3Q2YA

Crystal structure of bmrr bound to ethidium
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
KESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q2yA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q2yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q2yA03
4AYZB 2DG6A 1Q05A 3E0HA 4WLWA 3D70A 5D8CA 3Q3DA 3LURA 4R4MA 3D6ZA 3G9RA 4R4EA 1BOWA 2VZ4A 1R8DA 4WLSA 3GP4A 2BOWA 3Q5PA 3D6YA 3T97B 5KAWA 1EXJA 2KCUA 1Q08A 4R4LA 1EXIA 5KATA 3GK6A 3IAOA 3D71A 2JMLA 5KAXA 1Q07A 1D5YA 1Q0AA 3GPVA 4R24B 4J2NA 5KCBA 3HH0A 2ZHGA 1DIPA 3QAOA 5I44A 3Q2YA 3Q1MA 5GQQA 2GOVA 2OQQA 4R22B 1JBGA 5E01A 1R8EA 3R8KA 5I41B 4B0YA 4A1MA 5KAUA 2ZHHA 3UCSA 1Q09A 4AYZA 5KAVA 1Q06A 3R8JA 3B49A 3Q5SA 1JYHA 2J5UA 2HVAA 3Q5RA 5D90A
chains in the Genus database with same CATH superfamily
2E75C 3GHGA 5APSA 2QSIA 3RK2C 2WTYA 4JF7A 2KSJA 1L0ND 3H1HG 3L70G 1NU1K 2P58A 3WUTA 4ASVA 3AE3C 2Q5UA 2Z5HA 3GHGB 3CCLP 2IFNA 3RL0C 4H0LB 3RK3E 2R5BA 3BCCD 1YJ9P 1T8ZA 3HE5A 1NAFA 2YMYA 4XFJA 4B86A 1S3JA 2L91A 5AW0B 2E74C 4UB8H 1NTMJ 2OYIC 1GK6A 4QMAA 4YXWH 5KAFH 3ITKA 2WSCH 2JO1A 3A2AA 3CL3D 4I6MC 3R8KA 3HE5B 3UCSA 3PJSK 5KAVA 2RMZA 1PPJE 2NPSA 2MKVA 1FOSF 3D6ZA 3S4RA 1JCDA 2E76D 4N3YB 2Q3IA 1KQGB 2Y9YA 1VQNP 3RK3D 1SQVG 1S9KE 5KCBA 1YJNP 1HUCA 3KZIH 4D6TJ 2HVAA 3CWBJ 1SP4A 3NXSA 1RF1A 4PD4I 3K5BA 3VOPA 1KILC 1NU1D 2AXCA 1W2EA 1IJDB 2R5DA 1Q07A 4Y99B 1IC2A 4B0YA 1KQFB 4AUWA 1VQOP 1AVOA 3L75G 5C39A 1PPJD 5CCGD 2Q3EA 3MD0A 3D70A 1IFDA 1G1JA 5AVXB 2J58A 4UB8E 2LXBA 1RF1B 4GKGA 4CPGA 4DCKA 5KAFE 2XDJA 1S9KD 1QX8A 1PP9G 3ZDMA 2SPZA 1KYOH 1JY3O 2Y0EA 2FXOA 3WU2H 3E1RA 2PGDA 1VDFA 3CCVP 1PM6A 3GK6A 1K8AQ 2K3RA 5KLVG 1T2KC 2A45H 2K9JA 1SQPK 3KZIE 1VQ5P 1T3UA 1SVFA 3EZ7A 1HJ0A 4GOFA 3HUSA 1QLED 3L73G 4I2LC 4PJ0H 2QM7A 2Y0CA 3G3ZA 5AVUB 2ZT9C 2IBZE 2E76B 2QRXA 2FYUE 3HD7A 3SFEC 4W7YA 4AYZA 5APXA 2K9JB 3RK3B 1OVRA 1LTSC 2YXRB 3RGUA 5BU5A 1YQ3C 3HUSB 1FDIA 2K37A 1FZCA 1IZNB 5CCGA 1DD3A 4WWIA 4WY4D 3QH9A 1KYOE 3HD7B 1BSNA 1BSHA 1AVYA 3C9IA 1SQXK 1R8DA 3L36A 1N7SC 2PRRA 1FZCB 1KD1Q 1IO4A 1N2DC 3QAOA 1CI6A 1LP1A 4ZKUA 1Q86Q 2IBZD 2YKOA 2FYUD 1H88A 4I7ZC 5CJ4A 1JCCA 1BCCD 1SQPJ 2D2CC 5AVSB 1GW4A 2OYOA 1JY3N 3OJAB 3V4WA 1L0LJ 1AJYA 3H1KJ 3H25A 1ZP0C 2N9YB 5M1BA 4R24B 3CMAP 2FKWB 1CI6B 2OTLP 1KYOD 4TLFA 3AE7C 3A3YB 3PHLA 3GP4A 1WRGA 2QJKC 1URQD 5KLIB 1KORA 1U7JA 2KNCB 2KVVA 5GTHE 3T97B 3TGUJ 2HYNA 3SWKA 1QL1A 4PD4E 2PAJA 2N1TA 2I1KA 2IPPA 3G4SP 4WY4A 2NRGA 1VQKP 4K3AA 3H1ID 2R44A 1SQXD 1RH6A 2ZHHA 2N1TB 4PV1C 3GMAA 2W6JH 1AA0A 1D7MA 1FDOA 3AE6C 4WY4B 1Y9BA 1NTZK 2QJYC 4C7RA 5KKZB 3GW6A 3Q5RA 5APYA 2KK7A 3S9OA 3CCEP 2YKQA 4JPZB 1URQA 1OW6A 2KUBA 1R8EA 1JY2O 2CPBA 2WSFJ 1NJIQ 2YO3A 4JQ0D 4U3FE 5CCHD 3L70J 2C9LY 3L71E 3HTKA 1ZR4A 5KAIH 1ZV8A 1ZW0A 4H44C 1URQB 1NTKE 4JYCA 4O9BA 4IOIH 5APQA 1HF9A 2J5UA 2QEXP 1SQQE 3JCUH 3M0DC 3B8EB 1IFMA 1JOCA 3TNUA 1K05A 1GZLA 3B5NC 4IFMA 3HTKB 1AFOA 1LTJB 2HFED 1LNQA 2IZ0A 4L75A 1VQMP 2ZJSE 1LT9A 1S5LE 2M8RA 4U3FD 1ZR2A 4Z1MH 5D90A 2C9NY 2FYUG 3EZ9A 1L0LG 3H1KG 5B5EH 3L71D 3FX0A 3L74E 3TNUB 5KJ7D 2M5AA 1NWQA 4IL6X 2Q6QA 1Q08A 3AEGC 2FYNB 1EQ7A 1KV4A 2ZYDA 1M56D 1QGKB 1SQVJ 4ZNCA 5CBOA 1LT9B 3U1CA 3V5BA 4HKZH 2Z5IA 1Y6UA 1JY3P 1SQQD 3TGUG 1U7MA 2RH0A 4R4LA 2M5AB 2O1KA 4OGQD 5EFWB 1GMJA 1XTCC 2FFDC 2ZXEB 4RESB 2R3CA 1PGJA 1JY2N 3L75J 3A0HH 2E75D 2GUSA 3G71P 2KCUA 1RE3A 1PIXA 2QJPB 2KZJA 1DD4A 1MZ9A 3Q1MA 3H1JG 3B71A 1Q06A 5AVWB 2W6BA 1FE6A 1NTMK 3FXEA 1P84H 4W7ZA 3IR9A 2JEEA 1PL5A 4LHFA 3I5CA 1OW8A 3TDKA 3GHGC 3U59A 2FBWC 3BCCE 1NYHA 4H0LC 3RL0D 3O6QA 2P2UA 1SQBE 1QEXA 1J1DB 1Y8AA 2KZIA 2O01J 1HH0A 5KLVJ 1LTTC 1VF5B 1VL2A 3WUVA 1HJBA 1KC8Q 3L72J 2WZ7A 1MUUA 2BOWA 5H2FH 2E74D 2V7QH 2E42A 3L73J 2IBZI 1KILE 1EZVD 1OW7A 3O6QB 5E79H 3V4QA 2XNXA 2A06G 1BGYE 1KFNA 1QVFO 2YIUB 3A0HE 5GTIH 2E5YA 1PGOA 2WPRA 1KYOI 1Q90D 1SQBD 1Q7YQ 1X8YA 2Y9ZA 1M8OB 3KDPB 3EQ2A 2LKMA 5AW7B 3PP5A 2VZ4A 2W83C 1DX7A 3AE5C 1NU1E 3TSIA 1K9MQ 3M06A 1KILD 2A45I 2OQQA 5E01A 5B66E 4Y99C 2E75B 1NO4A 1UIXA 1BGYD 4HYTB 2HLOA 1JB0J 4WVZA 3U1AA 4U3FG 5AW5B 2G3AA 3D6YA 5H2FE 2KOGA 3WUUA 3L71G 1E5WA 3GLMA 1Q0AA 2OTJP 2H43A 3V2NA 2YXQB 3EZ2A 5E79E 5AW8B 1MV8A 1NTKG 4EYYQ 3R8JA 2OYIA 3NTNA 1FJKA 1HVVA 2YO2A 4KHXA 2NPSB 2JP3A 3A7OA 1P84D 1WMKA 3C8VA 4OH8B 2BCCE 5GTIE 2KLUA 2JWDA 1OIPA 2R32A 1DEBA 1YBKA 3KXDA 1VQ6P 1YHQP 1JTHA 3BVHA 5APVA 4HJGH 3SWYA 3ABVC 2PFXA 1T2KD 4K35A 2XNDH 1H0TA 2OYIB 3KYQA 1GDTA 3LIDA 1FZGA 1FZFA 3H1LE 5KATA 3CCUP 3R2PA 3L74G 5KAXA 3I55P 1RHZB 1JTHB 3VMAA 3NMDA 3AEFC 1JY2P 2E76C 1DIPA 2ZT9D 4IFFA 3CI9A 4DCZA 2C0WA 1WT6A 2BCCD 3HUSC 4N78E 1U57A 1G1IA 2XU6A 1M7LA 1LTIC 1GU4A 3WMM0 1ZMEC 1L4AC 3L72G 4TT3H 4GIFA 1VQLP 1JYHA 3HD7C 1L0LK 5KTBA 3H1LD 4ZMDA 5APWA 3GG2A 3IAOA 2JMLA 1N7SD 4J2NA 1FZCC 5CCGC 1FBMA 1YIJP 3LW5H 3GF3A 1PGQA 1N8RQ 5DJTB 1L0NG 1BCCE 4DZOA 1S72P 1AV1A 3RBXA 4KJMA 3TYYA 1VQ9P 3M9HA 2D2CD 1S1CX 4N78D 2N9BA 3G6EP 2GA1A 1QVGO 3BCCG 3B49A 2KS1A 3EZ6A 1SQBG 4AYZB 3WU2E 4IL6H 5KLIC 3CPWO 2OTKE 3AE9C 1XTGB 2ZYGA 2ZVNB 1OMIA 1NHLA 2M3EA 5KAUA 3BATA 2KS1B 2OARA 3Q3DA 3IFMA 2MJZA 1USDA 2FYUJ 3AECC 1FAVA 4PJ0E 1SQPD 3EFFK 3H1IE 3II6A 1M1JC 3KPEA 1JBGA 3BASA 2HPCA 1SQXE 1LP1B 3AE4C 1OXZA 1X22A 2N1TC 1AQTA 4PV1D 1BOWA 2OYHA 1LWUA 4GOEA 1X79B 4WY4C 3CCSP 3N7NA 2JR8A 1NU1G 2GOVA 4R22B 4GT1A 4C7NA 4EOTA 3F5HA 5KKZC 3KQGA 1YI2P 3AE2C 1PPJG 3Q5PA 2OYHB 1ZOYC 1EZVI 1LWUB 1BDDA 2W8ZA 3O8ZA 1BE3E 3SWFA 2D2CB 2WWWA 3VMYA 4KT0J 4C7NB 1QL2A 3H1JJ 1Q05A 1NAYA 4WLSA 2IYPA 4AQRD 1CW5A 4YTPC 3CD6P 3MUDC 3H1HE 3L70E 1PV3A 1KN7A 3IF4A 1YQ4C 2BCCG 4H44D 3AEDC 5AVTB 1R5LA 1H89A 3NFQA 3CXHH 3E0HA 5CMZA 1SFCD 1RH5B 1N73C 1KMIZ 3B5ND 4H13C 3H1LG 3HE4A 1G2CA 1LTJC 1SQVK 1BE3D 2K9YA 1Y47A 4AYCA 1NTZE 1NTKK 5D8CA 4LC1A 2ZAEB 2KLVA 1YTZI 2L5GB 1IFIA 5AW6B 3H1HD 3L70D 2FYNC 3A0BH 3HE4B 2QM8A 1PGPA 1J1EB 3H6PA 3PRJA 3GF7A 1LT9C 3USSA 2DW3A 3L4FA 4UB6H 2KIKA 3CX5H 4NPEA 5AW9B 1GL2D 3UIAA 5AW3B 4DT0A 2IEFA 1LT1A 1NTZD 2BASA 2ZVOB 2IBZG 3CXHE 3PH0A 3E7KA 3VTPC 1BCCG 1Q2NA 4U3FJ 2JWAA 2GUVA 3BRTB 5K5GB 3CC7P 3GPVA 2CK3H 3L35A 3HH0A 2WSEJ 2QJPC 1SFCA 1T6AA 3L71J 1RE4A 3QWOC 4A7PA 3P8MC 5KLVK 3PTZA 2M3BA 1VQPP 2C0XA 2E43A 2DG6A 1DEEG 1NTKJ 1RF0A 1LGHB 1PP9E 1GTWA 3V2RA 1NH4A 5KAIE 1EDLA 1K73Q 2Z4EA 5CCHA 1SQQJ 5GQQA 3A0BE 1RE3C 3C1LA 1SFCB 4H0LD 1M57D 5AW1B 2IX7C 2I1JA 2WPVB 4YXDC 1JMBA 3CXHD 1L0NK 2A45G 1KB9H 1VF5C 3JCUE 3M0AA 2AXTH 1X9VA 1MFZA 4WB4A 1FC2C 5DJUB 1M1KQ 1NOHA 1EZVE 2WITA 3RK2D 3L74J 3H1IG 3V2QA 1W2BO 3MTUE 2P7JA 1IFNA 4JYBA 1GL2A 1OVVA 1NKZB 1SQXG 2JDIH 4WLWA 2WVRA 1YJWP 4YPCA 5B5EE 1PP9D 2QVAA 2YIUC 2WT7A 5AVZB 2FFDA 4EIJA 3CLQA 5KJ7A 3MHVA 2P1JA 3L37A 1GL2B 4HB1A 4BWNA 1FZBA 2WPSA 3CX5D 3KHUA 2B9BA 1Q81Q 4DJGA 3LIEA 2WT7B 3SFDC 2FFDB 1OX3A 1YITP 1GK4A 2OG0A 1NTME 2AEFA 3L73D 2IYOA 5CBNA 3CC4P 1KB9E 3EZFA 2AXTE 1KZUB 1L0NJ 2FYZA 2KP8A 3F89A 3VP9A 2ZHGA 2WQYC 2B88A 4LLHA 1S5LX 1PFIA 2XZRA 3BCCJ 1HTLC 3CC2P 1SQBJ 4OGQB 1P84E 5L8RJ 2NPSC 4D6TE 3CWBE 2FY8A 2OGUA 1L2PA 4BXLA 3VMZA 1NTMD 2HG5D 2ZFCA 2E5TA 3R4YA 1Q82Q 3VYIA 3HRNA 1CSBA 1KB9D 1NTZG 3RK2B 3PLNA 1BGYJ 1HGZA 4RKUJ 1RF1C 2XKMA 1R5SA 5CJ0A 3AEEC 2ZYAA 1FJPA 3RL0B 1SQQG 4OVNF 5AW2B 4D6TD 2POHA 2W27A 3CWBD 1ZLLA 1FOSE 5I44A 2I8DA 4OWFA 2GM4A 2E74B 1NU1J 1FS0E 1EDKA 1L4AD 2VRSA 1ZN5A 3HD7D 2RKLA 4L76A 2B87A 1YYCA 2H8PD 5TISH 2KYVA 2V7QJ 1KILA 2LXCB 1H0TB 3RK3C 3M9QA 1N7LA 5AW4B 3S1KA 1M90Q 3M91A 1IFPA 2IZ1A 3AEBC 2B87B 1X0TA 4C46A 1EC5A 4HH2A 2BCCJ 2Q7CA 2M0BA 1KILB 1MFTA 4R4EA 2FYUK 3P32A 3B4SA 1IK7A 1D5YA 1OWAA 3H1LJ 1ZXGA 1EZVG 2AEJA 3MGNA 2G8YA 1JO5A 2WSCJ 4R4MA 4EI2A 1KQSO 3FXDA 4JBZA 1JUNA 1L4AA 1NKNA 1SQPE 4L73A 1L0LE 5TISE 2QA4P 3H1KE 3Q5SA 1GU5A 2HR3A 2XV5A 5GTHH 1TU3F 2N1TD 5KAWA 4PD4H 1L4AB 1VQ7P 2H88C 3TGUE 3CXHI 1HBWA 3AE8C 2QE7H 3E1IA 2O1JA 1NTMG 1NGMB 2PP6A 2WSFH 1BGYG 1BDCA 1RQVA 2KSEA 3MIWA 5CHXA 1S4XA 2ZT9B 2OYHC 1BCCJ 1S2EA 2Q1KA 1LWUC 2QG4A 5AVYB 4ZKPA 1FZEA 1L0LD 1CZQA 3H1KD 2BEZF 2NZ2A 3W68A 4BRYA 1VPCA 3JC22 1N7SA 2KNCA 3TK1A 3N4XA 3T97A 2IFMA 3M9BA 4WBAA 3H1JE 5BU8B 4D6TG 3CWBG 1SLQA 3OW2O 3TGUD 2HPCB 3CX5I 4BRYB 1N7SB 2CPSA 4IL6E 1M1JA 1HGVA 1MKMA 2Q9IA 1UIIA 4I7ZB 4H13D 2J59M 1T3JA 2R3SA 3FWNA 4XA4A 1Z56A 2WSEH 3H1IJ 5APUA 3MZWB 1HWTC 1SQXJ 1EXJA 1M1JB 3H1JD 3LW5J 3D71A 1LTBC 2A06E 2FXMA 2P67A 4NPDA 3TF5A 1URQC 2QJKB 2HODA 1DH3A 3CCMP 1J1EC 4Y28J 2KB7P 2YKPA 5TJHA 2K1AA 3CCJP 4PD4D 1LTAC 4W80A 1VQ4P 2WMMA 1S5LH 1GW3A 1AQ5A 1RY3A 1ZRTE 1KFMA 3VP8A 2HODB 1KB9I 1J2JB 3BRVB 3MUDA 1YTZT 3G9RA 1BE3J 4RJTA 2FXPA 1SQQK 1JM0A 5AVVB 3RBZA 2A06D 4IFDK 1OVUA 4PV1B 4EDFA 3P7KA 1G2CB 3V6IA 1JMMA 3P8CE 2WPQA 3VMXA 1N73A 1E79H 3CCQP 3H1HJ 2IDBA 1P84I 3IN6A 4DOJA 2W6AA 2Y0DA 4M3LA 1OZHA 1SQVE 1KTMA 1LTJA 3MP7B 2O01H 1RQUA 2QJYB 2ITAA 1LX8A 1OFCX 2JJLA 2KI7B 4LGDE 1K04A 3W67A 4NPFX 1ZRTD 3EFGA 1SFCC 1N73B 3EWKA 3FGAD 1RE4C 4H13B 5AVRB 1LJ2A 5APTA 4ASWA 1VF5D 1RF0C 1NTZJ 2W90A 4U7JA 3SSUA 3L75E 1JNMA 2O3JA 3AE1C 4XE5B 1A02F 1SQPG 3M0DA 5CCHC 1PZQA 3P8CD 1FU1A 3B5NA 4GODA 1SS1A 2YMKA 3LURA 2BEQD 2O01N 1SQVD 4H44B 2LR2A 1IK9A 2JKVA 4GDOA 1NTKD 3OA7A 1N86A 2ZXXA 1USEA 4I1LA 3CCRP 1KQLA 4N6JA 1J1DC 3B5NB 1NVOA 4UB6E 1FZAA 1GL2C 3CX5E 3H32A 4MN4C 1W5CE 1EXIA 1FDMA 5KLVE 3JSVC 3L72E 3L75D 2RN0A 3Q2YA 1GD2E 5I41B 1Q09A 2WSSH 2KXPB 3L73E 1H8AA 5KJ7C 4RO0A 2K88A 1SQBK 3L74D 3I56P 3VN0A 3H32B 2V4HA 3RL0g 1LTGC 1JEKA 2AEMA 3FWLA 1A02J 3AEAC 5AVQB 1L0NE 1PP9J 2B89A 3A5TA 2P10A 1VQ8P 2H89C 1EDJA 2QIWA 3OAKA 1IFJA 3CMEP 5BVZA 4OGQC 5KLVD 2YNYA 3L72D 5B66H 2NPSD 2UWJE 4A1MA 4L74A 2H7HA 1EDIA 1BE3G 3V2PA
chains in the Genus database with same CATH topology
2E75C 1JB0J 4YXDC 2YMKA 4PV1D 5D8CA 3LURA 2BEQD 1NGMB 2G3AA 1VF5C 1YQ3C 1FDIA 1BOWA 4H44B 4OGQB 1K05A 3D6YA 1RQVA 1PL5A 4LHFA 1DD3A 2QSIA 5L8RJ 4GDOA 1OW8A 3IAOA 2JMLA 3GLMA 1Q07A 2ZT9B 1Q0AA 4J2NA 2FBWC 1NYHA 3AEBC 4H0LC 3O6QA 2FYNC 2GOVA 4R22B 4B0YA 1KQFB 1RH6A 3EZ2A 2ZHHA 2BEZF 1ZRTE 2O01J 2NZ2A 3GMAA 3GF3A 4PV1C 5KKZC 3R8JA 1VF5B 4Z1MH 1VL2A 5D90A 3R4YA 1FDOA 3GF7A 3EZ9A 4WLWA 3D70A 3AE6C 3G9RA 4R4EA 2JP3A 3AE3C 1R8DA 3AE2C 2BOWA 1WMKA 3C8VA 3Q5PA 2D2CD 1Y9BA 1S1CX 2E74D 4IL6X 1IK7A 1ZOYC 2YIUC 1Q08A 4H0LB 1EXIA 2FXPA 3AEGC 3RK3E 1D5YA 2QJYC 4RKUJ 1KILE 3QAOA 3Q2YA 1OW7A 4PV1B 5I41B 2IEFA 2D2CB 1Q09A 4I7ZC 4KT0J 4XFJA 3ABVC 3B49A 3AEEC 3EZ6A 3Q5RA 2G8YA 2IDBA 4AYZB 2D2CC 1Y6UA 1Q05A 3IN6A 2E74C 2WSCJ 4R4MA 4WLSA 5KLIC 1KTMA 1AJYA 3S9OA 1PM6A 1RQUA 1ZP0C 4YTPC 3H25A 3AE9C 1LX8A 4R4LA 5KATA 3GK6A 5KAXA 3RL0g 3SFDC 1PV3A 5M1BA 1OW6A 3GPVA 4R24B 2JO1A 1MKMA 3HH0A 1Q90D 5I44A 1YQ4C 2WSEJ 4I7ZB 2QJPC 3AEAC 4H44D 4OGQD 1K04A 3R8KA 1R8EA 1GMJA 1OMIA 4H13D 2OG0A 5KAUA 2WSFJ 3AEDC 3UCSA 3AE7C 2P10A 5KAVA 2E74B 3Q5SA 3AEFC 2E76C 1DIPA 2ZT9D 3GP4A 2QJKC 3EZ7A 2DG6A 1HJ0A 3EWKA 1KORA 3FGAD 3E0HA 2H89C 2MKVA 3Q3DA 3D6ZA 4DCZA 3EZFA 2VZ4A 2QIWA 2E76D 4H13B 2E75D 1TU3F 2KVVA 3AE5C 1KQGB 3AECC 3T97B 1EXJA 5KAWA 2KCUA 3LW5J 1VF5D 1KMIZ 1U57A 4H44C 1PIXA 3D71A 4OGQC 1DD4A 4H13C 4U7JA 5KCBA 2ZHGA 2WQYC 3AE1C 3Q1MA 5GQQA 2K9YA 2OQQA 1ZMEC 1JBGA 5E01A 2ZT9C 2E76B 3SFEC 2E75B 2H88C 3B71A 4A1MA 4H0LD 3AE4C 1UIXA 4AYZA 1Q06A 2V7QJ 3AE8C 4TT3H 1S5LX 1HF9A 2WPVB 1JYHA 2J5UA 2HVAA 4Y28J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYZ B;  2DG6 A;  1Q05 A;  3E0H A;  4WLW A;  3D70 A;  5D8C A;  3Q3D A;  3LUR A;  4R4M A;  3D6Z A;  3G9R A;  4R4E A;  1BOW A;  2VZ4 A;  1R8D A;  4WLS A;  3GP4 A;  2BOW A;  3Q5P A;  3D6Y A;  3T97 B;  5KAW A;  1EXJ A;  2KCU A;  1Q08 A;  4R4L A;  1EXI A;  5KAT A;  3GK6 A;  3IAO A;  3D71 A;  2JML A;  5KAX A;  1Q07 A;  1D5Y A;  1Q0A A;  3GPV A;  4R24 B;  4J2N A;  5KCB A;  3HH0 A;  2ZHG A;  1DIP A;  3QAO A;  5I44 A;  3Q2Y A;  3Q1M A;  5GQQ A;  2GOV A;  2OQQ A;  4R22 B;  1JBG A;  5E01 A;  1R8E A;  3R8K A;  5I41 B;  4B0Y A;  4A1M A;  5KAU A;  2ZHH A;  3UCS A;  1Q09 A;  4AYZ A;  5KAV A;  1Q06 A;  3R8J A;  3B49 A;  3Q5S A;  1JYH A;  2J5U A;  2HVA A;  3Q5R A;  5D90 A; 
#chains in the Genus database with same CATH topology
 2E75 C;  3GHG A;  5APS A;  2QSI A;  3RK2 C;  2WTY A;  4JF7 A;  2KSJ A;  1L0N D;  3H1H G;  3L70 G;  1NU1 K;  2P58 A;  3WUT A;  4ASV A;  3AE3 C;  2Q5U A;  2Z5H A;  3GHG B;  3CCL P;  2IFN A;  3RL0 C;  4H0L B;  3RK3 E;  2R5B A;  3BCC D;  1YJ9 P;  1T8Z A;  3HE5 A;  1NAF A;  2YMY A;  4XFJ A;  4B86 A;  1S3J A;  2L91 A;  5AW0 B;  2E74 C;  4UB8 H;  1NTM J;  2OYI C;  1GK6 A;  4QMA A;  4YXW H;  5KAF H;  3ITK A;  2WSC H;  2JO1 A;  3A2A A;  3CL3 D;  4I6M C;  3R8K A;  3HE5 B;  3UCS A;  3PJS K;  5KAV A;  2RMZ A;  1PPJ E;  2NPS A;  2MKV A;  1FOS F;  3D6Z A;  3S4R A;  1JCD A;  2E76 D;  4N3Y B;  2Q3I A;  1KQG B;  2Y9Y A;  1VQN P;  3RK3 D;  1SQV G;  1S9K E;  5KCB A;  1YJN P;  1HUC A;  3KZI H;  4D6T J;  2HVA A;  3CWB J;  1SP4 A;  3NXS A;  1RF1 A;  4PD4 I;  3K5B A;  3VOP A;  1KIL C;  1NU1 D;  2AXC A;  1W2E A;  1IJD B;  2R5D A;  1Q07 A;  4Y99 B;  1IC2 A;  4B0Y A;  1KQF B;  4AUW A;  1VQO P;  1AVO A;  3L75 G;  5C39 A;  1PPJ D;  5CCG D;  2Q3E A;  3MD0 A;  3D70 A;  1IFD A;  1G1J A;  5AVX B;  2J58 A;  4UB8 E;  2LXB A;  1RF1 B;  4GKG A;  4CPG A;  4DCK A;  5KAF E;  2XDJ A;  1S9K D;  1QX8 A;  1PP9 G;  3ZDM A;  2SPZ A;  1KYO H;  1JY3 O;  2Y0E A;  2FXO A;  3WU2 H;  3E1R A;  2PGD A;  1VDF A;  3CCV P;  1PM6 A;  3GK6 A;  1K8A Q;  2K3R A;  5KLV G;  1T2K C;  2A45 H;  2K9J A;  1SQP K;  3KZI E;  1VQ5 P;  1T3U A;  1SVF A;  3EZ7 A;  1HJ0 A;  4GOF A;  3HUS A;  1QLE D;  3L73 G;  4I2L C;  4PJ0 H;  2QM7 A;  2Y0C A;  3G3Z A;  5AVU B;  2ZT9 C;  2IBZ E;  2E76 B;  2QRX A;  2FYU E;  3HD7 A;  3SFE C;  4W7Y A;  4AYZ A;  5APX A;  2K9J B;  3RK3 B;  1OVR A;  1LTS C;  2YXR B;  3RGU A;  5BU5 A;  1YQ3 C;  3HUS B;  1FDI A;  2K37 A;  1FZC A;  1IZN B;  5CCG A;  1DD3 A;  4WWI A;  4WY4 D;  3QH9 A;  1KYO E;  3HD7 B;  1BSN A;  1BSH A;  1AVY A;  3C9I A;  1SQX K;  1R8D A;  3L36 A;  1N7S C;  2PRR A;  1FZC B;  1KD1 Q;  1IO4 A;  1N2D C;  3QAO A;  1CI6 A;  1LP1 A;  4ZKU A;  1Q86 Q;  2IBZ D;  2YKO A;  2FYU D;  1H88 A;  4I7Z C;  5CJ4 A;  1JCC A;  1BCC D;  1SQP J;  2D2C C;  5AVS B;  1GW4 A;  2OYO A;  1JY3 N;  3OJA B;  3V4W A;  1L0L J;  1AJY A;  3H1K J;  3H25 A;  1ZP0 C;  2N9Y B;  5M1B A;  4R24 B;  3CMA P;  2FKW B;  1CI6 B;  2OTL P;  1KYO D;  4TLF A;  3AE7 C;  3A3Y B;  3PHL A;  3GP4 A;  1WRG A;  2QJK C;  1URQ D;  5KLI B;  1KOR A;  1U7J A;  2KNC B;  2KVV A;  5GTH E;  3T97 B;  3TGU J;  2HYN A;  3SWK A;  1QL1 A;  4PD4 E;  2PAJ A;  2N1T A;  2I1K A;  2IPP A;  3G4S P;  4WY4 A;  2NRG A;  1VQK P;  4K3A A;  3H1I D;  2R44 A;  1SQX D;  1RH6 A;  2ZHH A;  2N1T B;  4PV1 C;  3GMA A;  2W6J H;  1AA0 A;  1D7M A;  1FDO A;  3AE6 C;  4WY4 B;  1Y9B A;  1NTZ K;  2QJY C;  4C7R A;  5KKZ B;  3GW6 A;  3Q5R A;  5APY A;  2KK7 A;  3S9O A;  3CCE P;  2YKQ A;  4JPZ B;  1URQ A;  1OW6 A;  2KUB A;  1R8E A;  1JY2 O;  2CPB A;  2WSF J;  1NJI Q;  2YO3 A;  4JQ0 D;  4U3F E;  5CCH D;  3L70 J;  2C9L Y;  3L71 E;  3HTK A;  1ZR4 A;  5KAI H;  1ZV8 A;  1ZW0 A;  4H44 C;  1URQ B;  1NTK E;  4JYC A;  4O9B A;  4IOI H;  5APQ A;  1HF9 A;  2J5U A;  2QEX P;  1SQQ E;  3JCU H;  3M0D C;  3B8E B;  1IFM A;  1JOC A;  3TNU A;  1K05 A;  1GZL A;  3B5N C;  4IFM A;  3HTK B;  1AFO A;  1LTJ B;  2HFE D;  1LNQ A;  2IZ0 A;  4L75 A;  1VQM P;  2ZJS E;  1LT9 A;  1S5L E;  2M8R A;  4U3F D;  1ZR2 A;  4Z1M H;  5D90 A;  2C9N Y;  2FYU G;  3EZ9 A;  1L0L G;  3H1K G;  5B5E H;  3L71 D;  3FX0 A;  3L74 E;  3TNU B;  5KJ7 D;  2M5A A;  1NWQ A;  4IL6 X;  2Q6Q A;  1Q08 A;  3AEG C;  2FYN B;  1EQ7 A;  1KV4 A;  2ZYD A;  1M56 D;  1QGK B;  1SQV J;  4ZNC A;  5CBO A;  1LT9 B;  3U1C A;  3V5B A;  4HKZ H;  2Z5I A;  1Y6U A;  1JY3 P;  1SQQ D;  3TGU G;  1U7M A;  2RH0 A;  4R4L A;  2M5A B;  2O1K A;  4OGQ D;  5EFW B;  1GMJ A;  1XTC C;  2FFD C;  2ZXE B;  4RES B;  2R3C A;  1PGJ A;  1JY2 N;  3L75 J;  3A0H H;  2E75 D;  2GUS A;  3G71 P;  2KCU A;  1RE3 A;  1PIX A;  2QJP B;  2KZJ A;  1DD4 A;  1MZ9 A;  3Q1M A;  3H1J G;  3B71 A;  1Q06 A;  5AVW B;  2W6B A;  1FE6 A;  1NTM K;  3FXE A;  1P84 H;  4W7Z A;  3IR9 A;  2JEE A;  1PL5 A;  4LHF A;  3I5C A;  1OW8 A;  3TDK A;  3GHG C;  3U59 A;  2FBW C;  3BCC E;  1NYH A;  4H0L C;  3RL0 D;  3O6Q A;  2P2U A;  1SQB E;  1QEX A;  1J1D B;  1Y8A A;  2KZI A;  2O01 J;  1HH0 A;  5KLV J;  1LTT C;  1VF5 B;  1VL2 A;  3WUV A;  1HJB A;  1KC8 Q;  3L72 J;  2WZ7 A;  1MUU A;  2BOW A;  5H2F H;  2E74 D;  2V7Q H;  2E42 A;  3L73 J;  2IBZ I;  1KIL E;  1EZV D;  1OW7 A;  3O6Q B;  5E79 H;  3V4Q A;  2XNX A;  2A06 G;  1BGY E;  1KFN A;  1QVF O;  2YIU B;  3A0H E;  5GTI H;  2E5Y A;  1PGO A;  2WPR A;  1KYO I;  1Q90 D;  1SQB D;  1Q7Y Q;  1X8Y A;  2Y9Z A;  1M8O B;  3KDP B;  3EQ2 A;  2LKM A;  5AW7 B;  3PP5 A;  2VZ4 A;  2W83 C;  1DX7 A;  3AE5 C;  1NU1 E;  3TSI A;  1K9M Q;  3M06 A;  1KIL D;  2A45 I;  2OQQ A;  5E01 A;  5B66 E;  4Y99 C;  2E75 B;  1NO4 A;  1UIX A;  1BGY D;  4HYT B;  2HLO A;  1JB0 J;  4WVZ A;  3U1A A;  4U3F G;  5AW5 B;  2G3A A;  3D6Y A;  5H2F E;  2KOG A;  3WUU A;  3L71 G;  1E5W A;  3GLM A;  1Q0A A;  2OTJ P;  2H43 A;  3V2N A;  2YXQ B;  3EZ2 A;  5E79 E;  5AW8 B;  1MV8 A;  1NTK G;  4EYY Q;  3R8J A;  2OYI A;  3NTN A;  1FJK A;  1HVV A;  2YO2 A;  4KHX A;  2NPS B;  2JP3 A;  3A7O A;  1P84 D;  1WMK A;  3C8V A;  4OH8 B;  2BCC E;  5GTI E;  2KLU A;  2JWD A;  1OIP A;  2R32 A;  1DEB A;  1YBK A;  3KXD A;  1VQ6 P;  1YHQ P;  1JTH A;  3BVH A;  5APV A;  4HJG H;  3SWY A;  3ABV C;  2PFX A;  1T2K D;  4K35 A;  2XND H;  1H0T A;  2OYI B;  3KYQ A;  1GDT A;  3LID A;  1FZG A;  1FZF A;  3H1L E;  5KAT A;  3CCU P;  3R2P A;  3L74 G;  5KAX A;  3I55 P;  1RHZ B;  1JTH B;  3VMA A;  3NMD A;  3AEF C;  1JY2 P;  2E76 C;  1DIP A;  2ZT9 D;  4IFF A;  3CI9 A;  4DCZ A;  2C0W A;  1WT6 A;  2BCC D;  3HUS C;  4N78 E;  1U57 A;  1G1I A;  2XU6 A;  1M7L A;  1LTI C;  1GU4 A;  3WMM 0;  1ZME C;  1L4A C;  3L72 G;  4TT3 H;  4GIF A;  1VQL P;  1JYH A;  3HD7 C;  1L0L K;  5KTB A;  3H1L D;  4ZMD A;  5APW A;  3GG2 A;  3IAO A;  2JML A;  1N7S D;  4J2N A;  1FZC C;  5CCG C;  1FBM A;  1YIJ P;  3LW5 H;  3GF3 A;  1PGQ A;  1N8R Q;  5DJT B;  1L0N G;  1BCC E;  4DZO A;  1S72 P;  1AV1 A;  3RBX A;  4KJM A;  3TYY A;  1VQ9 P;  3M9H A;  2D2C D;  1S1C X;  4N78 D;  2N9B A;  3G6E P;  2GA1 A;  1QVG O;  3BCC G;  3B49 A;  2KS1 A;  3EZ6 A;  1SQB G;  4AYZ B;  3WU2 E;  4IL6 H;  5KLI C;  3CPW O;  2OTK E;  3AE9 C;  1XTG B;  2ZYG A;  2ZVN B;  1OMI A;  1NHL A;  2M3E A;  5KAU A;  3BAT A;  2KS1 B;  2OAR A;  3Q3D A;  3IFM A;  2MJZ A;  1USD A;  2FYU J;  3AEC C;  1FAV A;  4PJ0 E;  1SQP D;  3EFF K;  3H1I E;  3II6 A;  1M1J C;  3KPE A;  1JBG A;  3BAS A;  2HPC A;  1SQX E;  1LP1 B;  3AE4 C;  1OXZ A;  1X22 A;  2N1T C;  1AQT A;  4PV1 D;  1BOW A;  2OYH A;  1LWU A;  4GOE A;  1X79 B;  4WY4 C;  3CCS P;  3N7N A;  2JR8 A;  1NU1 G;  2GOV A;  4R22 B;  4GT1 A;  4C7N A;  4EOT A;  3F5H A;  5KKZ C;  3KQG A;  1YI2 P;  3AE2 C;  1PPJ G;  3Q5P A;  2OYH B;  1ZOY C;  1EZV I;  1LWU B;  1BDD A;  2W8Z A;  3O8Z A;  1BE3 E;  3SWF A;  2D2C B;  2WWW A;  3VMY A;  4KT0 J;  4C7N B;  1QL2 A;  3H1J J;  1Q05 A;  1NAY A;  4WLS A;  2IYP A;  4AQR D;  1CW5 A;  4YTP C;  3CD6 P;  3MUD C;  3H1H E;  3L70 E;  1PV3 A;  1KN7 A;  3IF4 A;  1YQ4 C;  2BCC G;  4H44 D;  3AED C;  5AVT B;  1R5L A;  1H89 A;  3NFQ A;  3CXH H;  3E0H A;  5CMZ A;  1SFC D;  1RH5 B;  1N73 C;  1KMI Z;  3B5N D;  4H13 C;  3H1L G;  3HE4 A;  1G2C A;  1LTJ C;  1SQV K;  1BE3 D;  2K9Y A;  1Y47 A;  4AYC A;  1NTZ E;  1NTK K;  5D8C A;  4LC1 A;  2ZAE B;  2KLV A;  1YTZ I;  2L5G B;  1IFI A;  5AW6 B;  3H1H D;  3L70 D;  2FYN C;  3A0B H;  3HE4 B;  2QM8 A;  1PGP A;  1J1E B;  3H6P A;  3PRJ A;  3GF7 A;  1LT9 C;  3USS A;  2DW3 A;  3L4F A;  4UB6 H;  2KIK A;  3CX5 H;  4NPE A;  5AW9 B;  1GL2 D;  3UIA A;  5AW3 B;  4DT0 A;  2IEF A;  1LT1 A;  1NTZ D;  2BAS A;  2ZVO B;  2IBZ G;  3CXH E;  3PH0 A;  3E7K A;  3VTP C;  1BCC G;  1Q2N A;  4U3F J;  2JWA A;  2GUV A;  3BRT B;  5K5G B;  3CC7 P;  3GPV A;  2CK3 H;  3L35 A;  3HH0 A;  2WSE J;  2QJP C;  1SFC A;  1T6A A;  3L71 J;  1RE4 A;  3QWO C;  4A7P A;  3P8M C;  5KLV K;  3PTZ A;  2M3B A;  1VQP P;  2C0X A;  2E43 A;  2DG6 A;  1DEE G;  1NTK J;  1RF0 A;  1LGH B;  1PP9 E;  1GTW A;  3V2R A;  1NH4 A;  5KAI E;  1EDL A;  1K73 Q;  2Z4E A;  5CCH A;  1SQQ J;  5GQQ A;  3A0B E;  1RE3 C;  3C1L A;  1SFC B;  4H0L D;  1M57 D;  5AW1 B;  2IX7 C;  2I1J A;  2WPV B;  4YXD C;  1JMB A;  3CXH D;  1L0N K;  2A45 G;  1KB9 H;  1VF5 C;  3JCU E;  3M0A A;  2AXT H;  1X9V A;  1MFZ A;  4WB4 A;  1FC2 C;  5DJU B;  1M1K Q;  1NOH A;  1EZV E;  2WIT A;  3RK2 D;  3L74 J;  3H1I G;  3V2Q A;  1W2B O;  3MTU E;  2P7J A;  1IFN A;  4JYB A;  1GL2 A;  1OVV A;  1NKZ B;  1SQX G;  2JDI H;  4WLW A;  2WVR A;  1YJW P;  4YPC A;  5B5E E;  1PP9 D;  2QVA A;  2YIU C;  2WT7 A;  5AVZ B;  2FFD A;  4EIJ A;  3CLQ A;  5KJ7 A;  3MHV A;  2P1J A;  3L37 A;  1GL2 B;  4HB1 A;  4BWN A;  1FZB A;  2WPS A;  3CX5 D;  3KHU A;  2B9B A;  1Q81 Q;  4DJG A;  3LIE A;  2WT7 B;  3SFD C;  2FFD B;  1OX3 A;  1YIT P;  1GK4 A;  2OG0 A;  1NTM E;  2AEF A;  3L73 D;  2IYO A;  5CBN A;  3CC4 P;  1KB9 E;  3EZF A;  2AXT E;  1KZU B;  1L0N J;  2FYZ A;  2KP8 A;  3F89 A;  3VP9 A;  2ZHG A;  2WQY C;  2B88 A;  4LLH A;  1S5L X;  1PFI A;  2XZR A;  3BCC J;  1HTL C;  3CC2 P;  1SQB J;  4OGQ B;  1P84 E;  5L8R J;  2NPS C;  4D6T E;  3CWB E;  2FY8 A;  2OGU A;  1L2P A;  4BXL A;  3VMZ A;  1NTM D;  2HG5 D;  2ZFC A;  2E5T A;  3R4Y A;  1Q82 Q;  3VYI A;  3HRN A;  1CSB A;  1KB9 D;  1NTZ G;  3RK2 B;  3PLN A;  1BGY J;  1HGZ A;  4RKU J;  1RF1 C;  2XKM A;  1R5S A;  5CJ0 A;  3AEE C;  2ZYA A;  1FJP A;  3RL0 B;  1SQQ G;  4OVN F;  5AW2 B;  4D6T D;  2POH A;  2W27 A;  3CWB D;  1ZLL A;  1FOS E;  5I44 A;  2I8D A;  4OWF A;  2GM4 A;  2E74 B;  1NU1 J;  1FS0 E;  1EDK A;  1L4A D;  2VRS A;  1ZN5 A;  3HD7 D;  2RKL A;  4L76 A;  2B87 A;  1YYC A;  2H8P D;  5TIS H;  2KYV A;  2V7Q J;  1KIL A;  2LXC B;  1H0T B;  3RK3 C;  3M9Q A;  1N7L A;  5AW4 B;  3S1K A;  1M90 Q;  3M91 A;  1IFP A;  2IZ1 A;  3AEB C;  2B87 B;  1X0T A;  4C46 A;  1EC5 A;  4HH2 A;  2BCC J;  2Q7C A;  2M0B A;  1KIL B;  1MFT A;  4R4E A;  2FYU K;  3P32 A;  3B4S A;  1IK7 A;  1D5Y A;  1OWA A;  3H1L J;  1ZXG A;  1EZV G;  2AEJ A;  3MGN A;  2G8Y A;  1JO5 A;  2WSC J;  4R4M A;  4EI2 A;  1KQS O;  3FXD A;  4JBZ A;  1JUN A;  1L4A A;  1NKN A;  1SQP E;  4L73 A;  1L0L E;  5TIS E;  2QA4 P;  3H1K E;  3Q5S A;  1GU5 A;  2HR3 A;  2XV5 A;  5GTH H;  1TU3 F;  2N1T D;  5KAW A;  4PD4 H;  1L4A B;  1VQ7 P;  2H88 C;  3TGU E;  3CXH I;  1HBW A;  3AE8 C;  2QE7 H;  3E1I A;  2O1J A;  1NTM G;  1NGM B;  2PP6 A;  2WSF H;  1BGY G;  1BDC A;  1RQV A;  2KSE A;  3MIW A;  5CHX A;  1S4X A;  2ZT9 B;  2OYH C;  1BCC J;  1S2E A;  2Q1K A;  1LWU C;  2QG4 A;  5AVY B;  4ZKP A;  1FZE A;  1L0L D;  1CZQ A;  3H1K D;  2BEZ F;  2NZ2 A;  3W68 A;  4BRY A;  1VPC A;  3JC2 2;  1N7S A;  2KNC A;  3TK1 A;  3N4X A;  3T97 A;  2IFM A;  3M9B A;  4WBA A;  3H1J E;  5BU8 B;  4D6T G;  3CWB G;  1SLQ A;  3OW2 O;  3TGU D;  2HPC B;  3CX5 I;  4BRY B;  1N7S B;  2CPS A;  4IL6 E;  1M1J A;  1HGV A;  1MKM A;  2Q9I A;  1UII A;  4I7Z B;  4H13 D;  2J59 M;  1T3J A;  2R3S A;  3FWN A;  4XA4 A;  1Z56 A;  2WSE H;  3H1I J;  5APU A;  3MZW B;  1HWT C;  1SQX J;  1EXJ A;  1M1J B;  3H1J D;  3LW5 J;  3D71 A;  1LTB C;  2A06 E;  2FXM A;  2P67 A;  4NPD A;  3TF5 A;  1URQ C;  2QJK B;  2HOD A;  1DH3 A;  3CCM P;  1J1E C;  4Y28 J;  2KB7 P;  2YKP A;  5TJH A;  2K1A A;  3CCJ P;  4PD4 D;  1LTA C;  4W80 A;  1VQ4 P;  2WMM A;  1S5L H;  1GW3 A;  1AQ5 A;  1RY3 A;  1ZRT E;  1KFM A;  3VP8 A;  2HOD B;  1KB9 I;  1J2J B;  3BRV B;  3MUD A;  1YTZ T;  3G9R A;  1BE3 J;  4RJT A;  2FXP A;  1SQQ K;  1JM0 A;  5AVV B;  3RBZ A;  2A06 D;  4IFD K;  1OVU A;  4PV1 B;  4EDF A;  3P7K A;  1G2C B;  3V6I A;  1JMM A;  3P8C E;  2WPQ A;  3VMX A;  1N73 A;  1E79 H;  3CCQ P;  3H1H J;  2IDB A;  1P84 I;  3IN6 A;  4DOJ A;  2W6A A;  2Y0D A;  4M3L A;  1OZH A;  1SQV E;  1KTM A;  1LTJ A;  3MP7 B;  2O01 H;  1RQU A;  2QJY B;  2ITA A;  1LX8 A;  1OFC X;  2JJL A;  2KI7 B;  4LGD E;  1K04 A;  3W67 A;  4NPF X;  1ZRT D;  3EFG A;  1SFC C;  1N73 B;  3EWK A;  3FGA D;  1RE4 C;  4H13 B;  5AVR B;  1LJ2 A;  5APT A;  4ASW A;  1VF5 D;  1RF0 C;  1NTZ J;  2W90 A;  4U7J A;  3SSU A;  3L75 E;  1JNM A;  2O3J A;  3AE1 C;  4XE5 B;  1A02 F;  1SQP G;  3M0D A;  5CCH C;  1PZQ A;  3P8C D;  1FU1 A;  3B5N A;  4GOD A;  1SS1 A;  2YMK A;  3LUR A;  2BEQ D;  2O01 N;  1SQV D;  4H44 B;  2LR2 A;  1IK9 A;  2JKV A;  4GDO A;  1NTK D;  3OA7 A;  1N86 A;  2ZXX A;  1USE A;  4I1L A;  3CCR P;  1KQL A;  4N6J A;  1J1D C;  3B5N B;  1NVO A;  4UB6 E;  1FZA A;  1GL2 C;  3CX5 E;  3H32 A;  4MN4 C;  1W5C E;  1EXI A;  1FDM A;  5KLV E;  3JSV C;  3L72 E;  3L75 D;  2RN0 A;  3Q2Y A;  1GD2 E;  5I41 B;  1Q09 A;  2WSS H;  2KXP B;  3L73 E;  1H8A A;  5KJ7 C;  4RO0 A;  2K88 A;  1SQB K;  3L74 D;  3I56 P;  3VN0 A;  3H32 B;  2V4H A;  3RL0 g;  1LTG C;  1JEK A;  2AEM A;  3FWL A;  1A02 J;  3AEA C;  5AVQ B;  1L0N E;  1PP9 J;  2B89 A;  3A5T A;  2P10 A;  1VQ8 P;  2H89 C;  1EDJ A;  2QIW A;  3OAK A;  1IFJ A;  3CME P;  5BVZ A;  4OGQ C;  5KLV D;  2YNY A;  3L72 D;  5B66 H;  2NPS D;  2UWJ E;  4A1M A;  4L74 A;  2H7H A;  1EDI A;  1BE3 G;  3V2P A; 
#chains in the Genus database with same CATH homology
 2E75 C;  1JB0 J;  4YXD C;  2YMK A;  4PV1 D;  5D8C A;  3LUR A;  2BEQ D;  1NGM B;  2G3A A;  1VF5 C;  1YQ3 C;  1FDI A;  1BOW A;  4H44 B;  4OGQ B;  1K05 A;  3D6Y A;  1RQV A;  1PL5 A;  4LHF A;  1DD3 A;  2QSI A;  5L8R J;  4GDO A;  1OW8 A;  3IAO A;  2JML A;  3GLM A;  1Q07 A;  2ZT9 B;  1Q0A A;  4J2N A;  2FBW C;  1NYH A;  3AEB C;  4H0L C;  3O6Q A;  2FYN C;  2GOV A;  4R22 B;  4B0Y A;  1KQF B;  1RH6 A;  3EZ2 A;  2ZHH A;  2BEZ F;  1ZRT E;  2O01 J;  2NZ2 A;  3GMA A;  3GF3 A;  4PV1 C;  5KKZ C;  3R8J A;  1VF5 B;  4Z1M H;  1VL2 A;  5D90 A;  3R4Y A;  1FDO A;  3GF7 A;  3EZ9 A;  4WLW A;  3D70 A;  3AE6 C;  3G9R A;  4R4E A;  2JP3 A;  3AE3 C;  1R8D A;  3AE2 C;  2BOW A;  1WMK A;  3C8V A;  3Q5P A;  2D2C D;  1Y9B A;  1S1C X;  2E74 D;  4IL6 X;  1IK7 A;  1ZOY C;  2YIU C;  1Q08 A;  4H0L B;  1EXI A;  2FXP A;  3AEG C;  3RK3 E;  1D5Y A;  2QJY C;  4RKU J;  1KIL E;  3QAO A;  3Q2Y A;  1OW7 A;  4PV1 B;  5I41 B;  2IEF A;  2D2C B;  1Q09 A;  4I7Z C;  4KT0 J;  4XFJ A;  3ABV C;  3B49 A;  3AEE C;  3EZ6 A;  3Q5R A;  2G8Y A;  2IDB A;  4AYZ B;  2D2C C;  1Y6U A;  1Q05 A;  3IN6 A;  2E74 C;  2WSC J;  4R4M A;  4WLS A;  5KLI C;  1KTM A;  1AJY A;  3S9O A;  1PM6 A;  1RQU A;  1ZP0 C;  4YTP C;  3H25 A;  3AE9 C;  1LX8 A;  4R4L A;  5KAT A;  3GK6 A;  5KAX A;  3RL0 g;  3SFD C;  1PV3 A;  5M1B A;  1OW6 A;  3GPV A;  4R24 B;  2JO1 A;  1MKM A;  3HH0 A;  1Q90 D;  5I44 A;  1YQ4 C;  2WSE J;  4I7Z B;  2QJP C;  3AEA C;  4H44 D;  4OGQ D;  1K04 A;  3R8K A;  1R8E A;  1GMJ A;  1OMI A;  4H13 D;  2OG0 A;  5KAU A;  2WSF J;  3AED C;  3UCS A;  3AE7 C;  2P10 A;  5KAV A;  2E74 B;  3Q5S A;  3AEF C;  2E76 C;  1DIP A;  2ZT9 D;  3GP4 A;  2QJK C;  3EZ7 A;  2DG6 A;  1HJ0 A;  3EWK A;  1KOR A;  3FGA D;  3E0H A;  2H89 C;  2MKV A;  3Q3D A;  3D6Z A;  4DCZ A;  3EZF A;  2VZ4 A;  2QIW A;  2E76 D;  4H13 B;  2E75 D;  1TU3 F;  2KVV A;  3AE5 C;  1KQG B;  3AEC C;  3T97 B;  1EXJ A;  5KAW A;  2KCU A;  3LW5 J;  1VF5 D;  1KMI Z;  1U57 A;  4H44 C;  1PIX A;  3D71 A;  4OGQ C;  1DD4 A;  4H13 C;  4U7J A;  5KCB A;  2ZHG A;  2WQY C;  3AE1 C;  3Q1M A;  5GQQ A;  2K9Y A;  2OQQ A;  1ZME C;  1JBG A;  5E01 A;  2ZT9 C;  2E76 B;  3SFE C;  2E75 B;  2H88 C;  3B71 A;  4A1M A;  4H0L D;  3AE4 C;  1UIX A;  4AYZ A;  1Q06 A;  2V7Q J;  3AE8 C;  4TT3 H;  1S5L X;  1HF9 A;  2WPV B;  1JYH A;  2J5U A;  2HVA A;  4Y28 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...