1RF0C 1X9VA 1LT1A 3Q5PA 2O3JA 1R5SA 5H2FE 3H1ID 3TGUD 3O6QB 3UCSA 1SFCC 3L71D 3RL0B 3H1LE 5KLIC 1URQB 1YHQP 2JWDA 3L70J 4I2LC 3G9RA 2Z5IA 3H1JG 3D70A 1K73Q 3CX5E 3HD7C 5CBNA 1N7SD 2K9JA 1P84H 1Q90D 1FZEA 5AVXB 5AVRB 4XFJA 1KQSO 1XTCC 5D90A 5CCGC 2BEQD 1S72P 5AW9B 2B89A 2OYOA 2R3SA 2FFDC 5APXA 1L0LK 1PM6A 2MKVA 1RE4A 4BRYB 4JYCA 3TF5A 1Q86Q 4WY4A 3M0DA 4K35A 1LTJA 2FYUE 1NHLA 2D2CB 3EFFK 2ZFCA 1PV3A 1KB9E 1FU1A 4CPGA 2K9JB 1NTKG 1YQ4C 1E79H 3AEAC 1FZGA 3SWFA 4JQ0D 2R5DA 3C8VA 1EQ7A 1S4XA 3A3YB 1FBMA 4GIFA 5AW0B 2QJYC 4Z1MH 5AW4B 2K37A 3FX0A 1A02J 1JY2N 4TT3H 3FXDA 2UWJE 1W5CE 3HRNA 1NWQA 2HFED 1N7SC 4W7YA 2XNDH 4RKUJ 2N9YB 1SQPJ 3A5TA 3L71J 3KZIE 4UB6H 2OYHC 4H13C 1L4AB 3BVHA 3GHGA 3CC7P 1TU3F 3FWLA 1SQPK 5KAFH 3M0DC 3WUTA 1SQVD 5KKZC 2Y0CA 3RBZA 1FDMA 1RF1A 3T97B 2WITA 1JY3O 1Q07A 3AEGC 5APVA 2O1JA 3CC4P 2IBZI 2W83C 5B66H 3CCMP 5I41B 4KT0J 1VPCA 1KYOD 1RE3C 4PD4I 2GUSA 1LTBC 1NH4A 1GL2C 2V4HA 3MTUE 1NGMB 1HBWA 2NPSC 1PP9G 4L76A 1YBKA 2J59M 4I7ZC 1KN7A 3BATA 1ZR2A 2WSSH 1HGVA 1M1JA 5KAWA 1U7JA 3NMDA 3M06A 3IFMA 4PV1D 1BE3J 2M3BA 3GHGB 1NOHA 5DJTB 5E79E 1SQXK 4R24B 3RK3B 2E5TA 1L0LD 1AQTA 2IX7C 1SVFA 3RK2B 3L72E 2AEMA 3H1KE 2E75C 2OYHB 1PGJA 1CI6B 2KCUA 1RQVA 2QE7H 3WMM0 2J5UA 1OW7A 1YI2P 3VP9A 2H88C 1N86A 4C7NB 1BDDA 3B5NC 1Q06A 4EIJA 2HR3A 3CMEP 4BWNA 2Q9IA 1NJIQ 2BCCJ 3VYIA 5GTIE 3EQ2A 4I1LA 2Q7CA 1M1JC 4D6TD 3MHVA 5AVUB 2E42A 3TGUG 4B0YA 2JDIH 2D2CC 2WTYA 5KAXA 4TLFA 5KAIH 4H13B 2JEEA 3HTKA 3WUUA 3Q5RA 1HH0A 3G3ZA 1IO4A 2WSFH 3V2RA 2WSFJ 1KYOI 3OW2O 2H43A 3GW6A 3WUVA 1PZQA 1OZHA 1NTMD 1LTGC 1GZLA 3L72G 3CD6P 1EDKA 1T2KC 2WSEH 3RL0D 3P8CE 1SQXD 1R5LA 2KNCB 3Q5SA 4U3FD 2ZYGA 2QJPC 1M8OB 2W90A 4ZMDA 2QA4P 2Q3EA 2IBZE 2WQYC 1CW5A 3HTKB 1S9KE 3Q1MA 3H1LG 2IYPA 2M0BA 4IFDK 1JYHA 2AXCA 1M1KQ 2HG5D 1J1EB 1NAFA 2KS1B 3B4SA 1ZRTD 1GL2B 2XV5A 3B5NB 1LJ2A 3RK3D 1GTWA 3L73D 3HE5B 4LHFA 1EC5A 2QEXP 3HUSB 3W67A 1JCDA 5KJ7C 2O1KA 3HH0A 3MUDA 1JY2P 5KAFE 1YQ3C 1CZQA 3OAKA 3HD7B 2JKVA 1DIPA 1X22A 1KQGB 5DJUB 2QJPB 1JY2O 2FYUG 3H1HJ 1SQBE 3RK2C 1P84D 2FBWC 2H89C 1AVYA 2BCCG 3KQGA 4IFMA 4ASWA 2P67A 1PGPA 1GU4A 1LP1A 1NTMJ 1FZCC 4IL6E 2PAJA 4PV1B 3FWNA 3MIWA 1L2PA 4MN4C 2L91A 4BXLA 2NRGA 1EZVD 1CSBA 3AE4C 2N9BA 2WSCJ 2WPRA 4NPEA 1BSHA 4H0LB 3H1IG 3SFDC 1SQBD 2C0XA 3V6IA 3TGUE 4ZNCA 2RN0A 3RK3C 1JOCA 2FXMA 1DEEG 2E76C 1R8EA 1ZR4A 2XKMA 1QLED 1L0LJ 1KFMA 4H13D 4U7JA 5APWA 1SFCD 1IFJA 3HE4A 1FOSE 2FY8A 1IK9A 4PD4H 1QVGO 2ZXXA 1VL2A 3F89A 3RK3E 1SQQE 2DW3A 3GLMA 1AV1A 1JEKA 3MZWB 2KZJA 1EDLA 1PPJD 3QAOA 3BCCE 2OTJP 1HF9A 1ZV8A 2R3CA 1KILE 1QVFO 4HYTB 1ZMEC 3H1JE 4YXDC 1T2KD 1JMBA 2G3AA 1SQPG 4PJ0H 1L0NK 1JM0A 1GK4A 5BU8B 1N73C 3LIEA 3V4WA 3WU2H 3CI9A 3L75E 2Z5HA 1BE3E 1OXZA 2M8RA 1SQXG 1J1DC 3D6YA 4WBAA 1D5YA 4LLHA 1S5LE 5AVZB 3A0HE 2ZHGA 3AE6C 1ZXGA 1T3UA 1NTMG 4OH8B 3GHGC 1Q08A 1FDIA 2WPQA 1T3JA 5KLVD 3PRJA 2OG0A 1N7SB 3NTNA 2QIWA 1SQXJ 1SFCA 3AE8C 3HD7D 2P2UA 2A45I 2P58A 4C7NA 2E43A 3KZIH 2QJKC 2GA1A 3LW5H 2YXQB 3CCJP 1FC2C 3CWBG 1Y9BA 1BE3D 3HE5A 1LP1B 2YMKA 3K5BA 3L71G 3BASA 2HPCB 1EZVI 1RE3A 2BASA 1GU5A 2IFNA 1CI6A 4UB8E 4NPFX 1OW6A 1PIXA 2HPCA 1OWAA 1OX3A 1QL1A 5AW6B 1SQVJ 3M9QA 3TNUA 3L70G 1Y47A 1MFTA 3H6PA 5APUA 2KYVA 3CCUP 3H1KD 1SFCB 3PH0A 3USSA 2JP3A 1NKZB 1WT6A 2QJKB 2IZ1A 1LTJC 3CLQA 2KB7P 1SQQG 2KS1A 4RESB 3WU2E 2K1AA 3VMAA 5TJHA 2O01H 2RH0A 1Z56A 3FGAD 2JJLA 1JY3N 5H2FH 1GL2D 5AW3B 2FYUJ 3H1HG 4IL6X 3A0BE 3R2PA 1SP4A 1NU1E 2CK3H 3R8KA 2KLUA 3NXSA 2IYOA 1LGHB 1PGOA 2A45H 5D8CA 1EDJA 3N4XA 2FYUK 1IC2A 1EZVE 3HE4B 5E01A 3L75G 4EYYQ 2M3EA 1JO5A 2IBZG 4GKGA 2WPSA 2CPBA 3AE9C 3H1IJ 3R4YA 4GDOA 4R4EA 2B88A 1X8YA 3M91A 1KORA 5KJ7D 1VF5B 2FXOA 2M5AB 3GPVA 3TDKA 4W7ZA 4LC1A 3D71A 4U3FJ 4DJGA 2HLOA 1SQVE 1OVRA 1USEA 2B87A 1U7MA 1DEBA 3AE5C 4KJMA 1LWUA 2Y0DA 4WY4D 1YJ9P 2AXTE 1YITP 2QM8A 1GW3A 2JR8A 5CCHC 3CCQP 2KOGA 3RBXA 2IZ0A 3IAOA 1Q82Q 4AYZB 5KLVK 1HWTC 3H1JJ 1ZRTE 3NFQA 1URQC 1JBGA 2XU6A 2K9YA 3Q3DA 1RQUA 4YXWH 1N7SA 4R4LA 2NPSD 4I7ZB 5AVWB 3L74D 2WSCH 3I56P 4H0LC 5AVTB 4IOIH 2POHA 4H44D 1YTZI 2KP8A 1T6AA 2BEZF 1LTJB 2OYHA 1BCCG 2ZHHA 3IN6A 4GOFA 1NTKD 4YPCA 5K5GB 3CCEP 3KPEA 2BCCE 5KTBA 1K9MQ 1DH3A 2KI7B 3P8CD 3V2NA 2FYZA 3CXHH 2HODA 1RF1C 2W6AA 3CC2P 2CPSA 5CCHA 1M7LA 2FKWB 1NTME 2V7QH 4B86A 2P7JA 1MZ9A 2KLVA 5GTIH 2I8DA 2ZVNB 3PTZA 4AQRD 1P84I 3B5NA 2LR2A 1FZBA 1S9KD 1KV4A 4EOTA 5KAUA 3V5BA 4N78D 1N8RQ 4L74A 2B9BA 3A2AA 2KSEA 3PJSK 4XA4A 5AVQB 3QWOC 1GW4A 2WVRA 3ZDMA 2E76D 2PP6A 2Y0EA 1FJPA 2O01N 1H88A 2P10A 2YKQA 3H32B 3MGNA 2E74B 3M9HA 1SLQA 1JNMA 2IEFA 5EFWB 4H44B 1Y6UA 2KUBA 4N6JA 1QGKB 4L73A 2Q1KA 4D6TE 3A0BH 2NPSB 3L74G 1X0TA 3BCCG 5KATA 3U1AA 1GDTA 1BGYJ 2NZ2A 1EZVG 3RL0g 2OTLP 2C9NY 3E0HA 1QEXA 3QH9A 3E7KA 3EZFA 2YIUB 1G2CB 3ABVC 3V2PA 5TISH 4H44C 1NTMK 2YMYA 1VQNP 1SS1A 2ZAEB 2QM7A 3JSVC 4R4MA 1L4AD 1GD2E 2YNYA 5GQQA 5CMZA 4NPDA 4N3YB 1Q81Q 1AA0A 3H1KJ 2ZXEB 1L0LE 1KILB 1XTGB 3MUDC 2LXBA 1S5LH 1N73B 3GMAA 3EZ6A 3GG2A 4RO0A 1IK7A 1VQ9P 5AVYB 1KQLA 2ZYDA 3BRTB 1HVVA 4A7PA 2C0WA 2PGDA 2YXRB 3B49A 2QVAA 4O9BA 3G6EP 4WLSA 2KXPB 2M5AA 1KC8Q 4Y99C 3TSIA 4PJ0E 1X79B 1H8AA 4DCZA 3EWKA 3V4QA 2L5GB 1FJKA 1M1JB 2KK7A 2KNCA 3RK2D 1NAYA 5CJ4A 1OIPA 2KIKA 3KHUA 4N78E 1A02F 3H1HD 3W68A 3L75J 1KQFB 5KLVE 4JBZA 1IFIA 1PPJG 3S4RA 2FYNC 2PRRA 1NTKJ 4WWIA 1HUCA 1H0TB 1JTHA 1W2EA 3GF3A 5L8RJ 1L4AA 1LT9A 3C9IA 5APSA 4OGQB 5KCBA 1VQMP 2AEFA 1IFMA 1BOWA 3H1KG 1KB9D 2OYIB 1VF5C 5CHXA 1FZFA 3OA7A 3L75D 1Q7YQ 1M56D 2N1TD 1OW8A 1FS0E 2E75B 1NTKE 3L73J 3L73E 4WVZA 2Q5UA 2ZYAA 4DOJA 1VDFA 2D2CD 3N7NA 3H1JD 1BDCA 1FZCA 3TNUB 4AUWA 1PL5A 1M90Q 1J1DB 2RMZA 1ZLLA 1YTZT 2WWWA 4H0LD 3CWBD 3B8EB 1BGYG 4L75A 1G2CA 2OYIC 1VQLP 1IFPA 1MV8A 4OGQC 2IBZD 4ZKUA 2A06G 5CCGA 2Z4EA 3CXHI 2WZ7A 3VMYA 1NKNA 1FDOA 1LTAC 3PHLA 2HYNA 2FYUD 4HKZH 3IF4A 1MFZA 1RE4C 1VF5D 2JO1A 4RJTA 3L37A 4WY4C 3KYQA 2I1KA 2W27A 5KKZB 5CCGD 5APTA 3U59A 3L72J 3L74E 3L74J 1LTTC 1QX8A 5APQA 3JC22 2IDBA 1VQ7P 3AEDC 5APYA 1NTZJ 3AEFC 1YJWP 1S1CX 5B5EH 1IJDB 3D6ZA 1SQVK 2YO3A 3ITKA 3CPWO 5B5EE 1Y8AA 5CCHD 2MJZA 3UIAA 1W2BO 3P8MC 2C9LY 3H1LD 3L71E 5KAIE 1YJNP 2K88A 3H1IE 2N1TA 5AVSB 3B71A 1KB9I 1ZW0A 3H32A 3CXHE 3CX5H 2H8PD 1VQ6P 4WLWA 1BE3G 5C39A 3R8JA 3L70E 1Q09A 2E75D 1NO4A 4IL6H 1GK6A 1SQBK 4OGQD 3G71P 1SQBG 2WSEJ 1SQPD 1J2JB 1VQ5P 3FXEA 4C46A 1NYHA 1NVOA 3L36A 1J1EC 4HH2A 1FZAA 1BGYE 1LTSC 1VQKP 3S9OA 1ZOYC 1HGZA 1SQQJ 3EZ7A 1RH5B 1AVOA 2OARA 1Q2NA 2HODB 1H89A 3L35A 3SFEC 1S5LX 1NU1J 2E74D 1KYOH 1IFNA 2GUVA 1VQOP 4Y99B 3CCVP 4IFFA 2J58A 2W6JH 2XNXA 3GF7A 1RHZB 1YIJP 3P32A 2XDJA 3CCRP 1HJ0A 3MP7B 1RF0A 3V2QA 5KLIB 2P1JA 2W8ZA 1LWUC 3JCUE 1NTZK 1MKMA 5E79H 3AE3C 1UIXA 2OGUA 2KZIA 3BRVB 4J2NA 1FZCB 4WB4A 1JCCA 3G4SP 4Y28J 4AYZA 1URQA 2E5YA 2OTKE 1PP9D 4ASVA 3AEEC 1KZUB 2HVAA 1GL2A 2A06D 2Q6QA 2IFMA 3M0AA 2ZVOB 2YO2A 1KILD 4M3LA 4JYBA 3CMAP 1S3JA 2VZ4A 4UB6E 2K3RA 2AEJA 4GOEA 1GMJA 4K3AA 1JTHB 2SPZA 2Y9ZA 3VP8A 1KFNA 1K04A 4AYCA 1SQQD 1AFOA 2ITAA 1N7LA 1E5WA 3A7OA 3T97A 1RH6A 2BCCD 3PP5A 1UIIA 1SQVG 3E1IA 2JWAA 5KLVJ 3II6A 1DX7A 1K05A 1SQQK 4D6TG 1QL2A 3F5HA 5M1BA 1PGQA 4HJGH 5AW7B 4C7RA 1OFCX 2ZT9C 5AW1B 5AW2B 5KAVA 1NU1K 3BCCD 1PPJE 1BCCJ 1Q05A 4QMAA 1HTLC 1KYOE 2GOVA 1KTMA 3CWBJ 2V7QJ 1DD4A 3VN0A 5GTHE 1KMIZ 3GP4A 1JB0J 3JCUH 3CX5D 1U57A 4GT1A 1G1JA 1KILA 3CCLP 2WT7B 1VQPP 2FYNB 3VTPC 1PFIA 4XE5B 3AE7C 5CJ0A 4DZOA 1P84E 3M9BA 3LURA 2ZT9D 1OMIA 2QG4A 4ZKPA 4BRYA 1URQD 5TISE 2WT7A 1L0LG 1OVUA 3MD0A 3CCSP 1G1IA 3EZ2A 2Q3IA 1D7MA 1NTZG 2G8YA 2LKMA 2WMMA 5AW8B 4WY4B 4LGDE 5BU5A 4D6TJ 5BVZA 1T8ZA
chains in the Genus database with same CATH topology
1PV3A 1BOWA 2IDBA 2E74C 3AE5C 3R8KA 1VF5C 1ZMEC 3SFEC 1KQGB 1S5LX 3AEDC 4H13B 1YQ4C 2E74D 4R4MA 4YXDC 3AEAC 3AEFC 3Q5RA 2G3AA 1S1CX 4I7ZC 5KAUA 1RH6A 2H89C 2FBWC 3GK6A 2WSFJ 3C8VA 5GQQA 3D6ZA 1WMKA 2QJYC 2DG6A 2ZT9B 2JP3A 4Z1MH 3IAOA 5KAWA 1OW8A 4AYZB 3GF7A 4PV1D 2E75B 4TT3H 4A1MA 1K05A 3Q5PA 3AECC 1HJ0A 3EZ9A 2WPVB 4PV1B 2KVVA 2D2CD 1ZRTE 3O6QA 2E76B 3GMAA 1JBGA 3EZ6A 5M1BA 3D6YA 3UCSA 3FGAD 2E76D 3B71A 2ZT9C 1D5YA 4RKUJ 2K9YA 4R24B 1IK7A 1PL5A 3Q3DA 1ZP0C 1RQUA 2BOWA 3Q2YA 5KLIC 3Q5SA 1AJYA 5KAVA 4R4LA 4IL6X 2ZHGA 3AE6C 4I7ZB 4H0LD 2QJPC 1Q05A 3AE4C 2P10A 1MKMA 4WLWA 2WSCJ 3G9RA 4H0LC 4H13C 2E75C 3AE3C 1DD3A 1Q08A 1UIXA 2GOVA 4H0LB 3AE1C 2E74B 4J2NA 1EXIA 1KTMA 3B49A 3R8JA 3D70A 3SFDC 2V7QJ 2IEFA 1FDIA 1DD4A 4H44D 1KMIZ 4OGQC 1Q09A 2BEZF 3GP4A 2WQYC 4WLSA 2KCUA 2ZHHA 1RQVA 1JB0J 4H44B 3Q1MA 1R8DA 1U57A 3IN6A 2E75D 5D8CA 1TU3F 2OQQA 4Y28J 1Y6UA 4DCZA 3EWKA 1Q90D 4AYZA 2OG0A 2QIWA 2E76C 5KKZC 1R8EA 2J5UA 4PV1C 3AE2C 1FDOA 4XFJA 3AEEC 1JYHA 1OW7A 3AE8C 2HVAA 3AE7C 2O01J 3H25A 4OGQD 5D90A 2BEQD 5E01A 2WSEJ 2H88C 1Q0AA 3T97B 2QJKC 4H13D 4U7JA 5I44A 1Q07A 1Q06A 3AEGC 2ZT9D 3LURA 1OMIA 3AE9C 1VF5D 1NYHA 3R4YA 4GDOA 1Y9BA 2JO1A 2YIUC 4R4EA 5KATA 1PM6A 2QSIA 1KQFB 1VL2A 2FXPA 2MKVA 3RK3E 2NZ2A 4LHFA 2YMKA 3RL0g 1EXJA 4R22B 3GLMA 3EZ2A 2VZ4A 2FYNC 1KORA 1GMJA 1VF5B 2G8YA 3GPVA 3E0HA 5I41B 3AEBC 4KT0J 3GF3A 1ZOYC 4YTPC 3S9OA 3HH0A 5L8RJ 2JMLA 3D71A 4B0YA 3EZFA 2D2CC 1OW6A 1PIXA 3ABVC 1YQ3C 3QAOA 3LW5J 5KAXA 2D2CB 4H44C 1K04A 1HF9A 3EZ7A 1NGMB 4OGQB 5KCBA 1LX8A 1DIPA 1KILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP4 A;  3Q5P A;  1BOW A;  4WLS A;  4R4E A;  2KCU A;  2ZHH A;  5KAT A;  3Q1M A;  1R8D A;  5D8C A;  4R4M A;  1JBG A;  2OQQ A;  3D6Y A;  3UCS A;  1D5Y A;  3Q5R A;  1EXJ A;  4R22 B;  4AYZ A;  5KAU A;  2VZ4 A;  4R24 B;  2BOW A;  3GK6 A;  3Q3D A;  1R8E A;  3Q2Y A;  5GQQ A;  2J5U A;  3D6Z A;  1JYH A;  3Q5S A;  5KAV A;  3GPV A;  4R4L A;  5I41 B;  3E0H A;  2ZHG A;  2HVA A;  2DG6 A;  5D90 A;  1Q05 A;  5E01 A;  3HH0 A;  1DIP A;  2JML A;  3D71 A;  4B0Y A;  3IAO A;  4WLW A;  3G9R A;  5KAW A;  1Q0A A;  3QAO A;  4A1M A;  3T97 B;  1Q08 A;  2GOV A;  3B49 A;  5KAX A;  3R8K A;  4AYZ B;  4J2N A;  1EXI A;  5I44 A;  1Q07 A;  3R8J A;  1Q06 A;  3D70 A;  3LUR A;  5KCB A;  1Q09 A; 
#chains in the Genus database with same CATH topology
 1LTI C;  3P7K A;  1L0N D;  2RKL A;  1EDI A;  1NTK K;  2NPS A;  4EDF A;  1N2D C;  3C1L A;  2VRS A;  4DCK A;  2DG6 A;  3CWB E;  3PLN A;  1KD1 Q;  3VMZ A;  3AEC C;  3EZ9 A;  1KIL C;  2WPV B;  3I55 P;  2KVV A;  3O6Q A;  3I5C A;  1BCC E;  2QJY B;  2W6B A;  2BOW A;  2R32 A;  1ZP0 C;  1NU1 D;  1ZN5 A;  3OJA B;  2A06 E;  2OYI A;  1AJY A;  4U3F E;  1PP9 E;  1IZN B;  1M57 D;  1AQ5 A;  3LID A;  3KXD A;  4A1M A;  1DD3 A;  1WRG A;  2YKO A;  3A0H H;  4I6M C;  1KB9 H;  3TK1 A;  1SQX E;  1H0T A;  3KDP B;  1R8D A;  3U1C A;  2OQQ A;  1L0N G;  5KJ7 A;  2QRX A;  3AE2 C;  2O01 J;  3H25 A;  3IR9 A;  1VQ8 P;  1NTZ E;  2N1T B;  1RF1 B;  4PD4 E;  1BSN A;  2FFD B;  5CBO A;  2H7H A;  1S2E A;  2QSI A;  4HB1 A;  2FXP A;  3H1H E;  4DT0 A;  2R44 A;  1EXJ A;  4R22 B;  3HUS C;  1MUU A;  1NU1 G;  1YYC A;  5AVV B;  3SSU A;  2JML A;  1JMM A;  1RY3 A;  2R5B A;  1LX8 A;  2E74 C;  2ZJS E;  1L0N J;  3GK6 A;  1N73 A;  2PFX A;  1HJB A;  3SWY A;  1OVV A;  2ZT9 B;  2XZR A;  3VMX A;  2A45 G;  1USD A;  1LNQ A;  2N1T C;  4U3F G;  3TGU J;  5KLV G;  1FAV A;  1IFD A;  1FOS F;  2E76 B;  3VOP A;  2IPP A;  3RL0 C;  4PD4 D;  1NTZ D;  1JUN A;  3Q2Y A;  4JF7 A;  1K8A Q;  4GOD A;  2LXC B;  4KHX A;  3TYY A;  3L72 D;  3S1K A;  2Y9Y A;  3L73 G;  3AE1 C;  1FE6 A;  1EXI A;  1JY3 P;  4JPZ B;  3CL3 D;  3HUS A;  1LWU B;  1SQB J;  3E1R A;  1VQ4 P;  4UB8 H;  2B87 B;  1LT9 B;  4PV1 C;  2AXT H;  4W80 A;  5B66 E;  4OWF A;  3CXH D;  3H1L J;  3BCC J;  1PP9 J;  1Q0A A;  1BCC D;  3CX5 I;  5I44 A;  3SWK A;  1BGY D;  2GM4 A;  2YIU C;  5AW5 B;  3HD7 A;  3RGU A;  4OVN F;  3B5N D;  1SQP E;  3AEB C;  4YTP C;  3L4F A;  2YKP A;  3LW5 J;  4EI2 A;  1L0N E;  5GTH H;  1L4A C;  1LT9 C;  2FFD A;  3L70 D;  3EFG A;  1WMK A;  3O8Z A;  2KSJ A;  2I1J A;  1RF0 C;  1X9V A;  1LT1 A;  3Q5P A;  2O3J A;  1R5S A;  5H2F E;  3H1I D;  3TGU D;  3O6Q B;  3UCS A;  1SFC C;  3L71 D;  3RL0 B;  3H1L E;  5KLI C;  1URQ B;  1YHQ P;  2JWD A;  3L70 J;  4I2L C;  3G9R A;  2Z5I A;  3H1J G;  3D70 A;  1K73 Q;  3CX5 E;  3HD7 C;  5CBN A;  1N7S D;  2K9J A;  1P84 H;  1Q90 D;  1FZE A;  5AVX B;  5AVR B;  4XFJ A;  1KQS O;  1XTC C;  5D90 A;  5CCG C;  2BEQ D;  1S72 P;  5AW9 B;  2B89 A;  2OYO A;  2R3S A;  2FFD C;  5APX A;  1L0L K;  1PM6 A;  2MKV A;  1RE4 A;  4BRY B;  4JYC A;  3TF5 A;  1Q86 Q;  4WY4 A;  3M0D A;  4K35 A;  1LTJ A;  2FYU E;  1NHL A;  2D2C B;  3EFF K;  2ZFC A;  1PV3 A;  1KB9 E;  1FU1 A;  4CPG A;  2K9J B;  1NTK G;  1YQ4 C;  1E79 H;  3AEA C;  1FZG A;  3SWF A;  4JQ0 D;  2R5D A;  3C8V A;  1EQ7 A;  1S4X A;  3A3Y B;  1FBM A;  4GIF A;  5AW0 B;  2QJY C;  4Z1M H;  5AW4 B;  2K37 A;  3FX0 A;  1A02 J;  1JY2 N;  4TT3 H;  3FXD A;  2UWJ E;  1W5C E;  3HRN A;  1NWQ A;  2HFE D;  1N7S C;  4W7Y A;  2XND H;  4RKU J;  2N9Y B;  1SQP J;  3A5T A;  3L71 J;  3KZI E;  4UB6 H;  2OYH C;  4H13 C;  1L4A B;  3BVH A;  3GHG A;  3CC7 P;  1TU3 F;  3FWL A;  1SQP K;  5KAF H;  3M0D C;  3WUT A;  1SQV D;  5KKZ C;  2Y0C A;  3RBZ A;  1FDM A;  1RF1 A;  3T97 B;  2WIT A;  1JY3 O;  1Q07 A;  3AEG C;  5APV A;  2O1J A;  3CC4 P;  2IBZ I;  2W83 C;  5B66 H;  3CCM P;  5I41 B;  4KT0 J;  1VPC A;  1KYO D;  1RE3 C;  4PD4 I;  2GUS A;  1LTB C;  1NH4 A;  1GL2 C;  2V4H A;  3MTU E;  1NGM B;  1HBW A;  2NPS C;  1PP9 G;  4L76 A;  1YBK A;  2J59 M;  4I7Z C;  1KN7 A;  3BAT A;  1ZR2 A;  2WSS H;  1HGV A;  1M1J A;  5KAW A;  1U7J A;  3NMD A;  3M06 A;  3IFM A;  4PV1 D;  1BE3 J;  2M3B A;  3GHG B;  1NOH A;  5DJT B;  5E79 E;  1SQX K;  4R24 B;  3RK3 B;  2E5T A;  1L0L D;  1AQT A;  2IX7 C;  1SVF A;  3RK2 B;  3L72 E;  2AEM A;  3H1K E;  2E75 C;  2OYH B;  1PGJ A;  1CI6 B;  2KCU A;  1RQV A;  2QE7 H;  3WMM 0;  2J5U A;  1OW7 A;  1YI2 P;  3VP9 A;  2H88 C;  1N86 A;  4C7N B;  1BDD A;  3B5N C;  1Q06 A;  4EIJ A;  2HR3 A;  3CME P;  4BWN A;  2Q9I A;  1NJI Q;  2BCC J;  3VYI A;  5GTI E;  3EQ2 A;  4I1L A;  2Q7C A;  1M1J C;  4D6T D;  3MHV A;  5AVU B;  2E42 A;  3TGU G;  4B0Y A;  2JDI H;  2D2C C;  2WTY A;  5KAX A;  4TLF A;  5KAI H;  4H13 B;  2JEE A;  3HTK A;  3WUU A;  3Q5R A;  1HH0 A;  3G3Z A;  1IO4 A;  2WSF H;  3V2R A;  2WSF J;  1KYO I;  3OW2 O;  2H43 A;  3GW6 A;  3WUV A;  1PZQ A;  1OZH A;  1NTM D;  1LTG C;  1GZL A;  3L72 G;  3CD6 P;  1EDK A;  1T2K C;  2WSE H;  3RL0 D;  3P8C E;  1SQX D;  1R5L A;  2KNC B;  3Q5S A;  4U3F D;  2ZYG A;  2QJP C;  1M8O B;  2W90 A;  4ZMD A;  2QA4 P;  2Q3E A;  2IBZ E;  2WQY C;  1CW5 A;  3HTK B;  1S9K E;  3Q1M A;  3H1L G;  2IYP A;  2M0B A;  4IFD K;  1JYH A;  2AXC A;  1M1K Q;  2HG5 D;  1J1E B;  1NAF A;  2KS1 B;  3B4S A;  1ZRT D;  1GL2 B;  2XV5 A;  3B5N B;  1LJ2 A;  3RK3 D;  1GTW A;  3L73 D;  3HE5 B;  4LHF A;  1EC5 A;  2QEX P;  3HUS B;  3W67 A;  1JCD A;  5KJ7 C;  2O1K A;  3HH0 A;  3MUD A;  1JY2 P;  5KAF E;  1YQ3 C;  1CZQ A;  3OAK A;  3HD7 B;  2JKV A;  1DIP A;  1X22 A;  1KQG B;  5DJU B;  2QJP B;  1JY2 O;  2FYU G;  3H1H J;  1SQB E;  3RK2 C;  1P84 D;  2FBW C;  2H89 C;  1AVY A;  2BCC G;  3KQG A;  4IFM A;  4ASW A;  2P67 A;  1PGP A;  1GU4 A;  1LP1 A;  1NTM J;  1FZC C;  4IL6 E;  2PAJ A;  4PV1 B;  3FWN A;  3MIW A;  1L2P A;  4MN4 C;  2L91 A;  4BXL A;  2NRG A;  1EZV D;  1CSB A;  3AE4 C;  2N9B A;  2WSC J;  2WPR A;  4NPE A;  1BSH A;  4H0L B;  3H1I G;  3SFD C;  1SQB D;  2C0X A;  3V6I A;  3TGU E;  4ZNC A;  2RN0 A;  3RK3 C;  1JOC A;  2FXM A;  1DEE G;  2E76 C;  1R8E A;  1ZR4 A;  2XKM A;  1QLE D;  1L0L J;  1KFM A;  4H13 D;  4U7J A;  5APW A;  1SFC D;  1IFJ A;  3HE4 A;  1FOS E;  2FY8 A;  1IK9 A;  4PD4 H;  1QVG O;  2ZXX A;  1VL2 A;  3F89 A;  3RK3 E;  1SQQ E;  2DW3 A;  3GLM A;  1AV1 A;  1JEK A;  3MZW B;  2KZJ A;  1EDL A;  1PPJ D;  3QAO A;  3BCC E;  2OTJ P;  1HF9 A;  1ZV8 A;  2R3C A;  1KIL E;  1QVF O;  4HYT B;  1ZME C;  3H1J E;  4YXD C;  1T2K D;  1JMB A;  2G3A A;  1SQP G;  4PJ0 H;  1L0N K;  1JM0 A;  1GK4 A;  5BU8 B;  1N73 C;  3LIE A;  3V4W A;  3WU2 H;  3CI9 A;  3L75 E;  2Z5H A;  1BE3 E;  1OXZ A;  2M8R A;  1SQX G;  1J1D C;  3D6Y A;  4WBA A;  1D5Y A;  4LLH A;  1S5L E;  5AVZ B;  3A0H E;  2ZHG A;  3AE6 C;  1ZXG A;  1T3U A;  1NTM G;  4OH8 B;  3GHG C;  1Q08 A;  1FDI A;  2WPQ A;  1T3J A;  5KLV D;  3PRJ A;  2OG0 A;  1N7S B;  3NTN A;  2QIW A;  1SQX J;  1SFC A;  3AE8 C;  3HD7 D;  2P2U A;  2A45 I;  2P58 A;  4C7N A;  2E43 A;  3KZI H;  2QJK C;  2GA1 A;  3LW5 H;  2YXQ B;  3CCJ P;  1FC2 C;  3CWB G;  1Y9B A;  1BE3 D;  3HE5 A;  1LP1 B;  2YMK A;  3K5B A;  3L71 G;  3BAS A;  2HPC B;  1EZV I;  1RE3 A;  2BAS A;  1GU5 A;  2IFN A;  1CI6 A;  4UB8 E;  4NPF X;  1OW6 A;  1PIX A;  2HPC A;  1OWA A;  1OX3 A;  1QL1 A;  5AW6 B;  1SQV J;  3M9Q A;  3TNU A;  3L70 G;  1Y47 A;  1MFT A;  3H6P A;  5APU A;  2KYV A;  3CCU P;  3H1K D;  1SFC B;  3PH0 A;  3USS A;  2JP3 A;  1NKZ B;  1WT6 A;  2QJK B;  2IZ1 A;  1LTJ C;  3CLQ A;  2KB7 P;  1SQQ G;  2KS1 A;  4RES B;  3WU2 E;  2K1A A;  3VMA A;  5TJH A;  2O01 H;  2RH0 A;  1Z56 A;  3FGA D;  2JJL A;  1JY3 N;  5H2F H;  1GL2 D;  5AW3 B;  2FYU J;  3H1H G;  4IL6 X;  3A0B E;  3R2P A;  1SP4 A;  1NU1 E;  2CK3 H;  3R8K A;  2KLU A;  3NXS A;  2IYO A;  1LGH B;  1PGO A;  2A45 H;  5D8C A;  1EDJ A;  3N4X A;  2FYU K;  1IC2 A;  1EZV E;  3HE4 B;  5E01 A;  3L75 G;  4EYY Q;  2M3E A;  1JO5 A;  2IBZ G;  4GKG A;  2WPS A;  2CPB A;  3AE9 C;  3H1I J;  3R4Y A;  4GDO A;  4R4E A;  2B88 A;  1X8Y A;  3M91 A;  1KOR A;  5KJ7 D;  1VF5 B;  2FXO A;  2M5A B;  3GPV A;  3TDK A;  4W7Z A;  4LC1 A;  3D71 A;  4U3F J;  4DJG A;  2HLO A;  1SQV E;  1OVR A;  1USE A;  2B87 A;  1U7M A;  1DEB A;  3AE5 C;  4KJM A;  1LWU A;  2Y0D A;  4WY4 D;  1YJ9 P;  2AXT E;  1YIT P;  2QM8 A;  1GW3 A;  2JR8 A;  5CCH C;  3CCQ P;  2KOG A;  3RBX A;  2IZ0 A;  3IAO A;  1Q82 Q;  4AYZ B;  5KLV K;  1HWT C;  3H1J J;  1ZRT E;  3NFQ A;  1URQ C;  1JBG A;  2XU6 A;  2K9Y A;  3Q3D A;  1RQU A;  4YXW H;  1N7S A;  4R4L A;  2NPS D;  4I7Z B;  5AVW B;  3L74 D;  2WSC H;  3I56 P;  4H0L C;  5AVT B;  4IOI H;  2POH A;  4H44 D;  1YTZ I;  2KP8 A;  1T6A A;  2BEZ F;  1LTJ B;  2OYH A;  1BCC G;  2ZHH A;  3IN6 A;  4GOF A;  1NTK D;  4YPC A;  5K5G B;  3CCE P;  3KPE A;  2BCC E;  5KTB A;  1K9M Q;  1DH3 A;  2KI7 B;  3P8C D;  3V2N A;  2FYZ A;  3CXH H;  2HOD A;  1RF1 C;  2W6A A;  3CC2 P;  2CPS A;  5CCH A;  1M7L A;  2FKW B;  1NTM E;  2V7Q H;  4B86 A;  2P7J A;  1MZ9 A;  2KLV A;  5GTI H;  2I8D A;  2ZVN B;  3PTZ A;  4AQR D;  1P84 I;  3B5N A;  2LR2 A;  1FZB A;  1S9K D;  1KV4 A;  4EOT A;  5KAU A;  3V5B A;  4N78 D;  1N8R Q;  4L74 A;  2B9B A;  3A2A A;  2KSE A;  3PJS K;  4XA4 A;  5AVQ B;  3QWO C;  1GW4 A;  2WVR A;  3ZDM A;  2E76 D;  2PP6 A;  2Y0E A;  1FJP A;  2O01 N;  1H88 A;  2P10 A;  2YKQ A;  3H32 B;  3MGN A;  2E74 B;  3M9H A;  1SLQ A;  1JNM A;  2IEF A;  5EFW B;  4H44 B;  1Y6U A;  2KUB A;  4N6J A;  1QGK B;  4L73 A;  2Q1K A;  4D6T E;  3A0B H;  2NPS B;  3L74 G;  1X0T A;  3BCC G;  5KAT A;  3U1A A;  1GDT A;  1BGY J;  2NZ2 A;  1EZV G;  3RL0 g;  2OTL P;  2C9N Y;  3E0H A;  1QEX A;  3QH9 A;  3E7K A;  3EZF A;  2YIU B;  1G2C B;  3ABV C;  3V2P A;  5TIS H;  4H44 C;  1NTM K;  2YMY A;  1VQN P;  1SS1 A;  2ZAE B;  2QM7 A;  3JSV C;  4R4M A;  1L4A D;  1GD2 E;  2YNY A;  5GQQ A;  5CMZ A;  4NPD A;  4N3Y B;  1Q81 Q;  1AA0 A;  3H1K J;  2ZXE B;  1L0L E;  1KIL B;  1XTG B;  3MUD C;  2LXB A;  1S5L H;  1N73 B;  3GMA A;  3EZ6 A;  3GG2 A;  4RO0 A;  1IK7 A;  1VQ9 P;  5AVY B;  1KQL A;  2ZYD A;  3BRT B;  1HVV A;  4A7P A;  2C0W A;  2PGD A;  2YXR B;  3B49 A;  2QVA A;  4O9B A;  3G6E P;  4WLS A;  2KXP B;  2M5A A;  1KC8 Q;  4Y99 C;  3TSI A;  4PJ0 E;  1X79 B;  1H8A A;  4DCZ A;  3EWK A;  3V4Q A;  2L5G B;  1FJK A;  1M1J B;  2KK7 A;  2KNC A;  3RK2 D;  1NAY A;  5CJ4 A;  1OIP A;  2KIK A;  3KHU A;  4N78 E;  1A02 F;  3H1H D;  3W68 A;  3L75 J;  1KQF B;  5KLV E;  4JBZ A;  1IFI A;  1PPJ G;  3S4R A;  2FYN C;  2PRR A;  1NTK J;  4WWI A;  1HUC A;  1H0T B;  1JTH A;  1W2E A;  3GF3 A;  5L8R J;  1L4A A;  1LT9 A;  3C9I A;  5APS A;  4OGQ B;  5KCB A;  1VQM P;  2AEF A;  1IFM A;  1BOW A;  3H1K G;  1KB9 D;  2OYI B;  1VF5 C;  5CHX A;  1FZF A;  3OA7 A;  3L75 D;  1Q7Y Q;  1M56 D;  2N1T D;  1OW8 A;  1FS0 E;  2E75 B;  1NTK E;  3L73 J;  3L73 E;  4WVZ A;  2Q5U A;  2ZYA A;  4DOJ A;  1VDF A;  2D2C D;  3N7N A;  3H1J D;  1BDC A;  1FZC A;  3TNU B;  4AUW A;  1PL5 A;  1M90 Q;  1J1D B;  2RMZ A;  1ZLL A;  1YTZ T;  2WWW A;  4H0L D;  3CWB D;  3B8E B;  1BGY G;  4L75 A;  1G2C A;  2OYI C;  1VQL P;  1IFP A;  1MV8 A;  4OGQ C;  2IBZ D;  4ZKU A;  2A06 G;  5CCG A;  2Z4E A;  3CXH I;  2WZ7 A;  3VMY A;  1NKN A;  1FDO A;  1LTA C;  3PHL A;  2HYN A;  2FYU D;  4HKZ H;  3IF4 A;  1MFZ A;  1RE4 C;  1VF5 D;  2JO1 A;  4RJT A;  3L37 A;  4WY4 C;  3KYQ A;  2I1K A;  2W27 A;  5KKZ B;  5CCG D;  5APT A;  3U59 A;  3L72 J;  3L74 E;  3L74 J;  1LTT C;  1QX8 A;  5APQ A;  3JC2 2;  2IDB A;  1VQ7 P;  3AED C;  5APY A;  1NTZ J;  3AEF C;  1YJW P;  1S1C X;  5B5E H;  1IJD B;  3D6Z A;  1SQV K;  2YO3 A;  3ITK A;  3CPW O;  5B5E E;  1Y8A A;  5CCH D;  2MJZ A;  3UIA A;  1W2B O;  3P8M C;  2C9L Y;  3H1L D;  3L71 E;  5KAI E;  1YJN P;  2K88 A;  3H1I E;  2N1T A;  5AVS B;  3B71 A;  1KB9 I;  1ZW0 A;  3H32 A;  3CXH E;  3CX5 H;  2H8P D;  1VQ6 P;  4WLW A;  1BE3 G;  5C39 A;  3R8J A;  3L70 E;  1Q09 A;  2E75 D;  1NO4 A;  4IL6 H;  1GK6 A;  1SQB K;  4OGQ D;  3G71 P;  1SQB G;  2WSE J;  1SQP D;  1J2J B;  1VQ5 P;  3FXE A;  4C46 A;  1NYH A;  1NVO A;  3L36 A;  1J1E C;  4HH2 A;  1FZA A;  1BGY E;  1LTS C;  1VQK P;  3S9O A;  1ZOY C;  1HGZ A;  1SQQ J;  3EZ7 A;  1RH5 B;  1AVO A;  2OAR A;  1Q2N A;  2HOD B;  1H89 A;  3L35 A;  3SFE C;  1S5L X;  1NU1 J;  2E74 D;  1KYO H;  1IFN A;  2GUV A;  1VQO P;  4Y99 B;  3CCV P;  4IFF A;  2J58 A;  2W6J H;  2XNX A;  3GF7 A;  1RHZ B;  1YIJ P;  3P32 A;  2XDJ A;  3CCR P;  1HJ0 A;  3MP7 B;  1RF0 A;  3V2Q A;  5KLI B;  2P1J A;  2W8Z A;  1LWU C;  3JCU E;  1NTZ K;  1MKM A;  5E79 H;  3AE3 C;  1UIX A;  2OGU A;  2KZI A;  3BRV B;  4J2N A;  1FZC B;  4WB4 A;  1JCC A;  3G4S P;  4Y28 J;  4AYZ A;  1URQ A;  2E5Y A;  2OTK E;  1PP9 D;  4ASV A;  3AEE C;  1KZU B;  2HVA A;  1GL2 A;  2A06 D;  2Q6Q A;  2IFM A;  3M0A A;  2ZVO B;  2YO2 A;  1KIL D;  4M3L A;  4JYB A;  3CMA P;  1S3J A;  2VZ4 A;  4UB6 E;  2K3R A;  2AEJ A;  4GOE A;  1GMJ A;  4K3A A;  1JTH B;  2SPZ A;  2Y9Z A;  3VP8 A;  1KFN A;  1K04 A;  4AYC A;  1SQQ D;  1AFO A;  2ITA A;  1N7L A;  1E5W A;  3A7O A;  3T97 A;  1RH6 A;  2BCC D;  3PP5 A;  1UII A;  1SQV G;  3E1I A;  2JWA A;  5KLV J;  3II6 A;  1DX7 A;  1K05 A;  1SQQ K;  4D6T G;  1QL2 A;  3F5H A;  5M1B A;  1PGQ A;  4HJG H;  5AW7 B;  4C7R A;  1OFC X;  2ZT9 C;  5AW1 B;  5AW2 B;  5KAV A;  1NU1 K;  3BCC D;  1PPJ E;  1BCC J;  1Q05 A;  4QMA A;  1HTL C;  1KYO E;  2GOV A;  1KTM A;  3CWB J;  2V7Q J;  1DD4 A;  3VN0 A;  5GTH E;  1KMI Z;  3GP4 A;  1JB0 J;  3JCU H;  3CX5 D;  1U57 A;  4GT1 A;  1G1J A;  1KIL A;  3CCL P;  2WT7 B;  1VQP P;  2FYN B;  3VTP C;  1PFI A;  4XE5 B;  3AE7 C;  5CJ0 A;  4DZO A;  1P84 E;  3M9B A;  3LUR A;  2ZT9 D;  1OMI A;  2QG4 A;  4ZKP A;  4BRY A;  1URQ D;  5TIS E;  2WT7 A;  1L0L G;  1OVU A;  3MD0 A;  3CCS P;  1G1I A;  3EZ2 A;  2Q3I A;  1D7M A;  1NTZ G;  2G8Y A;  2LKM A;  2WMM A;  5AW8 B;  4WY4 B;  4LGD E;  5BU5 A;  4D6T J;  5BVZ A;  1T8Z A; 
#chains in the Genus database with same CATH homology
 1PV3 A;  1BOW A;  2IDB A;  2E74 C;  3AE5 C;  3R8K A;  1VF5 C;  1ZME C;  3SFE C;  1KQG B;  1S5L X;  3AED C;  4H13 B;  1YQ4 C;  2E74 D;  4R4M A;  4YXD C;  3AEA C;  3AEF C;  3Q5R A;  2G3A A;  1S1C X;  4I7Z C;  5KAU A;  1RH6 A;  2H89 C;  2FBW C;  3GK6 A;  2WSF J;  3C8V A;  5GQQ A;  3D6Z A;  1WMK A;  2QJY C;  2DG6 A;  2ZT9 B;  2JP3 A;  4Z1M H;  3IAO A;  5KAW A;  1OW8 A;  4AYZ B;  3GF7 A;  4PV1 D;  2E75 B;  4TT3 H;  4A1M A;  1K05 A;  3Q5P A;  3AEC C;  1HJ0 A;  3EZ9 A;  2WPV B;  4PV1 B;  2KVV A;  2D2C D;  1ZRT E;  3O6Q A;  2E76 B;  3GMA A;  1JBG A;  3EZ6 A;  5M1B A;  3D6Y A;  3UCS A;  3FGA D;  2E76 D;  3B71 A;  2ZT9 C;  1D5Y A;  4RKU J;  2K9Y A;  4R24 B;  1IK7 A;  1PL5 A;  3Q3D A;  1ZP0 C;  1RQU A;  2BOW A;  3Q2Y A;  5KLI C;  3Q5S A;  1AJY A;  5KAV A;  4R4L A;  4IL6 X;  2ZHG A;  3AE6 C;  4I7Z B;  4H0L D;  2QJP C;  1Q05 A;  3AE4 C;  2P10 A;  1MKM A;  4WLW A;  2WSC J;  3G9R A;  4H0L C;  4H13 C;  2E75 C;  3AE3 C;  1DD3 A;  1Q08 A;  1UIX A;  2GOV A;  4H0L B;  3AE1 C;  2E74 B;  4J2N A;  1EXI A;  1KTM A;  3B49 A;  3R8J A;  3D70 A;  3SFD C;  2V7Q J;  2IEF A;  1FDI A;  1DD4 A;  4H44 D;  1KMI Z;  4OGQ C;  1Q09 A;  2BEZ F;  3GP4 A;  2WQY C;  4WLS A;  2KCU A;  2ZHH A;  1RQV A;  1JB0 J;  4H44 B;  3Q1M A;  1R8D A;  1U57 A;  3IN6 A;  2E75 D;  5D8C A;  1TU3 F;  2OQQ A;  4Y28 J;  1Y6U A;  4DCZ A;  3EWK A;  1Q90 D;  4AYZ A;  2OG0 A;  2QIW A;  2E76 C;  5KKZ C;  1R8E A;  2J5U A;  4PV1 C;  3AE2 C;  1FDO A;  4XFJ A;  3AEE C;  1JYH A;  1OW7 A;  3AE8 C;  2HVA A;  3AE7 C;  2O01 J;  3H25 A;  4OGQ D;  5D90 A;  2BEQ D;  5E01 A;  2WSE J;  2H88 C;  1Q0A A;  3T97 B;  2QJK C;  4H13 D;  4U7J A;  5I44 A;  1Q07 A;  1Q06 A;  3AEG C;  2ZT9 D;  3LUR A;  1OMI A;  3AE9 C;  1VF5 D;  1NYH A;  3R4Y A;  4GDO A;  1Y9B A;  2JO1 A;  2YIU C;  4R4E A;  5KAT A;  1PM6 A;  2QSI A;  1KQF B;  1VL2 A;  2FXP A;  2MKV A;  3RK3 E;  2NZ2 A;  4LHF A;  2YMK A;  3RL0 g;  1EXJ A;  4R22 B;  3GLM A;  3EZ2 A;  2VZ4 A;  2FYN C;  1KOR A;  1GMJ A;  1VF5 B;  2G8Y A;  3GPV A;  3E0H A;  5I41 B;  3AEB C;  4KT0 J;  3GF3 A;  1ZOY C;  4YTP C;  3S9O A;  3HH0 A;  5L8R J;  2JML A;  3D71 A;  4B0Y A;  3EZF A;  2D2C C;  1OW6 A;  1PIX A;  3ABV C;  1YQ3 C;  3QAO A;  3LW5 J;  5KAX A;  2D2C B;  4H44 C;  1K04 A;  1HF9 A;  3EZ7 A;  1NGM B;  4OGQ B;  5KCB A;  1LX8 A;  1DIP A;  1KIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...