1D5YA

Crystal structure of the e. coli rob transcription factor in complex with dna
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
288
Chain Sequence
QAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRSPEWSAFGIRPPLRLGEFTMPEHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLNLTRRKGQDIERYYPAEDDRPINLRCELLIPIRRKLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*AP*CP*AP*GP*CP*AP*CP*TP*GP*AP*AP*TP*GP*TP*C
publication title Crystal structure of the Escherichia coli Rob transcription factor in complex with DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 288
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06445 GyrI-like GyrI-like small molecule binding domain
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1d5yA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1d5yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1d5yA03
3MN2A 1WH7A 3BR1A 4A1MA 1RKWA 2O9LA 2NS8A 2LP0A 4RDUA 4I6ZA 2FJ1A 1DU6A 3HM5A 4BKXA 2LK2A 3HOYJ 1JT0A 2LKXA 1Q1VA 2JWTA 1T33A 4V2GA 4JYKA 4A3JJ 2NVQJ 1MNMC 1ETOA 1OCTC 2E2JJ 2G0EA 1MBKA 2K9NA 3M4OJ 5IYDJ 1ORKA 1B8IB 1IG7A 5F04A 3BG5A 4DYQA 1Y1VJ 2XGCA 4B3AA 2E1OA 2LLKA 2L7FP 2DMNA 3Q0VA 2Y30A 1A5JA 1PUFB 3HGGA 4FCYA 2R5ZB 4M3EA 2R0QC 1MBFA 2EBIA 3ZQHA 3LSPA 2JA7J 5K7ZA 5FLMJ 4JX4A 1IDZA 3B49A 2RAEA 4QTRA 4A3KJ 1BW5A 3JRBA 4IHXA 2DMTA 3GTLJ 2EZLA 2XB0X 1O4XA 5C4JJ 5EZHA 4JX5A 5EZGA 1F36A 4A3MJ 2YU9J 2DA5A 1U78A 1HCRA 4FE7A 3Q1MA 2GBYA 3S17J 1JTYA 1JTXA 2CRGA 4B0YA 3A03A 1IV6A 3HKZN 4MFDA 1XC5A 1I6HJ 4AYZB 1X2MA 1WI3A 3HB9A 2N8GA 1GVDA 1Z0XA 5E3LA 3ZQCA 2XSDC 1HF0A 2XRLA 3GK6A 2M0CA 2HDDA 2P81A 3M3YJ 5M5XJ 2Y9ZA 4L5EA 5M5WJ 3WHBA 1B8IA 2W48A 1TWGJ 2HXIA 3MVPA 2FX0A 1RKTA 4XK4A 1ZR4A 3GTMJ 2ELKA 1PUFA 4IHYA 2R5ZA 2M8GX 1G2HA 1EXIA 1VF9A 3JREA 1LFUP 3JRAA 3H0GJ 1JKPC 3BQZA 1JYHA 3TP0A 5EYRA 3DEWA 1MH3A 3HDDA 2WAQN 3Q0UA 2M9HA 1FTZA 1OJLA 5M3FJ 3K7AJ 5EGOB 5DTDA 1TWCJ 3SDGA 2CQQA 1EF4A 3NAUA 5EF6A 4IEJA 4M3BA 1HDPA 1MBHA 4BY1J 3LURA 3Q0WA 2NVTJ 3OSFA 4QIWN 3CCYA 3TP3A 4BBRJ 1U8BA 1BW6A 1ETWA 2XPWA 5GQQA 4G12A 2JA8J 3JRHA 1IGNA 2MGQA 4AYZA 5KAWA 3C2BA 1Y1WJ 2BOWA 1EXJA 1SFOJ 2HVAA 5JLXA 2AO9A 1IRZA 1ETQA 5FLVA 4QSHA 3O8GA 1W0UA 5EG0B 2X48A 5FKOA 4IHVA 1QVTA 1X58A 2CU7A 1H88C 2XPUA 2LY9A 3S16J 3BR2A 3Q3SA 3Q5RA 2HYJA 1QVUA 5BNGA 4X1EA 5GPAA 1W0TA 4FE4A 5M5YJ 1ZK8A 1XS9A 1DU0A 2JMWA 3HOZJ 1APLC 1LE8B 1JUMA 3ZQFA 5DS9A 3BTCA 1NK3P 2E2IJ 2H1KA 3I4NJ 2Y9YA 3MKLA 2GOVA 2TCTA 5EGOA 1ZGWA 2Y2ZA 1AHDP 2K40A 3LOCA 1BA5A 3BQYA 2L9RA 2VKEA 3E0HA 1GT0C 3A02A 1IDYA 4XRSA 1POGA 2XGDA 5GP9A 4RBOA 2X9DA 4J19A 3OSGA 3IH3A 4FISA 2VUMJ 2L7MP 3JRFA 3D6YA 2KDZA 1ENHA 2R92J 4MO7A 3B6CA 3Q5SA 1OCPA 3Q3DA 1TWAJ 1JUPA 4B4CA 3JR9A 4JP0A 1JKRC 2NOGA 4M3FA 3BG9A 2B63J 2EZKA 3BTIA 4B1RA 5J1UA 3S14J 4A3CJ 2JA6J 2QCOA 1VI0A 2ME6A 2ZB9A 4BY7J 5EG0A 3HBLA 3W6VA 1BJZA 2O8KA 1ITYA 2CUEA 2NS7A 1GUUA 2JN6A 2R5YB 4I76A 1MSFC 5KCBA 1IJWC 2CQXA 3FK7A 2HXOA 5J3LA 3HOWJ 2DA1A 1B72B 4UUTA 3LNQA 1ETYA 5J1RA 2JA5J 3S2HJ 1NK2P 1R9TJ 1LE8A 4DW6A 3D70A 4HNVA 4IHWA 2EZHA 5GPCA 3CDLA 3S15J 3SJMA 3JRGA 4DYCA 4A3DJ 3JRDA 2ECCA 2L0KA 2ME0A 1BL0A 1RETA 1RPWA 1UG2A 5IOYA 3S1NJ 3O8HA 9ANTA 2XPVA 1U9NA 3GTQJ 1NTCA 5E3MA 3QQAA 3VPRA 2O7OA 4AC0A 3G1LA 5EDNA 5M3MJ 3UKGA 2GM4A 3S1QJ 1WGXA 1MSEC 5F0FA 3LSJA 1FIPA 2WV1A 1ZR2A 3TW7A 1YRNB 5HODA 2L7ZA 1JJ8C 2DMPA 2GLOA 5KAXA 3Q5PA 3S1MJ 2CUFA 4XIDA 1JJ6C 2Y31A 4Y7NJ 2DMQA 3HOUJ 1AU7A 1JGGA 2DA7A 1WCMJ 2R5YA 1VFCA 3NARA 3DCFA 3HEFA 4W1UA 4X6AJ 1E3OC 2ID3A 4LOCA 1X2NA 2IAIA 2DN0A 4M3GA 5FKMA 2M2EA 1B72A 1HDDC 5KAVA 3RZOJ 4XRMA 1HOMA 1VNDA 4A3GJ 5IYBJ 3WHCA 1A6IA 3A01B 3GTPJ 2DA2A 3I4MJ 5JLWA 2IEKA 2DJNA 3GTKJ 4MIMA 4A93J 4NDLA 2JJ7A 3Q2YA 4D7MA 5F08A 4UUSB 1OFCX 4D5FA 4GFBA 1FEXA 2MG4A 2H8RA 5IYCJ 2COBA 3OIOA 5IPAA 3B6AA 4CYCB 3BR3A 3H3VK 1ETKA 4A3EJ 1MBGA 2X6OA 1FJLA 2AHQA 3RQIA 2K9SA 2YS9A 5J1YA 4A69C 1YRNA 5EEAA 4C2MJ 2OPTA 5C4XJ 3ZQLA 3QPLA 1GV2A 1ZTRA 1QRYA 3CMYA 1TWFJ 4BXXJ 4M6VA 3QPSA 5E3NA 3GTOJ 3IH4A 5FKKA 2KT0A 2VPRA 4ABZA 3BR6A 1MBEA 3IAOA 3G1OA 2LFBA 3JRIA 3GTGJ 5KATA 1ETXA 2DMUA 1JT6A 5IP7J 3FKIJ 1H89C 3CQZJ 2EZIA 1I50J 4FTHA 2NVXJ 3OOUA 2IBDA 5F27A 2D5VA 2MW8A 1Z77A 3BR5A 1WH5A 1TC3C 2OF7A 4BBSJ 4A3FJ 4DZPA 3A01A 3PM1A 1IUFA 1WPKA 5IP6A 2TRTA 1LFBA 1GV5A 2HOAA 2K9QA 5F0HA 4UUSA 5K7FA 3PO2J 4C3IJ 3BT9A 2QF7A 2ID6A 2FD5A 3BTJA 4XRSG 1FTTA 2ECBA 3L1PA 2WB1N 4CYCA 5C3EJ 5IP9J 4C3HJ 2MSYA 2XGEA 2DA6A 5IOZA 4MFEA 1XG1A 2JK3A 4A3BJ 4XICA 2DTZA 4W97A 2DA3A 3BG3A 2HQ5A 2E2HJ 1P7IA 5FKNA 3D71A 1RESA 5F0CA 4AUXA 2CJJA 2LVSA 3K2AA 4D7NA 3IV5A 1K61A 1AKHB 1F43A 3D6ZA 1JKOC 4Y52J 2YUSA 5K7HA 2HOSA 4DZJA 3E7LA 3F0CA 4DYRA 3ZQIA 3HGYA 2R7ZJ 3GTJJ 4AYBN 4M3DA 2HOTA 3TEDA 3LSRA 2EQRA 3R8JA 2M34A 2DA4A 3FK6A 1GDTA 1T56A 2PMZN 3JRCA 1JKQC 3R8KA 3FIWA 2VKVA 1BOWA 1UHSA 4A3IJ 1ZKGA 1S7EA 4EEFG 1MH4A 2VI6A 2LTPA 3FISA 4D5CA 2KCUA 2R93J 3IH2A 2Y0SN 4C3JJ 1ZQ3P 1TWHJ 4MLOA 3LSGA 3SFIA 3S2DJ 1QPIA 1SANA 4A3LJ 3S1RJ 1K83J 3TW6A 1H8AC 1FIAA 1P7JA 2HI3A 5C44J 2LR8A 5FJ8J 3PO3J 1JUSA 1I3QJ 3D1NI 2LD5A 2XB5A 3RZDJ 2E19A 3ZOBA 2NVYJ 1HLVA 3HOVJ 1R8EA 2FQ4A 3RKQA 1AKHA 1MBJA 3BR0A 5FKLA 1D5YA 1ETVA 3G1MA 2I10A 1IC8A 4V2FA 5E3OA 2EH3A 3BTLA 1U9OA 1UMQA 3ZQGA 3HOXJ 3GBGA 1RR7A 5KAUA 5F1JA 4JX6A 1CQTA 4S0HB
chains in the Genus database with same CATH superfamily
3MN2A 3G6EI 1V5FA 4YIIA 1OMIA 1RKWA 4PUSA 4A6DA 1K7AA 2O8XA 3ZMUA 3IC7A 4M6XA 3CUQC 2QKMB 2FJ1A 1BI1A 1YW7A 4RGSA 1QA6A 3TDZC 3GFIA 1YS7A 4BKXA 2LK2A 2M30A 5DV5A 5KNLA 1JT0A 3LMMA 2O03A 2JWTA 4LB5A 5A2QZ 1IXSB 2FEZA 2UV1A 4A3JJ 4AIHA 2MFZA 3WU1B 1MNMC 1ETOA 2ISYA 2GWRA 1WJDA 1MBKA 3ISPA 1VQ6I 1MMNA 5HLIA 2HTJA 2VT3A 4DYQA 3HTSB 4PSXA 1Y1VJ 3GX4X 4XSZF 4LGWA 3S3NA 4XLNF 3RSNA 4B3AA 1YTYA 3ZP5A 3Q0VA 1ON1A 1A5JA 3GVAA 2M7AA 2R5ZB 2ICWG 1EH7A 3GFMA 1EH6A 2V6CA 2JA7J 2BOLA 1UCRA 5K7ZA 1O3QA 3PUBA 1IN4A 2RAEA 1R1TA 4QTRA 2STWA 3JRBA 1ULYA 3G2BA 1UHMA 3CCSI 2NOJB 2DK8A 1FOXA 1YIOA 3FXLA 4E70A 3A2KA 4RAFA 3TMOA 4PZJA 3D5LA 1USSA 2HVRA 2X0LA 2V7FA 2DA5A 1U78A 2WAFA 1HCRA 3I9V2 1Q1HA 4YIRX 2GA2A 2I5UA 2CRGA 3A03A 2M8EA 1P4WA 2HQAA 4NC6A 1PUEE 4B3XA 4YFXF 4Q47A 2WTEA 3C7JA 5GAEJ 3HB9A 5B3SH 3PIOF 5K5OA 4EJTA 4NBQA 5E3LA 2XF6A 2K02A 3OYIA 2RGVA 3GK6A 4WCGA 3HZJA 3H9QA 3WHBA 1S3JA 2K86A 1UELB 3F9KA 5L3GA 3CMEI 1U6GA 3MVPA 2O3FA 2NRAC 1RKTA 1BC8C 3E5UA 3GTMJ 1EXIA 1MNDA 2R5ZA 3HOSA 3HIFA 3JRAA 2F5DA 1VZ0A 5EYRA 3AKZA 4HQEA 2B0LA 2P6TA 2MYSA 2A07F 2BY0A 2WAQN 3HDDA 4OIPF 1FSHA 1P92A 4B48A 2V79A 4G9YA 5M3FJ 3ELKA 3K0LA 4KITB 1EF4A 2LNBA 2H6CA 2M4GA 4IEJA 4IHTA 4AIKA 1HDPA 1FYMA 2VE8A 1KU7A 2EB7A 3DBLB 1HC8A 3Q0WA 4GYIA 5J4VA 3OSFA 4QIWN 2EV0A 2FRHA 1KU3A 3NEUA 3HL2A 3C2HA 4ENMA 5F6FA 3E97A 3MZHA 1VQ8I 1BJAA 2KHMA 4B09A 1ZG5A 4ZDOA 2A6TA 1ETQA 5FLVA 3WTYC 3KLNA 2DQLA 4IO9F 1VQ4I 3EUHA 1ZELA 4RGUA 4FHTA 1V54H 2ZJRF 3BPXA 2LY1A 4KT5C 3U1DA 2OZ6A 3JTHA 4FETA 3S16J 2DTRA 1R6RA 2VQGA 1HBXG 2P5KA 4MTDA 5BNGA 1W0TA 4KUMA 4FE4A 4YFNF 4JOMA 2GQQA 2JVGA 1X1CA 1YS6A 2K5CA 1APLC 1SD5A 4I0BA 2O61A 1JUMA 2J5OA 2PMHA 2EPFA 3BTCA 2BYVE 2H1KA 3MKLA 5IY5H 4B44A 1WWXA 2FBHA 4RB0A 3LOCA 2VKEA 5B66C 1Z3XA 2Y69H 2IA2A 3A02A 3GZNB 4XRSA 4ZTJA 4PJJA 2QQ8A 2XGDA 3KZIC 2VE9A 2L7MP 2XAQA 4WWCA 2KDZA 2F5EA 2M4KA 2E1MC 1W36C 3Q5SA 3Q3DA 3CUQB 5BOXA 1HKTA 4N9IA 3F8MA 2EZKA 2VBZA 2FBKA 3BTIA 2B63J 3KP6A 3S14J 4A3CJ 2QM3A 3TDUC 3CZ6A 4GGGA 4BY7J 2JSPA 1BJZA 4GRIA 2CUEA 1GUUA 2JN6A 2K85A 1MSFC 4AVPA 1STZA 1IUYA 5KCBA 4HV6A 2CQXA 6PAXA 4BL0B 4HOBA 4BJ6C 3HOWJ 5DEQA 2F4IA 1PDNC 4IX7A 4UUTA 3LNQA 4MQ9F 5DCMB 3GLLA 1LEBA 3L2WA 1VQ9I 1X1DA 2JA5J 2P7CB 4BJ5C 3K10A 4IQJA 4DW6A 2IS2A 5DD4A 1ZG1A 2ZJPF 4BE0A 1D1CA 1LKXA 2Z2SB 4RM2A 4HNVA 1O3RA 4ZYGA 3BC8A 2VXDA 3SFZA 4BU2A 1R23A 3CDLA 4HA8A 1Y0UA 4A3DJ 1ZG3A 2ECCA 4LK0F 3ERMA 2LF7A 3COAC 1UG2A 4KNYA 5IOYA 3LSIA 3S1NJ 2QUFA 3RI4A 2LMDA 2VOPA 2XPVA 5AONA 1VQOI 2FOWA 1V3FA 2C6YA 2VODA 5CVIA 5E3MA 3CO6C 1SFEA 5M3MJ 3WG7H 3S1QJ 1WGXA 4OIRF 1FSEA 5IT3A 2BW3A 4KIGA 5F0FA 3LSTA 1J59A 2GXGA 1FIPA 2WV1A 1ZR2A 2L7ZA 3CUQA 3MQ0A 3ML6A 2R7TA 1XMKA 2DPDA 3S1MJ 3RIRA 3QAHA 2VLAA 1U5TC 3T8TA 1JJ6C 1KYWA 3CDIA 1J7KA 3N05A 2W00A 2P6SA 2R7OA 3BP8A 1RRJA 1XMAA 3HEFA 2EFQA 4W1UA 1E3OC 1AWCA 2ID3A 5JVTA 2IS6A 3IWZA 1X19A 2DI3A 5FKMA 5JR3A 4H4KC 1PJRA 1XCBA 5DCMA 2IP2A 3H5AA 2OAZA 5KHDA 1S5LC 1A6IA 4BE2A 1MMSA 2R4GA 3A01B 1J09A 2FE3A 4ZC3A 4F91B 1OYIA 2LKSA 2FBIA 4BQAA 1HA8A 2W1OA 4XQFA 4A93J 1XSVA 4XONA 5CKTA 3Q2YA 4UUSB 4GFBA 3ECHA 4LJZF 4U0WA 5J8CA 1WKMA 2QENA 4TV7A 2HDCA 4ITVA 1SD6A 3OIQA 4KIFA 2ZXIA 3B6AA 3PJRA 3BR3A 3OS0A 3H3VK 2PJRB 1KYZA 4BAYA 1G3YA 4WXHA 3RQIA 2YS9A 4A69C 3M1EA 4IF4A 1I27A 3HRTA 4BEHB 2ESNA 3CLOA 2R7SA 1W4MA 5E1ZB 3FBNB 1ZTRA 4LLLA 5HLHA 1QRYA 3CMYA 2KDOA 4RB3C 4ENNA 2L9SA 4XLFA 2ZNYA 1O7LA 3G71I 4EM0B 2OV7A 4BXXJ 3T1BA 1P2FA 2XRNA 3GTOJ 1D8JA 4CSWA 1W5SA 5AIQA 3DKYA 2CG4A 4OINF 2DMUA 5KATA 2FMYA 2JPCA 4ETSA 2WV0A 4OIQF 1H89C 2V9KA 2Z16A 2HKXA 5HS8A 1G6NA 4HG2A 3OYFA 2LG4A 4HAMA 4IPAA 4E7IA 3K4JA 5HNFA 5E20A 1R71A 5DCFA 3JSPA 3QYEA 4E7LA 3EYYA 2UWMA 1XGOA 3H36A 4LITA 1TBXA 5D5VB 3A01A 1FOYA 1EH8A 3LAPA 5IP6A 1FBSA 3H9JA 3WU0A 2L9VA 1Z6RA 2K9QA 2OJED 5F0HA 4UUSA 1YG2A 4C3IJ 2HYGD 3CP8A 2QF7A 3ZR8X 1S72I 2LKPA 1IZ1A 5EEHA 2Z5UA 2PMUA 1T2KA 3L1PA 3IAS2 3GWZA 4HLYA 1N75A 5J47A 4DGWB 1D3YA 4CYDA 2PJRA 2XGEA 2UXXA 2DA6A 2E1MB 1MDMB 2RDPA 4W97A 4BEHA 1LVKA 2X6YA 2ZNZA 3BG3A 2E2HJ 5FKNA 3D71A 2KKOA 2K7LA 4XOPA 3V8LA 4D7NA 2ZMEC 2VQLA 3D6ZA 3ZQQA 3DV8A 1BI3A 4L9NA 3ZXSA 2GZWA 4DZJA 1A31A 3E7LA 1LNWA 3ZQIA 3JAMZ 1YQAA 1VQNI 4AYBN 2K3PA 3AG3H 4DOZA 2FQ3A 1RNLA 3OYMA 3ASNH 4EM1A 4KFCA 4O3MA 3LSRA 3ROUA 3R8JA 2M34A 2QSHX 1LVAA 1K79A 3H1CA 3CCRI 3L9FA 3BJ6A 1UHSA 4XRFA 1ZKGA 5HLGA 1WJEA 1EA3A 3K4CA 4EJWA 2VASA 2VI6A 3FISA 2R93J 2Y0SN 1ZQ3P 1TWHJ 1O7FA 3E0JB 4EQQA 2RREA 3FMQA 1QPIA 4L5JA 2LDUA 2VB6A 5GADJ 2LBFB 4IXAA 4IHSA 4I99C 2K4BA 1E3PA 1F5TA 1R7JA 1I39A 2L3DA 4LK1F 1P7JA 4P55A 1MDMA 1UAAA 1JUSA 1ZARA 3D1NI 2LD5A 1W7PD 2E35A 2L9NA 2HEOA 4RLQA 2GA1A 3RPUD 3HOVJ 3ZOBA 3RKYA 3U21A 2B7EA 1A35A 1R8EA 2FQ4A 5CVVA 4BYYA 5FKLA 2XVCA 1YJ9I 4AWXB 1IC8A 5E3OA 1BC7C 2F5CA 2D45A 3ZQGA 3HOXJ 1NG7A 3CUOA 4XL9A 1RR7A 3K70C 4OWRB 1ZGJA 4PJNA 3E6BA 3K6GA 4JX6A 4OOIA 2NVUB 1MJAA 4S0HB 1MZBA 1WH7A 4NUBA 1GVJA 4I7HA 5H6QA 4IZZA 2NAZA 3QOPA 2XUBA 3BCAA 2KFDA 1IW7F 4A5NA 2HPMA 4IKFA 3D5RC 2AXLA 2MH2A 4BACA 4BUPA 1TQMA 2DFIA 2BZTA 1Y8QB 4MNUA 2P5LC 5CVRA 3F23A 1B6AA 1MMAA 2MA3A 3V4GA 2NVQJ 4JYKA 2LBFA 1LQ1A 1D0XA 3K4MA 2FMLA 4PSWA 1YE9A 2DK5A 3M4OJ 3A0HC 3LA3A 4AD9A 1GHCA 2X1CA 2X6WA 2XGCA 1R4NB 3RPQA 1D1BA 3ZMDA 4CZCA 1PUFB 3HGGA 4GXOA 4M3EA 2BV6A 2HVQA 2DJIA 3LSPA 3BZCA 1ONVA 4YEJA 4G6TB 2ZXWH 4YRVA 4JX4A 5FLMJ 4A3KJ 3OYHA 3V7CA 2V1NA 3IP4B 4Y15A 4IHXA 2EZLA 4UVAA 4EVIA 3FM5A 5D5WB 3GEZA 3I0TA 4JX5A 5HS9A 5GTHC 2VQCA 2ETHA 3CJQB 3H35A 1BR2A 1R5ID 2OU2A 2VC1A 3CJTB 3FWEA 2X6XA 4A3MJ 2KLOA 2QVOA 3PIPF 1DPRA 3ZN1A 1QHGA 3OS2A 3S2WA 3I3LA 3OWTA 4YIFA 2XC7A 1X1BA 1QNTA 2IA0A 3L2QA 2FA5A 1RR8C 3HSFA 2IVMA 3HKZN 4MFDA 1XC5A 2HQRA 1GXQA 1I6HJ 1X2MA 1KZHA 4L9TA 2M7BA 1I3AA 3FXQA 3ZQCA 3VOEA 2P7VB 2EV5A 1BN5A 5ICCA 1RIOH 2Z33A 4PJMA 2PG4A 4EMSA 2YU3A 3I55I 1MJ9A 2M0CA 2HDDA 1FP2A 4WK8F 3SXYA 3QODA 2ZJQF 3VFZA 5M5WJ 1MIJA 4R79A 4AIJA 2E5NA 2BE5F 1Y0NA 5LRSA 3K4NA 4QWQA 3U2RA 3GLXA 4XK4A 1ZR4A 1MNEA 1PUFA 2M8GX 3TO6A 2H94A 4LG0B 3H0GJ 1JKPC 2OA4A 2KPMA 2ZMEB 5E8IA 2UZKA 1FPQA 3K4KA 2HR3A 2EV6A 1OYYA 4KIBA 5LBQA 5TRDA 5BMZA 2A68F 5GAGJ 1OJLA 2MBFA 3K7AJ 3I56I 5DTDA 3V7RA 3J7YJ 3HRUA 4HF0A 3NAUA 5EF6A 4NC7A 1IF1A 3S8PA 3ABMH 3F6VA 2H27A 2NNNA 1LDKB 1MBHA 1R00A 1JHHA 3GFLA 3K2ZA 1H9TA 2OTLI 5D4RA 3CCYA 4FX0A 3TP3A 1O57A 2IS1A 3PSIA 2ZO4A 1U8BA 1BW6A 5FFXA 3VYUB 1ZN2A 2F5FA 2QWWA 2BVLA 4G12A 4HNUA 2JA8J 5GQQA 3SZPA 3DU5A 3JW4A 3JRHA 4M73A 3GW2A 1IGNA 1DP3A 5KAWA 3C2BA 1Y1WJ 2BOWA 3OYDA 2HVAA 3J7AY 4MHGA 5JLXA 4S05A 4Q4ZF 1W0UA 5EG0B 3L7WA 3ZQ7A 2L5QA 3CP2A 4D9JA 4A5MA 2HNHA 3M07A 3E3VA 5DUIA 2FOKA 3P7NA 5H6RA 4OAYA 4EV0A 3DLLF 4AM3A 1L0OC 2KIFA 4F55A 3Q3SA 3Q5RA 3PSFA 3H92A 1BM9A 5E18F 1X1AA 1XS9A 5GPAA 4LG0A 2PJPA 3OYLA 2M3AA 2Z99A 3ABLH 2ZMEA 1U0JA 3ZQFA 3HSRA 4EGYA 5DS9A 4HX7A 3EETA 2Q1ZB 1X3ZB 2JPBA 4JQFA 3I4NJ 5HDNA 4CICA 4N4OB 2IA1A 2L9RA 3F8BA 1FYKA 3U9GA 5LGUA 3VYTB 2WA0A 2OUMA 1GT0C 2QZ8A 1IDYA 2MC3A 1RUNA 5GP9A 3KP5A 4J19A 3OSGA 3IH3A 4FISA 3FZVA 3JRFA 2VUMJ 4CCJA 3VSLA 3EPZA 2H09A 1J9IA 2ZBKA 2XASA 1SFXA 4QPOA 4OMYA 2X1DA 3Q9VA 1YYVA 2OZUA 3BG9A 4RM3A 3I54A 1P9QC 5KVRA 3CO7C 3AL0B 5J1UA 4MTEA 3K9TA 4C2UA 2WADA 3B73A 3LA7A 3GZ6A 2HPIA 2ME6A 2CMPA 2ZB9A 5EG0A 3H5RA 3F6OA 3W6VA 2O8KA 2XKPA 1ITYA 2VKDA 3IKVA 2R5YB 5DD8A 2HXOA 5J3LA 1IAWA 3WTSC 1MW7A 2RC4A 5LRRA 2W4SA 5TJJA 2DYSH 1DGWY 1U8RA 4XN0A 1ZRDA 3RKXA 1FY7A 2DOEA 2EZHA 4BGDA 4I02A 1TT5B 3S15J 3SJMA 4DYCA 3ZMVA 2W25A 1RETA 3WGIA 3M8FA 3F72A 4AVZA 4FQGA 3VODA 9ANTA 3HTUA 3DBHB 3GTQJ 4HW0A 1JGSA 1NTCA 2AQEA 1G4DA 5EDNA 3CC4I 2XAHA 3DLAA 3S32A 1BR4A 3LSJA 4GCVA 2KZVA 3TW7A 3CTAA 1YRNB 4S04A 1IRXA 2V1UA 3JCUC 1M1EB 1K4TA 2GLOA 4HEA2 5ICEA 3Q5PA 4RGXA 3HJEA 4XIDA 1Z6TA 3CF2A 2YR2A 4II2A 3OYBA 3DF8A 1UJ8A 2TDXA 2DA7A 1WCMJ 4M71A 2R5YA 3A1YA 2W82A 1MKMA 4Y17A 3VYRB 4X6AJ 3J81Z 5DUKA 5D6FA 2AQFA 3DBRB 3HG9A 2B9SA 4Q48A 3DQVC 4N9HA 5IT9Z 1HDDC 3K4LA 4CH7A 2DFFA 3DTIA 1H9GA 1WZ2A 4XRMA 1VNDA 1BR1A 5JFRA 4A3GJ 1G3WA 3BG6A 2VQHA 1KGSA 3I4MJ 4CUGA 3RJPA 2DJNA 1XGNA 4LFUA 4MIMA 3GTKJ 4MEXF 2JJ7A 5TISC 3WGGA 1OFCX 4D5FA 1W5CC 3I71A 3OYNA 3TBIA 2MG4A 4J00A 1FEXA 5IYCJ 3HHHA 2ZC2A 2OCCH 3K4BA 2R7RA 2A6HF 3V8JA 5IPAA 4G7ZF 2VL8A 1WJFA 4G6DA 4ZYDA 1S7AA 3FKJA 3HYIA 1ETKA 3LQRA 5FLXK 4M9ZA 2AHQA 4XLEA 3MD2A 2K9SA 4UXNA 1YO5C 3BWGA 1YRNA 4U88A 1J2XA 3DTKA 1TNTA 3ZQLA 3IRQA 1B4AA 5L3BA 1W1WE 1WRJA 3KP7A 5FB2A 4L9JA 2OTJI 2HU9A 2DQRA 3BZKA 3BPVA 3NWTA 3FMRA 3IH4A 2KT0A 3BR6A 4UY8I 3E6DA 4XOTA 3G1OA 2QQBA 2LFBA 3JRIA 2VN2A 2M5WA 1PP8F 2BW3B 4F3QA 5L3CA 2IJLA 1IN6A 3CQZJ 1F1ZA 4LMYA 2RN7A 2NVXJ 3OOUA 5F27A 2Y0MA 1IO2A 1E3HA 2MW8A 4M72A 3E6MA 3HUGB 4QLCU 4CCNA 2OF7A 3M7GA 3CF5F 4A3FJ 3OYCA 3I4PA 4L5IA 3FF5A 2E71A 3H9GA 1GLNA 5J8FA 4NHJA 2I8DA 1XN7A 3R0AA 2XAJA 3BT9A 2VBYA 5B1BH 1FWZA 2E5ZA 3V42A 1BIBA 4DIQA 4OIOF 1VQKI 1B9MA 3KP4A 5D6EA 2V26A 2KZGA 2WB1N 4IRIA 2NS0A 5C3EJ 3OYGA 1P4AA 4C3HJ 2MSYA 3DKXA 1OKRA 5IOZA 1XG1A 2JK3A 4HLXA 1I5ZA 2DTZA 4RA2A 2E1NA 1RESA 2LF8A 3K1PA 3L2RA 1K61A 3K2AA 3IV5A 2P5VA 4F93B 2CV2A 3HOTA 1IV8A 5K7HA 4HSRA 4BQOA 2VKHA 1TNSA 2K4JA 4E7JA 3CD6I 2ZXJA 2R7ZJ 1YFHA 3GTJJ 4M3DA 4L0YB 2HOTA 1E0EA 4YELA 4UVCA 2VT2A 3CC2I 1W36D 3GFJA 5FD5A 3BY6A 1ZHFA 3E5QA 2J5PA 3BCBA 3FK6A 2L54A 1USTA 1JKQC 2EILH 2V6EA 3HUGA 1AOYA 1XX5A 1DP7P 2KISA 4LD5A 4RAZA 2FUG2 1XGSA 1YW9A 2LTPA 2YX4A 4D5CA 4G8XA 2ZXHA 2R7VA 1MGTA 2P0WA 4AYBA 3LSGA 3FM3A 2GIVA 1QHHD 2VJJA 1SANA 4A3LJ 1UHWA 1SAXA 1LJ9A 2BHZA 2QSGX 3MFKA 3KYLA 2IGNA 4R1HA 2LR8A 1XGMA 4I01A 3M9AA 4A0XA 3RZDJ 1QPMA 2E19A 2XIGA 4HX8A 1HLVA 1F4KA 5CLSA 3ZCOA 3BJAA 2Y0SA 2D1HA 1MBJA 2EA2A 1ETVA 1R4MB 2DU9A 2OQGA 5EEGA 2I10A 2DT5A 3I5UA 1ACIA 4V2FA 4DQ2A 2EH3A 1U9OA 4PGGA 1LDDA 3AG4H 2VJ4A 1IXCA 5DM6F 2V4JC 4M74A 2XROA 2LRDA 2HTSA 4XMYA 4EGZA 3BR1A 1XTAA 3W6JB 2O9LA 1XCVA 3U1KA 2NS8A 2LP0A 3W6KB 4RDUA 4ZJZA 1LEAA 3PNVA 1DU6A 4A0YA 4NNJA 1U3EM 2LKXA 1YLFA 3J80K 1Q1VA 3S93A 1R5HA 1T33A 3IL2A 1SMYF 1K78B 3QYBA 4BE1A 1OCTC 4UV9A 1JXSA 2K9NA 1ORKA 4X0GA 4B43A 5F04A 1IG7A 2JRTA 3BG5A 5CVUA 3TOBA 5J40A 3ZMSA 1UG0A 3FMSA 2E1OA 2L7FP 3G3ZA 2A6EF 2Y30A 4R8HA 4BQNA 1ZAOA 4YG2F 5LFAA 4FCYA 1O3TA 4L18B 2VPLA 1MJBA 3EUKL 2R0QC 3ZQHA 1IDZA 1KONA 3B49A 1LUJB 4OAZA 2WBMA 1Z3YA 4E7ZA 2F6CA 3EDPA 3TOAA 1T38A 4KISA 2RNJA 3GTLJ 3EUAA 2XB0X 4XLCA 1SD7A 4E7SA 5EZHA 5C4JJ 2RNGA 2IPQX 1WI9A 2DT6A 3LQQA 3T0YA 1T8IA 1ERDA 4FX4A 2W7NA 2DYRH 3RTRA 1UFMA 5FGMA 3HPGA 5GTIC 4L9VA 1IRGA 3P5JA 5HOOA 4FE7A 2V1DA 1A36A 1OCZH 1QO0D 4Y33A 2GBYA 3S17J 1FX7A 3EQLF 3L2CA 4B0YA 4ZTFA 1XB4A 3QU3A 4M6YA 4BHPA 4ENJA 5A2QK 4KMFA 2FNAA 3E5XA 4HF2A 1DPUA 2W85A 1WI3A 4JK1X 2QLZA 3JSOA 2FNPA 1LDJA 2KIUA 2LYCA 3KE2A 5KAIC 4IL6C 4J01A 3MZYA 1HF0A 1QZYA 4WXDA 2VXZA 1K78A 2XAFA 2P81A 3WTXC 4L5EA 1DQUA 2JT1A 4ASNA 5JHFA 2XDVA 2H6BA 2W48A 2OBPA 2F48A 2HXIA 4ZYAA 1LPQA 3HKZA 1ON2A 3I53A 1G2HA 1HKSA 2DCEA 2OCEA 4IHYA 1FP1D 3BDDA 5DM7F 2R7FA 2RV8A 5ILSA 3DKWA 1YJWI 3KYDB 3Q0UA 1G3TA 3LAJA 2ACJA 5CQEA 2H8WA 2GIZA 5EGOB 1TWCJ 2XV4S 4XBFA 4BXFA 2EJRA 3R0JA 2XF5A 5E17F 2MD5A 4DNCA 3DPTA 1I1GA 4UB8C 2NVTJ 2ELJA 4BBRJ 4ZH4F 3WODF 4PCQA 2XPWA 4IJAA 3VDXA 2R7UA 2G7HA 3J7ZI 4RMNA 1U5TB 2DDBA 2MABA 2BGCA 3VWBA 2A3SA 3SYTA 4G7OF 3KZYA 2DXIA 1EXJA 4GO1A 4EJUA 1MMDA 2AO9A 1RZ4A 3ZGKA 3CCLI 1J5YA 4QSHA 2WAEA 3O8GA 4CHUA 1Z9CA 3ZN0A 3DPLC 2X48A 5AIPA 1HW2A 3R60A 1FMVA 5FKOA 1BI2A 3R61A 2CU7A 1H88C 1XMXA 2W24A 2CO5A 3BR2A 2HS5A 2LH9A 1SC7A 3OR2C 1QVUA 2X1EA 5HDGA 3AAFA 5M5YJ 1DU0A 2JMWA 2LY2A 3OV8A 1LE8B 2KMUA 4Y13A 2CW7A 3V8KA 2ZJ2A 4ZDLA 4BDZA 2JUGA 1NK3P 2E2IJ 1T0FC 2Y9YA 2M0MA 1Z91A 1F9NA 5EGOA 1ZGWA 1Z21A 3ABKH 4IRGA 4BS9A 1SMTA 1BA5A 3BQYA 4Z6YA 3KETA 4E6KG 3E0HA 4XORA 3KX2A 1P4XA 3CCUI 4RBOA 2X9DA 2QGUA 1KQ9A 2R92J 4MO7A 3BOQA 2A69F 1OCPA 1E2XA 1U5TA 1TWAJ 1JUPA 1QZEA 4MQVA 1UB9A 3K1NA 4BDYA 4JP0A 2KRFA 4A2UA 4HNTA 2NOGA 4UUVA 4BQQA 3AFHA 2XSJC 5FFZA 4B1RA 4CZZA 2JA6J 5CVJA 2ADUA 2A5YB 3K70D 1VI0A 4RB2C 3D0SA 1TT0A 3FHNA 3HBLA 2M45A 4UVBA 3TL4X 5GAHJ 4I76A 1DDNA 1IJWC 1ZRFA 2MD0A 2K27A 1R58A 1R22A 1XSDA 2KQRA 1Z1DA 1B72B 2A61A 2IGMA 5LD2C 4UNOA 2QBYB 3C3WA 3S2HJ 1NK2P 1A04A 2E1CA 1LE8A 2ESHA 3D70A 1OR7C 4RGRA 2F4MB 2L0KA 1BL0A 4N4NB 3SDBA 1QZZA 4AU7A 1FYLA 2OQRA 3GUDA 4PDKA 3KFWX 2CGPA 5K5RA 4XSXF 5H20A 4PJ0C 1DGRM 3QQAA 3VPRA 4AC0A 3G1LA 1TW2A 2DAOA 5D5XB 5JVGF 2GM4A 3N97A 4A6EA 1MSEC 5KAFC 3CCVI 3G73A 1WFXA 4CA0A 2BXZA 4NC8A 2DMPA 2G7UA 3GO5A 3SHFA 3DP7A 1T6SA 2CUFA 1P6RA 4LB6B 4ESJA 1X3UA 1ODDA 3E1SA 1K6OA 4Y7NJ 1VQPI 1JGGA 5H2FC 3S3OA 1A6QA 3MCZA 4ZYEA 4UB6C 2EFOA 1B9NA 3LFKA 1ZYRF 3PNYA 2DBBA 2KRCA 3LFUA 4LOCA 1TTYA 3AG1H 3WU2C 2IAIA 4M3GA 2WC2A 4RAGA 1B72A 4LG3A 2WAQA 2Q0OA 5D4SA 2QBYA 3HXLA 2VOOA 3MKZA 2VJIA 2FU4A 4LLGF 3A4CA 1HOMA 4OU0A 5IYBJ 3OMYA 2DA2A 5JLWA 2WWYA 2IEKA 4NDLA 2BVMA 3W2WA 1IN8A 5LEKA 1BOAA 2IS4A 4Q5SF 1HW1A 4XKVA 1D0YA 4I0AA 3L2VA 2NNYA 2DDAA 2KIMA 2PI0A 2BY3A 4HDVA 1BOBA 1Z05A 4KYWA 3J7AO 4A3EJ 1MBGA 2X6OA 1FJLA 2LOOA 4XLAA 5J1YA 2QQAA 4C2MJ 2OPTA 2MLKA 3OL4A 4NQWB 1V55H 3ABTA 4CO8A 3V7SA 4U87A 2FF4A 4D0PA 2QEXI 4M6VA 3PNTA 5FKKA 1W7PA 2VPRA 2BBYA 2DOFA 3RPUA 2XHKA 4KT6A 3IAOA 4U0YA 5FO5A 1SFUA 3GTGJ 1ETXA 2Y75A 2W84A 3RYRA 3E6CC 2AXTC 5IP7J 2ZFUA 1ZH5A 2HVSA 4XKWA 2EZIA 1YOVB 1I50J 1MD0A 3R6SA 5E1WA 4IOCF 4XKBA 4QPQA 2D5VA 1X1PA 4PGHA 4BBSJ 1G8XA 2CFXA 1FOKA 3KZZA 1QBJA 5HVQC 3W2VA 4CXFA 4V19K 5LEJA 4P5OA 3WTUC 1LFBA 1GV5A 2HOAA 1HXDA 5K7FA 3PO2J 1REPC 3ERED 3QPTA 1BI0A 2GOXB 2ID6A 2FD5A 5F1RA 4NB5A 3EYIA 3MKWB 3A0BC 3BG7A 1XSXA 1ZLKA 4MGRA 3IWFA 1TW3A 4HRIA 2RQQA 2QSFX 2PEXA 4A3BJ 2JZYA 2VC0A 4XICA 2F4OB 3SEQA 4NQWA 2EFWA 4RB1A 1P7IA 4AUXA 2CJJA 1F43A 4M9SA 1AKHB 1WJBA 1JKOC 2E34A 2YUSA 4CCKA 2HOSA 2Z1DA 4Y52J 1W5TA 1SVOA 1CF7B 5B1AH 3WE3A 3MMYB 4A0ZA 5CYVA 1JE8A 2DW4A 1WJAA 3HGYA 3HPHA 3CJRB 3SZGA 1C0WA 3I58A 4OMZA 4I2OA 2WB1A 2R7DA 2F5VA 5HLTA 1TQIA 2KRHA 2XAUA 2DA4A 2CS3A 4I09A 1GDTA 2PMZN 1TL8A 3ECOA 3ZMZA 4HPQA 4ZDPA 2VKVA 1BOWA 4A3IJ 3ULQB 3KP2A 4EEFG 4L0ZB 4BH9A 1BBYA 1T0FA 3KLOA 3IH2A 4C3JJ 4HBLA 3S2DJ 2X51A 3R4KA 4AIDA 3LA2A 4IRHA 4CCOA 5E79C 5CQGA 3TW6A 2MC4A 3FXKA 4ESBA 1FIAA 4ZZDA 3KEOA 1N77A 1G3SA 2HI3A 1T08B 3PO3J 1CGPA 2ZSHB 1ZREA 1I3QJ 4EM2A 2CH0A 1JHFA 3ONQA 2NVYJ 3JAMK 4C30A 1J75A 1VQMI 1AKHA 3OL3A 4UV8A 1CF7A 2JQ7A 3G1MA 1SVLA 3VSKA 3CMMA 2X85A 3L00A 3IKTA 3ZMTA 4HYEA 3OYJA 3CCJI 3BTLA 5LGTA 1RI7A 2RVCA 3CESA 3M1CA 3UNGC 1UMQA 3MZ8A 3Q5FA 3HHGA 2YX7A 2DOAA 5KAUA 3GYHX 2M1BA 3DTEA 3PQKA 1CQTA 1HKQA 5ICFA 4HZFA 5CPRB 4A1MA 4UHTA 4U7DA 4O5VA 3UR3C 5LLQA 4PK4A 2GOMA 1SFKA 3LSHA 1VQ5I 2XF7A 1NH3A 3C18A 4I6ZA 2PQ8A 1OR7A 3GCMA 3SEZA 4U7BA 1GXPA 3HM5A 3KYCB 3IHUA 4HX4A 4M9XA 3HOYJ 1UZCA 1S8NA 2XGXA 1KU2A 3CMAI 1SEUA 1Z7LA 3QP5A 4V2GA 3P9CA 3MAJA 4U0VA 5F64A 3BROA 2H1LA 4G6QA 3WTWC 1VQLI 2E2JJ 2DODA 2G0EA 5IYDJ 1B8IB 1KQ8A 1ZRCA 3OYEA 3QRFF 2M87A 3PUFA 2FSWA 3RKWA 1XD7A 3PFIA 3RYPA 1S7OA 2LLKA 2DMNA 2DPUA 1X4OA 4XM3A 2CUJA 4DJAA 1MBFA 2EBIA 4BHBA 1BW5A 2JVHA 2OD5A 1S9HA 3N4MA 3Q9SA 1HQCA 2DMTA 4FT8A 2E7XA 1O4XA 5ICGA 1R49A 2E60A 2BEOA 2ELHA 2HOEA 5EZGA 1TLHB 4PFOA 5DYMA 3MEXA 1F36A 2YU9J 1RC9A 2L4AA 3TKYA 2E36A 4KN4X 1R5GA 2CV1A 4BNCA 3Q1MA 4DBRA 1JTYA 1JTXA 2V9PA 1XDUA 3OOPA 1IV6A 4O6JA 1EJ9A 2ZFWA 3H3UA 4AYZB 2ZSIB 4C2TA 1TC3C 2HYFA 2N8GA 1GVDA 3CCMI 2HZTA 1Z0XA 1EV7A 3KEQA 3W3CA 2XSDC 3P9KA 2XRLA 2HZDA 4LLNA 2UUZA 3M3YJ 5M5XJ 2Y9ZA 3TGNA 1B8IA 2CW8A 2K9MA 3BLYA 4BJTA 3WTTC 1TWGJ 5J6XA 2JUCA 2LC2A 3F8FA 5L3DA 2FX0A 1YI2I 1QQIA 1PVEA 2VBWA 2ELKA 1X3WB 1LFPA 3AG2H 1O3SA 1VF9A 1N25A 2EFNA 3JREA 1LB2A 1FBUA 1LFUP 4F92B 2O5RA 5JI6A 5BS6A 3NQOA 2DT7B 1Y8RB 3BQZA 1JYHA 1MMGA 2IRFG 3TP0A 3DEWA 2O6GE 1MH3A 4P1WA 1FTZA 2M9HA 5EJCA 5HS7A 4H0EA 1BIAA 2V1XA 4Y3OA 5FRNA 2LREA 3GZ5A 4Y4RA 3SDGA 2CQQA 3JTGA 4HDUA 1R36A 3KPHA 4M3BA 5FRMA 3QYFA 2K3FA 4BY1J 3LURA 3FXUA 2YSRA 2COMA 4HSTA 3DWLE 3GMEA 2CSOA 1ETWA 3TQNA 1T95A 3HSEA 2CYYA 2HKOA 4AYZA 2MGQA 1K4SA 2MLGA 1S29A 3H3ZA 1T39A 1SFOJ 1SVMA 1QGPA 1IN7A 3WG9A 1HSJA 2JRMA 1Z67A 2WY8Q 4P9FA 1TZLA 1IRZA 4B8XA 1OYWA 2EIJH 5B5EC 4I98B 1J0RA 4IHVA 1QVTA 1X58A 5TGTA 3LSKA 3L2UA 2R7QA 2XPUA 3K1MA 5E8GA 3ASOH 4G7HF 2LY9A 1ZLJA 1FBQA 3RDIA 3ESWB 5D5UB 2HYJA 3LWFA 3PQJA 4II3A 3I64A 1KQ0A 4X1EA 3GXOA 1ZK8A 3OY9A 2MH9A 4EATA 3HOZJ 2EA4A 5K5QA 4E7HA 2BY2A 4HV5A 4YFKF 1PP7U 2GOVA 2DFHA 1VQ7I 2TCTA 2IW5A 3IAM2 1DUXC 4KN7X 1D5VA 2Y2ZA 3VYSB 3P9IA 2K40A 4E7KA 4CCLA 2Z3YA 2Q8KA 3G4SI 1OCRH 2KJCA 1AHDP 5FD6A 2EWNA 3FXMA 4CDGA 2X4HA 1IXRC 2IXSA 5KCMA 1KU9A 1POGA 1B1BA 5BQTA 2Z9OA 2GXBA 1EKEA 5LHGA 4BHCA 5L3EA 3D6YA 3H5NA 1ENHA 2KP6A 3GF2A 1YW8A 1OPCA 3B6CA 2PLYA 3DXJF 3C1DA 2V9VA 1NG6A 3NWSA 4B4CA 3JR9A 4HQMA 3QWLA 4KMUX 1JKRC 4M3FA 5LHIA 2PFBA 3L09A 1G59A 2DLLA 1VTNC 5ILVA 2QCOA 3F8CA 1WVRA 1XDSA 1D0ZA 1D8KA 2PX9A 4KA4A 2EIKH 3F8NA 4XNFA 2NS7A 3O2PE 2Y48A 3MWMA 2QYOA 2NYXA 3FK7A 3HC7A 4K2EA 1SAUA 5LGNA 2R3SA 5HDKA 1V4RA 2DA1A 1ETYA 5J1RA 3QP6A 3BZ6A 3CCEI 1R9TJ 4N0BA 1PYVA 3QOEA 3O6BB 3KCCA 4IHWA 5GPCA 2K9LA 1OCOH 5E1XA 3JRGA 4IQ4A 3JRDA 2ME0A 2L7KA 2VBXA 4Z2YA 1FOWA 1RPWA 2LSOA 4KJZA 3O8HA 3DFGA 3FDYA 2QKLB 2AS5F 1U9NA 4ESFA 3FBIB 2QA4I 1SD4A 4ANJA 2O7OA 3KP3A 3UKGA 1IN5A 1TP4A 3RQ4A 4IOAF 3QPHA 4PJLA 1R1UA 3FHZA 5HODA 1S6LA 1D1AA 1JJ8C 3S3MA 2L4MA 5J4YA 2G9WA 5KAXA 1Z7UA 2A5WA 4ZYHA 1YX5A 5FLXZ 1YITI 4B47A 2Y31A 2CW0F 2DMQA 2L01A 1AU7A 3HOUJ 3OR1C 3PFYA 1WQ2A 2D2WA 1FLIA 1VFCA 3NARA 2CQ7A 2HQNA 3DCFA 2E7WA 2VJ5A 1X2NA 3KIOA 2RKHA 2ZKZA 1RUOA 2DN0A 3T8RA 2M2EA 3IUOA 4LIUA 3OYAA 1ZGAA 3F3XA 3M8EA 3CCQI 3DU6A 5KAVA 4WF2A 1OISA 4WX9A 4WXCA 3RZOJ 3D5SC 5HNHA 3WHCA 1U2WA 4XR6A 3HRSA 3WE2A 1WJCA 3F22A 3GTPJ 2F2EA 3OIPA 4XLPF 4RLFA 1Y6IA 3X2QH 4G94A 4DBQA 5ILUA 4D7MA 5F08A 3KEYA 1L3LA 2H8RA 5ERIA 3QU6A 3SQNA 2WY7Q 2COBA 3OIOA 5K1YA 5D8LB 3PL8A 5LHHA 1WHUA 4CYCB 1I6XA 1YJNI 3W2AA 2L2OA 1OQYA 3I59B 1FNNA 3REOA 5EEAA 2CQNA 2CWEA 1YHQI 5C4XJ 4P9UA 2DO7A 4XLHA 3QPLA 1GV2A 3NRVA 3VB2A 2EINH 3B02A 3H0DA 4GDFA 3DPUA 3CC7I 4F7ZA 1TWFJ 3OS1A 3J81K 2O0YA 3QPSA 4FASD 5E3NA 3K69A 5IT9K 1I1SA 4ABZA 1MBEA 4KDPA 3AL0C 2A05A 2DFEA 5FROA 1JT6A 3FKIJ 4PFPA 2VIXA 4MEYF 3ZPLA 2L02A 3FXOA 4FTHA 4ZZLA 1FMWA 1H0MA 2IBDA 4JBAA 3FXRA 1Z77A 1WH5A 3BR5A 3F21A 5CJ9A 3C2GA 5BPDA 1X4PA 4DZPA 3PM1A 1IUFA 1WPKA 3RCOA 1IRFA 2TRTA 2KJBA 2R7WA 1Y39A 1K6YA 2PBIA 1OLTA 4C9YA 4ON0A 2FXAA 3LSMA 2P8TA 2BY1A 4IVNA 1XPXA 1Y56A 2IT0A 2EK5A 1N78A 1YIJI 3BTJA 1KA8A 2W57A 4XRSG 2YPRA 1JI8A 2XAGA 1FTTA 2HDWA 2ECBA 3EUHC 2ZCWA 3WTVC 2JA2A 1TQPA 4CYCA 5IP9J 1B59A 3MKYB 3WTZA 2BXYA 4CCMA 2IGKA 4MFEA 3I59A 1E17A 4GYGA 2DA3A 2PN6A 3HRMA 3ZRGA 2VONA 2HQ5A 5L3FA 3CDHA 1NHAA 3DEUA 2JTVA 2QQ9A 4LIVA 5F0CA 2LVSA 5KK1A 2RQPA 3O3KA 1FZPB 1QU3A 2R7XA 3F0CA 3IRRA 4DYRA 4KICA 5D8KB 4E4HA 1FT9A 2CV0A 2KL4A 2KIQA 3TEDA 4XKCA 4ENKA 3OYKA 2EQRA 2GAUA 1YX3A 4XN3A 2XKOA 1T56A 3WGHA 2Q2EB 3JRCA 4EJOA 1T98A 2GXAA 3R8KA 3FIWA 1FC3A 4BXUA 2HGCA 5JHUA 1WJ5A 3LL7A 1S7EA 1MH4A 2CUZA 1W7PB 3SZTA 2KCUA 5BPIA 3M8JA 4MLOA 3SFIA 3TO7A 2CQKA 2HFHA 2CFOA 4EJVA 3S1RJ 3FXJA 1AA7A 1WSUA 1K83J 2PMZA 2EIMH 2IGOA 2JSCA 2EFPA 1H8AC 3J80Z 2ISZA 2HWVA 1R1VA 5C44J 4D1QA 5FJ8J 4F52A 3ABUA 5ED4A 2XB5A 3CJNA 3RKQA 3BR0A 3DEEA 4A12A 3TO9A 1D5YA 2STTA 4HF1A 4CGZA 3VEPA 2BHYA 3T5XA 4RAYA 1HW5A 4P96A 1V5GA 3BJOA 1OCCH 2D1VA 3CLQA 5DDGA 3GBGA 2OC6A 4RS8A 1HSTA 1V5EA 2P4WA 2UXNA 5F1JA 3FX3A 2Q2EA 2NXNB
chains in the Genus database with same CATH topology
3MN2A 1WH7A 3BR1A 4A1MA 1RKWA 2O9LA 2NS8A 2LP0A 4RDUA 4I6ZA 2FJ1A 1DU6A 3HM5A 4BKXA 2LK2A 3HOYJ 1JT0A 2LKXA 1Q1VA 2JWTA 1T33A 4V2GA 4JYKA 4A3JJ 2NVQJ 1MNMC 1ETOA 1OCTC 2E2JJ 2G0EA 1MBKA 2K9NA 3M4OJ 5IYDJ 1ORKA 1B8IB 1IG7A 5F04A 3BG5A 4DYQA 1Y1VJ 2XGCA 4B3AA 2E1OA 2LLKA 2L7FP 2DMNA 3Q0VA 2Y30A 1A5JA 1PUFB 3HGGA 4FCYA 2R5ZB 4M3EA 2R0QC 1MBFA 2EBIA 3ZQHA 3LSPA 2JA7J 5K7ZA 5FLMJ 4JX4A 1IDZA 3B49A 2RAEA 4QTRA 4A3KJ 1BW5A 3JRBA 4IHXA 2DMTA 3GTLJ 2EZLA 2XB0X 1O4XA 5C4JJ 5EZHA 4JX5A 5EZGA 1F36A 4A3MJ 2YU9J 2DA5A 1U78A 1HCRA 4FE7A 3Q1MA 2GBYA 3S17J 1JTYA 1JTXA 2CRGA 4B0YA 3A03A 1IV6A 3HKZN 4MFDA 1XC5A 1I6HJ 4AYZB 1X2MA 1WI3A 3HB9A 2N8GA 1GVDA 1Z0XA 5E3LA 3ZQCA 2XSDC 1HF0A 2XRLA 3GK6A 2M0CA 2HDDA 2P81A 3M3YJ 5M5XJ 2Y9ZA 4L5EA 5M5WJ 3WHBA 1B8IA 2W48A 1TWGJ 2HXIA 3MVPA 2FX0A 1RKTA 4XK4A 1ZR4A 3GTMJ 2ELKA 1PUFA 4IHYA 2R5ZA 2M8GX 1G2HA 1EXIA 1VF9A 3JREA 1LFUP 3JRAA 3H0GJ 1JKPC 3BQZA 1JYHA 3TP0A 5EYRA 3DEWA 1MH3A 3HDDA 2WAQN 3Q0UA 2M9HA 1FTZA 1OJLA 5M3FJ 3K7AJ 5EGOB 5DTDA 1TWCJ 3SDGA 2CQQA 1EF4A 3NAUA 5EF6A 4IEJA 4M3BA 1HDPA 1MBHA 4BY1J 3LURA 3Q0WA 2NVTJ 3OSFA 4QIWN 3CCYA 3TP3A 4BBRJ 1U8BA 1BW6A 1ETWA 2XPWA 5GQQA 4G12A 2JA8J 3JRHA 1IGNA 2MGQA 4AYZA 5KAWA 3C2BA 1Y1WJ 2BOWA 1EXJA 1SFOJ 2HVAA 5JLXA 2AO9A 1IRZA 1ETQA 5FLVA 4QSHA 3O8GA 1W0UA 5EG0B 2X48A 5FKOA 4IHVA 1QVTA 1X58A 2CU7A 1H88C 2XPUA 2LY9A 3S16J 3BR2A 3Q3SA 3Q5RA 2HYJA 1QVUA 5BNGA 4X1EA 5GPAA 1W0TA 4FE4A 5M5YJ 1ZK8A 1XS9A 1DU0A 2JMWA 3HOZJ 1APLC 1LE8B 1JUMA 3ZQFA 5DS9A 3BTCA 1NK3P 2E2IJ 2H1KA 3I4NJ 2Y9YA 3MKLA 2GOVA 2TCTA 5EGOA 1ZGWA 2Y2ZA 1AHDP 2K40A 3LOCA 1BA5A 3BQYA 2L9RA 2VKEA 3E0HA 1GT0C 3A02A 1IDYA 4XRSA 1POGA 2XGDA 5GP9A 4RBOA 2X9DA 4J19A 3OSGA 3IH3A 4FISA 2VUMJ 2L7MP 3JRFA 3D6YA 2KDZA 1ENHA 2R92J 4MO7A 3B6CA 3Q5SA 1OCPA 3Q3DA 1TWAJ 1JUPA 4B4CA 3JR9A 4JP0A 1JKRC 2NOGA 4M3FA 3BG9A 2B63J 2EZKA 3BTIA 4B1RA 5J1UA 3S14J 4A3CJ 2JA6J 2QCOA 1VI0A 2ME6A 2ZB9A 4BY7J 5EG0A 3HBLA 3W6VA 1BJZA 2O8KA 1ITYA 2CUEA 2NS7A 1GUUA 2JN6A 2R5YB 4I76A 1MSFC 5KCBA 1IJWC 2CQXA 3FK7A 2HXOA 5J3LA 3HOWJ 2DA1A 1B72B 4UUTA 3LNQA 1ETYA 5J1RA 2JA5J 3S2HJ 1NK2P 1R9TJ 1LE8A 4DW6A 3D70A 4HNVA 4IHWA 2EZHA 5GPCA 3CDLA 3S15J 3SJMA 3JRGA 4DYCA 4A3DJ 3JRDA 2ECCA 2L0KA 2ME0A 1BL0A 1RETA 1RPWA 1UG2A 5IOYA 3S1NJ 3O8HA 9ANTA 2XPVA 1U9NA 3GTQJ 1NTCA 5E3MA 3QQAA 3VPRA 2O7OA 4AC0A 3G1LA 5EDNA 5M3MJ 3UKGA 2GM4A 3S1QJ 1WGXA 1MSEC 5F0FA 3LSJA 1FIPA 2WV1A 1ZR2A 3TW7A 1YRNB 5HODA 2L7ZA 1JJ8C 2DMPA 2GLOA 5KAXA 3Q5PA 3S1MJ 2CUFA 4XIDA 1JJ6C 2Y31A 4Y7NJ 2DMQA 3HOUJ 1AU7A 1JGGA 2DA7A 1WCMJ 2R5YA 1VFCA 3NARA 3DCFA 3HEFA 4W1UA 4X6AJ 1E3OC 2ID3A 4LOCA 1X2NA 2IAIA 2DN0A 4M3GA 5FKMA 2M2EA 1B72A 1HDDC 5KAVA 3RZOJ 4XRMA 1HOMA 1VNDA 4A3GJ 5IYBJ 3WHCA 1A6IA 3A01B 3GTPJ 2DA2A 3I4MJ 5JLWA 2IEKA 2DJNA 3GTKJ 4MIMA 4A93J 4NDLA 2JJ7A 3Q2YA 4D7MA 5F08A 4UUSB 1OFCX 4D5FA 4GFBA 1FEXA 2MG4A 2H8RA 5IYCJ 2COBA 3OIOA 5IPAA 3B6AA 4CYCB 3BR3A 3H3VK 1ETKA 4A3EJ 1MBGA 2X6OA 1FJLA 2AHQA 3RQIA 2K9SA 2YS9A 5J1YA 4A69C 1YRNA 5EEAA 4C2MJ 2OPTA 5C4XJ 3ZQLA 3QPLA 1GV2A 1ZTRA 1QRYA 3CMYA 1TWFJ 4BXXJ 4M6VA 3QPSA 5E3NA 3GTOJ 3IH4A 5FKKA 2KT0A 2VPRA 4ABZA 3BR6A 1MBEA 3IAOA 3G1OA 2LFBA 3JRIA 3GTGJ 5KATA 1ETXA 2DMUA 1JT6A 5IP7J 3FKIJ 1H89C 3CQZJ 2EZIA 1I50J 4FTHA 2NVXJ 3OOUA 2IBDA 5F27A 2D5VA 2MW8A 1Z77A 3BR5A 1WH5A 1TC3C 2OF7A 4BBSJ 4A3FJ 4DZPA 3A01A 3PM1A 1IUFA 1WPKA 5IP6A 2TRTA 1LFBA 1GV5A 2HOAA 2K9QA 5F0HA 4UUSA 5K7FA 3PO2J 4C3IJ 3BT9A 2QF7A 2ID6A 2FD5A 3BTJA 4XRSG 1FTTA 2ECBA 3L1PA 2WB1N 4CYCA 5C3EJ 5IP9J 4C3HJ 2MSYA 2XGEA 2DA6A 5IOZA 4MFEA 1XG1A 2JK3A 4A3BJ 4XICA 2DTZA 4W97A 2DA3A 3BG3A 2HQ5A 2E2HJ 1P7IA 5FKNA 3D71A 1RESA 5F0CA 4AUXA 2CJJA 2LVSA 3K2AA 4D7NA 3IV5A 1K61A 1AKHB 1F43A 3D6ZA 1JKOC 4Y52J 2YUSA 5K7HA 2HOSA 4DZJA 3E7LA 3F0CA 4DYRA 3ZQIA 3HGYA 2R7ZJ 3GTJJ 4AYBN 4M3DA 2HOTA 3TEDA 3LSRA 2EQRA 3R8JA 2M34A 2DA4A 3FK6A 1GDTA 1T56A 2PMZN 3JRCA 1JKQC 3R8KA 3FIWA 2VKVA 1BOWA 1UHSA 4A3IJ 1ZKGA 1S7EA 4EEFG 1MH4A 2VI6A 2LTPA 3FISA 4D5CA 2KCUA 2R93J 3IH2A 2Y0SN 4C3JJ 1ZQ3P 1TWHJ 4MLOA 3LSGA 3SFIA 3S2DJ 1QPIA 1SANA 4A3LJ 3S1RJ 1K83J 3TW6A 1H8AC 1FIAA 1P7JA 2HI3A 5C44J 2LR8A 5FJ8J 3PO3J 1JUSA 1I3QJ 3D1NI 2LD5A 2XB5A 3RZDJ 2E19A 3ZOBA 2NVYJ 1HLVA 3HOVJ 1R8EA 2FQ4A 3RKQA 1AKHA 1MBJA 3BR0A 5FKLA 1D5YA 1ETVA 3G1MA 2I10A 1IC8A 4V2FA 5E3OA 2EH3A 3BTLA 1U9OA 1UMQA 3ZQGA 3HOXJ 3GBGA 1RR7A 5KAUA 5F1JA 4JX6A 1CQTA 4S0HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MN2 A;  1WH7 A;  3BR1 A;  4A1M A;  1RKW A;  2O9L A;  2NS8 A;  2LP0 A;  4RDU A;  4I6Z A;  2FJ1 A;  1DU6 A;  3HM5 A;  4BKX A;  2LK2 A;  3HOY J;  1JT0 A;  2LKX A;  1Q1V A;  2JWT A;  1T33 A;  4V2G A;  4JYK A;  4A3J J;  2NVQ J;  1MNM C;  1ETO A;  1OCT C;  2E2J J;  2G0E A;  1MBK A;  2K9N A;  3M4O J;  5IYD J;  1ORK A;  1B8I B;  1IG7 A;  5F04 A;  3BG5 A;  4DYQ A;  1Y1V J;  2XGC A;  4B3A A;  2E1O A;  2LLK A;  2L7F P;  2DMN A;  3Q0V A;  2Y30 A;  1A5J A;  1PUF B;  3HGG A;  4FCY A;  2R5Z B;  4M3E A;  2R0Q C;  1MBF A;  2EBI A;  3ZQH A;  3LSP A;  2JA7 J;  5K7Z A;  5FLM J;  4JX4 A;  1IDZ A;  3B49 A;  2RAE A;  4QTR A;  4A3K J;  1BW5 A;  3JRB A;  4IHX A;  2DMT A;  3GTL J;  2EZL A;  2XB0 X;  1O4X A;  5C4J J;  5EZH A;  4JX5 A;  5EZG A;  1F36 A;  4A3M J;  2YU9 J;  2DA5 A;  1U78 A;  1HCR A;  4FE7 A;  3Q1M A;  2GBY A;  3S17 J;  1JTY A;  1JTX A;  2CRG A;  4B0Y A;  3A03 A;  1IV6 A;  3HKZ N;  4MFD A;  1XC5 A;  1I6H J;  4AYZ B;  1X2M A;  1WI3 A;  3HB9 A;  2N8G A;  1GVD A;  1Z0X A;  5E3L A;  3ZQC A;  2XSD C;  1HF0 A;  2XRL A;  3GK6 A;  2M0C A;  2HDD A;  2P81 A;  3M3Y J;  5M5X J;  2Y9Z A;  4L5E A;  5M5W J;  3WHB A;  1B8I A;  2W48 A;  1TWG J;  2HXI A;  3MVP A;  2FX0 A;  1RKT A;  4XK4 A;  1ZR4 A;  3GTM J;  2ELK A;  1PUF A;  4IHY A;  2R5Z A;  2M8G X;  1G2H A;  1EXI A;  1VF9 A;  3JRE A;  1LFU P;  3JRA A;  3H0G J;  1JKP C;  3BQZ A;  1JYH A;  3TP0 A;  5EYR A;  3DEW A;  1MH3 A;  3HDD A;  2WAQ N;  3Q0U A;  2M9H A;  1FTZ A;  1OJL A;  5M3F J;  3K7A J;  5EGO B;  5DTD A;  1TWC J;  3SDG A;  2CQQ A;  1EF4 A;  3NAU A;  5EF6 A;  4IEJ A;  4M3B A;  1HDP A;  1MBH A;  4BY1 J;  3LUR A;  3Q0W A;  2NVT J;  3OSF A;  4QIW N;  3CCY A;  3TP3 A;  4BBR J;  1U8B A;  1BW6 A;  1ETW A;  2XPW A;  5GQQ A;  4G12 A;  2JA8 J;  3JRH A;  1IGN A;  2MGQ A;  4AYZ A;  5KAW A;  3C2B A;  1Y1W J;  2BOW A;  1EXJ A;  1SFO J;  2HVA A;  5JLX A;  2AO9 A;  1IRZ A;  1ETQ A;  5FLV A;  4QSH A;  3O8G A;  1W0U A;  5EG0 B;  2X48 A;  5FKO A;  4IHV A;  1QVT A;  1X58 A;  2CU7 A;  1H88 C;  2XPU A;  2LY9 A;  3S16 J;  3BR2 A;  3Q3S A;  3Q5R A;  2HYJ A;  1QVU A;  5BNG A;  4X1E A;  5GPA A;  1W0T A;  4FE4 A;  5M5Y J;  1ZK8 A;  1XS9 A;  1DU0 A;  2JMW A;  3HOZ J;  1APL C;  1LE8 B;  1JUM A;  3ZQF A;  5DS9 A;  3BTC A;  1NK3 P;  2E2I J;  2H1K A;  3I4N J;  2Y9Y A;  3MKL A;  2GOV A;  2TCT A;  5EGO A;  1ZGW A;  2Y2Z A;  1AHD P;  2K40 A;  3LOC A;  1BA5 A;  3BQY A;  2L9R A;  2VKE A;  3E0H A;  1GT0 C;  3A02 A;  1IDY A;  4XRS A;  1POG A;  2XGD A;  5GP9 A;  4RBO A;  2X9D A;  4J19 A;  3OSG A;  3IH3 A;  4FIS A;  2VUM J;  2L7M P;  3JRF A;  3D6Y A;  2KDZ A;  1ENH A;  2R92 J;  4MO7 A;  3B6C A;  3Q5S A;  1OCP A;  3Q3D A;  1TWA J;  1JUP A;  4B4C A;  3JR9 A;  4JP0 A;  1JKR C;  2NOG A;  4M3F A;  3BG9 A;  2B63 J;  2EZK A;  3BTI A;  4B1R A;  5J1U A;  3S14 J;  4A3C J;  2JA6 J;  2QCO A;  1VI0 A;  2ME6 A;  2ZB9 A;  4BY7 J;  5EG0 A;  3HBL A;  3W6V A;  1BJZ A;  2O8K A;  1ITY A;  2CUE A;  2NS7 A;  1GUU A;  2JN6 A;  2R5Y B;  4I76 A;  1MSF C;  5KCB A;  1IJW C;  2CQX A;  3FK7 A;  2HXO A;  5J3L A;  3HOW J;  2DA1 A;  1B72 B;  4UUT A;  3LNQ A;  1ETY A;  5J1R A;  2JA5 J;  3S2H J;  1NK2 P;  1R9T J;  1LE8 A;  4DW6 A;  3D70 A;  4HNV A;  4IHW A;  2EZH A;  5GPC A;  3CDL A;  3S15 J;  3SJM A;  3JRG A;  4DYC A;  4A3D J;  3JRD A;  2ECC A;  2L0K A;  2ME0 A;  1BL0 A;  1RET A;  1RPW A;  1UG2 A;  5IOY A;  3S1N J;  3O8H A;  9ANT A;  2XPV A;  1U9N A;  3GTQ J;  1NTC A;  5E3M A;  3QQA A;  3VPR A;  2O7O A;  4AC0 A;  3G1L A;  5EDN A;  5M3M J;  3UKG A;  2GM4 A;  3S1Q J;  1WGX A;  1MSE C;  5F0F A;  3LSJ A;  1FIP A;  2WV1 A;  1ZR2 A;  3TW7 A;  1YRN B;  5HOD A;  2L7Z A;  1JJ8 C;  2DMP A;  2GLO A;  5KAX A;  3Q5P A;  3S1M J;  2CUF A;  4XID A;  1JJ6 C;  2Y31 A;  4Y7N J;  2DMQ A;  3HOU J;  1AU7 A;  1JGG A;  2DA7 A;  1WCM J;  2R5Y A;  1VFC A;  3NAR A;  3DCF A;  3HEF A;  4W1U A;  4X6A J;  1E3O C;  2ID3 A;  4LOC A;  1X2N A;  2IAI A;  2DN0 A;  4M3G A;  5FKM A;  2M2E A;  1B72 A;  1HDD C;  5KAV A;  3RZO J;  4XRM A;  1HOM A;  1VND A;  4A3G J;  5IYB J;  3WHC A;  1A6I A;  3A01 B;  3GTP J;  2DA2 A;  3I4M J;  5JLW A;  2IEK A;  2DJN A;  3GTK J;  4MIM A;  4A93 J;  4NDL A;  2JJ7 A;  3Q2Y A;  4D7M A;  5F08 A;  4UUS B;  1OFC X;  4D5F A;  4GFB A;  1FEX A;  2MG4 A;  2H8R A;  5IYC J;  2COB A;  3OIO A;  5IPA A;  3B6A A;  4CYC B;  3BR3 A;  3H3V K;  1ETK A;  4A3E J;  1MBG A;  2X6O A;  1FJL A;  2AHQ A;  3RQI A;  2K9S A;  2YS9 A;  5J1Y A;  4A69 C;  1YRN A;  5EEA A;  4C2M J;  2OPT A;  5C4X J;  3ZQL A;  3QPL A;  1GV2 A;  1ZTR A;  1QRY A;  3CMY A;  1TWF J;  4BXX J;  4M6V A;  3QPS A;  5E3N A;  3GTO J;  3IH4 A;  5FKK A;  2KT0 A;  2VPR A;  4ABZ A;  3BR6 A;  1MBE A;  3IAO A;  3G1O A;  2LFB A;  3JRI A;  3GTG J;  5KAT A;  1ETX A;  2DMU A;  1JT6 A;  5IP7 J;  3FKI J;  1H89 C;  3CQZ J;  2EZI A;  1I50 J;  4FTH A;  2NVX J;  3OOU A;  2IBD A;  5F27 A;  2D5V A;  2MW8 A;  1Z77 A;  3BR5 A;  1WH5 A;  1TC3 C;  2OF7 A;  4BBS J;  4A3F J;  4DZP A;  3A01 A;  3PM1 A;  1IUF A;  1WPK A;  5IP6 A;  2TRT A;  1LFB A;  1GV5 A;  2HOA A;  2K9Q A;  5F0H A;  4UUS A;  5K7F A;  3PO2 J;  4C3I J;  3BT9 A;  2QF7 A;  2ID6 A;  2FD5 A;  3BTJ A;  4XRS G;  1FTT A;  2ECB A;  3L1P A;  2WB1 N;  4CYC A;  5C3E J;  5IP9 J;  4C3H J;  2MSY A;  2XGE A;  2DA6 A;  5IOZ A;  4MFE A;  1XG1 A;  2JK3 A;  4A3B J;  4XIC A;  2DTZ A;  4W97 A;  2DA3 A;  3BG3 A;  2HQ5 A;  2E2H J;  1P7I A;  5FKN A;  3D71 A;  1RES A;  5F0C A;  4AUX A;  2CJJ A;  2LVS A;  3K2A A;  4D7N A;  3IV5 A;  1K61 A;  1AKH B;  1F43 A;  3D6Z A;  1JKO C;  4Y52 J;  2YUS A;  5K7H A;  2HOS A;  4DZJ A;  3E7L A;  3F0C A;  4DYR A;  3ZQI A;  3HGY A;  2R7Z J;  3GTJ J;  4AYB N;  4M3D A;  2HOT A;  3TED A;  3LSR A;  2EQR A;  3R8J A;  2M34 A;  2DA4 A;  3FK6 A;  1GDT A;  1T56 A;  2PMZ N;  3JRC A;  1JKQ C;  3R8K A;  3FIW A;  2VKV A;  1BOW A;  1UHS A;  4A3I J;  1ZKG A;  1S7E A;  4EEF G;  1MH4 A;  2VI6 A;  2LTP A;  3FIS A;  4D5C A;  2KCU A;  2R93 J;  3IH2 A;  2Y0S N;  4C3J J;  1ZQ3 P;  1TWH J;  4MLO A;  3LSG A;  3SFI A;  3S2D J;  1QPI A;  1SAN A;  4A3L J;  3S1R J;  1K83 J;  3TW6 A;  1H8A C;  1FIA A;  1P7J A;  2HI3 A;  5C44 J;  2LR8 A;  5FJ8 J;  3PO3 J;  1JUS A;  1I3Q J;  3D1N I;  2LD5 A;  2XB5 A;  3RZD J;  2E19 A;  3ZOB A;  2NVY J;  1HLV A;  3HOV J;  1R8E A;  2FQ4 A;  3RKQ A;  1AKH A;  1MBJ A;  3BR0 A;  5FKL A;  1D5Y A;  1ETV A;  3G1M A;  2I10 A;  1IC8 A;  4V2F A;  5E3O A;  2EH3 A;  3BTL A;  1U9O A;  1UMQ A;  3ZQG A;  3HOX J;  3GBG A;  1RR7 A;  5KAU A;  5F1J A;  4JX6 A;  1CQT A;  4S0H B; 
#chains in the Genus database with same CATH topology
 3MN2 A;  3G6E I;  1V5F A;  4YII A;  1OMI A;  1RKW A;  4PUS A;  4A6D A;  1K7A A;  2O8X A;  3ZMU A;  3IC7 A;  4M6X A;  3CUQ C;  2QKM B;  2FJ1 A;  1BI1 A;  1YW7 A;  4RGS A;  1QA6 A;  3TDZ C;  3GFI A;  1YS7 A;  4BKX A;  2LK2 A;  2M30 A;  5DV5 A;  5KNL A;  1JT0 A;  3LMM A;  2O03 A;  2JWT A;  4LB5 A;  5A2Q Z;  1IXS B;  2FEZ A;  2UV1 A;  4A3J J;  4AIH A;  2MFZ A;  3WU1 B;  1MNM C;  1ETO A;  2ISY A;  2GWR A;  1WJD A;  1MBK A;  3ISP A;  1VQ6 I;  1MMN A;  5HLI A;  2HTJ A;  2VT3 A;  4DYQ A;  3HTS B;  4PSX A;  1Y1V J;  3GX4 X;  4XSZ F;  4LGW A;  3S3N A;  4XLN F;  3RSN A;  4B3A A;  1YTY A;  3ZP5 A;  3Q0V A;  1ON1 A;  1A5J A;  3GVA A;  2M7A A;  2R5Z B;  2ICW G;  1EH7 A;  3GFM A;  1EH6 A;  2V6C A;  2JA7 J;  2BOL A;  1UCR A;  5K7Z A;  1O3Q A;  3PUB A;  1IN4 A;  2RAE A;  1R1T A;  4QTR A;  2STW A;  3JRB A;  1ULY A;  3G2B A;  1UHM A;  3CCS I;  2NOJ B;  2DK8 A;  1FOX A;  1YIO A;  3FXL A;  4E70 A;  3A2K A;  4RAF A;  3TMO A;  4PZJ A;  3D5L A;  1USS A;  2HVR A;  2X0L A;  2V7F A;  2DA5 A;  1U78 A;  2WAF A;  1HCR A;  3I9V 2;  1Q1H A;  4YIR X;  2GA2 A;  2I5U A;  2CRG A;  3A03 A;  2M8E A;  1P4W A;  2HQA A;  4NC6 A;  1PUE E;  4B3X A;  4YFX F;  4Q47 A;  2WTE A;  3C7J A;  5GAE J;  3HB9 A;  5B3S H;  3PIO F;  5K5O A;  4EJT A;  4NBQ A;  5E3L A;  2XF6 A;  2K02 A;  3OYI A;  2RGV A;  3GK6 A;  4WCG A;  3HZJ A;  3H9Q A;  3WHB A;  1S3J A;  2K86 A;  1UEL B;  3F9K A;  5L3G A;  3CME I;  1U6G A;  3MVP A;  2O3F A;  2NRA C;  1RKT A;  1BC8 C;  3E5U A;  3GTM J;  1EXI A;  1MND A;  2R5Z A;  3HOS A;  3HIF A;  3JRA A;  2F5D A;  1VZ0 A;  5EYR A;  3AKZ A;  4HQE A;  2B0L A;  2P6T A;  2MYS A;  2A07 F;  2BY0 A;  2WAQ N;  3HDD A;  4OIP F;  1FSH A;  1P92 A;  4B48 A;  2V79 A;  4G9Y A;  5M3F J;  3ELK A;  3K0L A;  4KIT B;  1EF4 A;  2LNB A;  2H6C A;  2M4G A;  4IEJ A;  4IHT A;  4AIK A;  1HDP A;  1FYM A;  2VE8 A;  1KU7 A;  2EB7 A;  3DBL B;  1HC8 A;  3Q0W A;  4GYI A;  5J4V A;  3OSF A;  4QIW N;  2EV0 A;  2FRH A;  1KU3 A;  3NEU A;  3HL2 A;  3C2H A;  4ENM A;  5F6F A;  3E97 A;  3MZH A;  1VQ8 I;  1BJA A;  2KHM A;  4B09 A;  1ZG5 A;  4ZDO A;  2A6T A;  1ETQ A;  5FLV A;  3WTY C;  3KLN A;  2DQL A;  4IO9 F;  1VQ4 I;  3EUH A;  1ZEL A;  4RGU A;  4FHT A;  1V54 H;  2ZJR F;  3BPX A;  2LY1 A;  4KT5 C;  3U1D A;  2OZ6 A;  3JTH A;  4FET A;  3S16 J;  2DTR A;  1R6R A;  2VQG A;  1HBX G;  2P5K A;  4MTD A;  5BNG A;  1W0T A;  4KUM A;  4FE4 A;  4YFN F;  4JOM A;  2GQQ A;  2JVG A;  1X1C A;  1YS6 A;  2K5C A;  1APL C;  1SD5 A;  4I0B A;  2O61 A;  1JUM A;  2J5O A;  2PMH A;  2EPF A;  3BTC A;  2BYV E;  2H1K A;  3MKL A;  5IY5 H;  4B44 A;  1WWX A;  2FBH A;  4RB0 A;  3LOC A;  2VKE A;  5B66 C;  1Z3X A;  2Y69 H;  2IA2 A;  3A02 A;  3GZN B;  4XRS A;  4ZTJ A;  4PJJ A;  2QQ8 A;  2XGD A;  3KZI C;  2VE9 A;  2L7M P;  2XAQ A;  4WWC A;  2KDZ A;  2F5E A;  2M4K A;  2E1M C;  1W36 C;  3Q5S A;  3Q3D A;  3CUQ B;  5BOX A;  1HKT A;  4N9I A;  3F8M A;  2EZK A;  2VBZ A;  2FBK A;  3BTI A;  2B63 J;  3KP6 A;  3S14 J;  4A3C J;  2QM3 A;  3TDU C;  3CZ6 A;  4GGG A;  4BY7 J;  2JSP A;  1BJZ A;  4GRI A;  2CUE A;  1GUU A;  2JN6 A;  2K85 A;  1MSF C;  4AVP A;  1STZ A;  1IUY A;  5KCB A;  4HV6 A;  2CQX A;  6PAX A;  4BL0 B;  4HOB A;  4BJ6 C;  3HOW J;  5DEQ A;  2F4I A;  1PDN C;  4IX7 A;  4UUT A;  3LNQ A;  4MQ9 F;  5DCM B;  3GLL A;  1LEB A;  3L2W A;  1VQ9 I;  1X1D A;  2JA5 J;  2P7C B;  4BJ5 C;  3K10 A;  4IQJ A;  4DW6 A;  2IS2 A;  5DD4 A;  1ZG1 A;  2ZJP F;  4BE0 A;  1D1C A;  1LKX A;  2Z2S B;  4RM2 A;  4HNV A;  1O3R A;  4ZYG A;  3BC8 A;  2VXD A;  3SFZ A;  4BU2 A;  1R23 A;  3CDL A;  4HA8 A;  1Y0U A;  4A3D J;  1ZG3 A;  2ECC A;  4LK0 F;  3ERM A;  2LF7 A;  3COA C;  1UG2 A;  4KNY A;  5IOY A;  3LSI A;  3S1N J;  2QUF A;  3RI4 A;  2LMD A;  2VOP A;  2XPV A;  5AON A;  1VQO I;  2FOW A;  1V3F A;  2C6Y A;  2VOD A;  5CVI A;  5E3M A;  3CO6 C;  1SFE A;  5M3M J;  3WG7 H;  3S1Q J;  1WGX A;  4OIR F;  1FSE A;  5IT3 A;  2BW3 A;  4KIG A;  5F0F A;  3LST A;  1J59 A;  2GXG A;  1FIP A;  2WV1 A;  1ZR2 A;  2L7Z A;  3CUQ A;  3MQ0 A;  3ML6 A;  2R7T A;  1XMK A;  2DPD A;  3S1M J;  3RIR A;  3QAH A;  2VLA A;  1U5T C;  3T8T A;  1JJ6 C;  1KYW A;  3CDI A;  1J7K A;  3N05 A;  2W00 A;  2P6S A;  2R7O A;  3BP8 A;  1RRJ A;  1XMA A;  3HEF A;  2EFQ A;  4W1U A;  1E3O C;  1AWC A;  2ID3 A;  5JVT A;  2IS6 A;  3IWZ A;  1X19 A;  2DI3 A;  5FKM A;  5JR3 A;  4H4K C;  1PJR A;  1XCB A;  5DCM A;  2IP2 A;  3H5A A;  2OAZ A;  5KHD A;  1S5L C;  1A6I A;  4BE2 A;  1MMS A;  2R4G A;  3A01 B;  1J09 A;  2FE3 A;  4ZC3 A;  4F91 B;  1OYI A;  2LKS A;  2FBI A;  4BQA A;  1HA8 A;  2W1O A;  4XQF A;  4A93 J;  1XSV A;  4XON A;  5CKT A;  3Q2Y A;  4UUS B;  4GFB A;  3ECH A;  4LJZ F;  4U0W A;  5J8C A;  1WKM A;  2QEN A;  4TV7 A;  2HDC A;  4ITV A;  1SD6 A;  3OIQ A;  4KIF A;  2ZXI A;  3B6A A;  3PJR A;  3BR3 A;  3OS0 A;  3H3V K;  2PJR B;  1KYZ A;  4BAY A;  1G3Y A;  4WXH A;  3RQI A;  2YS9 A;  4A69 C;  3M1E A;  4IF4 A;  1I27 A;  3HRT A;  4BEH B;  2ESN A;  3CLO A;  2R7S A;  1W4M A;  5E1Z B;  3FBN B;  1ZTR A;  4LLL A;  5HLH A;  1QRY A;  3CMY A;  2KDO A;  4RB3 C;  4ENN A;  2L9S A;  4XLF A;  2ZNY A;  1O7L A;  3G71 I;  4EM0 B;  2OV7 A;  4BXX J;  3T1B A;  1P2F A;  2XRN A;  3GTO J;  1D8J A;  4CSW A;  1W5S A;  5AIQ A;  3DKY A;  2CG4 A;  4OIN F;  2DMU A;  5KAT A;  2FMY A;  2JPC A;  4ETS A;  2WV0 A;  4OIQ F;  1H89 C;  2V9K A;  2Z16 A;  2HKX A;  5HS8 A;  1G6N A;  4HG2 A;  3OYF A;  2LG4 A;  4HAM A;  4IPA A;  4E7I A;  3K4J A;  5HNF A;  5E20 A;  1R71 A;  5DCF A;  3JSP A;  3QYE A;  4E7L A;  3EYY A;  2UWM A;  1XGO A;  3H36 A;  4LIT A;  1TBX A;  5D5V B;  3A01 A;  1FOY A;  1EH8 A;  3LAP A;  5IP6 A;  1FBS A;  3H9J A;  3WU0 A;  2L9V A;  1Z6R A;  2K9Q A;  2OJE D;  5F0H A;  4UUS A;  1YG2 A;  4C3I J;  2HYG D;  3CP8 A;  2QF7 A;  3ZR8 X;  1S72 I;  2LKP A;  1IZ1 A;  5EEH A;  2Z5U A;  2PMU A;  1T2K A;  3L1P A;  3IAS 2;  3GWZ A;  4HLY A;  1N75 A;  5J47 A;  4DGW B;  1D3Y A;  4CYD A;  2PJR A;  2XGE A;  2UXX A;  2DA6 A;  2E1M B;  1MDM B;  2RDP A;  4W97 A;  4BEH A;  1LVK A;  2X6Y A;  2ZNZ A;  3BG3 A;  2E2H J;  5FKN A;  3D71 A;  2KKO A;  2K7L A;  4XOP A;  3V8L A;  4D7N A;  2ZME C;  2VQL A;  3D6Z A;  3ZQQ A;  3DV8 A;  1BI3 A;  4L9N A;  3ZXS A;  2GZW A;  4DZJ A;  1A31 A;  3E7L A;  1LNW A;  3ZQI A;  3JAM Z;  1YQA A;  1VQN I;  4AYB N;  2K3P A;  3AG3 H;  4DOZ A;  2FQ3 A;  1RNL A;  3OYM A;  3ASN H;  4EM1 A;  4KFC A;  4O3M A;  3LSR A;  3ROU A;  3R8J A;  2M34 A;  2QSH X;  1LVA A;  1K79 A;  3H1C A;  3CCR I;  3L9F A;  3BJ6 A;  1UHS A;  4XRF A;  1ZKG A;  5HLG A;  1WJE A;  1EA3 A;  3K4C A;  4EJW A;  2VAS A;  2VI6 A;  3FIS A;  2R93 J;  2Y0S N;  1ZQ3 P;  1TWH J;  1O7F A;  3E0J B;  4EQQ A;  2RRE A;  3FMQ A;  1QPI A;  4L5J A;  2LDU A;  2VB6 A;  5GAD J;  2LBF B;  4IXA A;  4IHS A;  4I99 C;  2K4B A;  1E3P A;  1F5T A;  1R7J A;  1I39 A;  2L3D A;  4LK1 F;  1P7J A;  4P55 A;  1MDM A;  1UAA A;  1JUS A;  1ZAR A;  3D1N I;  2LD5 A;  1W7P D;  2E35 A;  2L9N A;  2HEO A;  4RLQ A;  2GA1 A;  3RPU D;  3HOV J;  3ZOB A;  3RKY A;  3U21 A;  2B7E A;  1A35 A;  1R8E A;  2FQ4 A;  5CVV A;  4BYY A;  5FKL A;  2XVC A;  1YJ9 I;  4AWX B;  1IC8 A;  5E3O A;  1BC7 C;  2F5C A;  2D45 A;  3ZQG A;  3HOX J;  1NG7 A;  3CUO A;  4XL9 A;  1RR7 A;  3K70 C;  4OWR B;  1ZGJ A;  4PJN A;  3E6B A;  3K6G A;  4JX6 A;  4OOI A;  2NVU B;  1MJA A;  4S0H B;  1MZB A;  1WH7 A;  4NUB A;  1GVJ A;  4I7H A;  5H6Q A;  4IZZ A;  2NAZ A;  3QOP A;  2XUB A;  3BCA A;  2KFD A;  1IW7 F;  4A5N A;  2HPM A;  4IKF A;  3D5R C;  2AXL A;  2MH2 A;  4BAC A;  4BUP A;  1TQM A;  2DFI A;  2BZT A;  1Y8Q B;  4MNU A;  2P5L C;  5CVR A;  3F23 A;  1B6A A;  1MMA A;  2MA3 A;  3V4G A;  2NVQ J;  4JYK A;  2LBF A;  1LQ1 A;  1D0X A;  3K4M A;  2FML A;  4PSW A;  1YE9 A;  2DK5 A;  3M4O J;  3A0H C;  3LA3 A;  4AD9 A;  1GHC A;  2X1C A;  2X6W A;  2XGC A;  1R4N B;  3RPQ A;  1D1B A;  3ZMD A;  4CZC A;  1PUF B;  3HGG A;  4GXO A;  4M3E A;  2BV6 A;  2HVQ A;  2DJI A;  3LSP A;  3BZC A;  1ONV A;  4YEJ A;  4G6T B;  2ZXW H;  4YRV A;  4JX4 A;  5FLM J;  4A3K J;  3OYH A;  3V7C A;  2V1N A;  3IP4 B;  4Y15 A;  4IHX A;  2EZL A;  4UVA A;  4EVI A;  3FM5 A;  5D5W B;  3GEZ A;  3I0T A;  4JX5 A;  5HS9 A;  5GTH C;  2VQC A;  2ETH A;  3CJQ B;  3H35 A;  1BR2 A;  1R5I D;  2OU2 A;  2VC1 A;  3CJT B;  3FWE A;  2X6X A;  4A3M J;  2KLO A;  2QVO A;  3PIP F;  1DPR A;  3ZN1 A;  1QHG A;  3OS2 A;  3S2W A;  3I3L A;  3OWT A;  4YIF A;  2XC7 A;  1X1B A;  1QNT A;  2IA0 A;  3L2Q A;  2FA5 A;  1RR8 C;  3HSF A;  2IVM A;  3HKZ N;  4MFD A;  1XC5 A;  2HQR A;  1GXQ A;  1I6H J;  1X2M A;  1KZH A;  4L9T A;  2M7B A;  1I3A A;  3FXQ A;  3ZQC A;  3VOE A;  2P7V B;  2EV5 A;  1BN5 A;  5ICC A;  1RIO H;  2Z33 A;  4PJM A;  2PG4 A;  4EMS A;  2YU3 A;  3I55 I;  1MJ9 A;  2M0C A;  2HDD A;  1FP2 A;  4WK8 F;  3SXY A;  3QOD A;  2ZJQ F;  3VFZ A;  5M5W J;  1MIJ A;  4R79 A;  4AIJ A;  2E5N A;  2BE5 F;  1Y0N A;  5LRS A;  3K4N A;  4QWQ A;  3U2R A;  3GLX A;  4XK4 A;  1ZR4 A;  1MNE A;  1PUF A;  2M8G X;  3TO6 A;  2H94 A;  4LG0 B;  3H0G J;  1JKP C;  2OA4 A;  2KPM A;  2ZME B;  5E8I A;  2UZK A;  1FPQ A;  3K4K A;  2HR3 A;  2EV6 A;  1OYY A;  4KIB A;  5LBQ A;  5TRD A;  5BMZ A;  2A68 F;  5GAG J;  1OJL A;  2MBF A;  3K7A J;  3I56 I;  5DTD A;  3V7R A;  3J7Y J;  3HRU A;  4HF0 A;  3NAU A;  5EF6 A;  4NC7 A;  1IF1 A;  3S8P A;  3ABM H;  3F6V A;  2H27 A;  2NNN A;  1LDK B;  1MBH A;  1R00 A;  1JHH A;  3GFL A;  3K2Z A;  1H9T A;  2OTL I;  5D4R A;  3CCY A;  4FX0 A;  3TP3 A;  1O57 A;  2IS1 A;  3PSI A;  2ZO4 A;  1U8B A;  1BW6 A;  5FFX A;  3VYU B;  1ZN2 A;  2F5F A;  2QWW A;  2BVL A;  4G12 A;  4HNU A;  2JA8 J;  5GQQ A;  3SZP A;  3DU5 A;  3JW4 A;  3JRH A;  4M73 A;  3GW2 A;  1IGN A;  1DP3 A;  5KAW A;  3C2B A;  1Y1W J;  2BOW A;  3OYD A;  2HVA A;  3J7A Y;  4MHG A;  5JLX A;  4S05 A;  4Q4Z F;  1W0U A;  5EG0 B;  3L7W A;  3ZQ7 A;  2L5Q A;  3CP2 A;  4D9J A;  4A5M A;  2HNH A;  3M07 A;  3E3V A;  5DUI A;  2FOK A;  3P7N A;  5H6R A;  4OAY A;  4EV0 A;  3DLL F;  4AM3 A;  1L0O C;  2KIF A;  4F55 A;  3Q3S A;  3Q5R A;  3PSF A;  3H92 A;  1BM9 A;  5E18 F;  1X1A A;  1XS9 A;  5GPA A;  4LG0 A;  2PJP A;  3OYL A;  2M3A A;  2Z99 A;  3ABL H;  2ZME A;  1U0J A;  3ZQF A;  3HSR A;  4EGY A;  5DS9 A;  4HX7 A;  3EET A;  2Q1Z B;  1X3Z B;  2JPB A;  4JQF A;  3I4N J;  5HDN A;  4CIC A;  4N4O B;  2IA1 A;  2L9R A;  3F8B A;  1FYK A;  3U9G A;  5LGU A;  3VYT B;  2WA0 A;  2OUM A;  1GT0 C;  2QZ8 A;  1IDY A;  2MC3 A;  1RUN A;  5GP9 A;  3KP5 A;  4J19 A;  3OSG A;  3IH3 A;  4FIS A;  3FZV A;  3JRF A;  2VUM J;  4CCJ A;  3VSL A;  3EPZ A;  2H09 A;  1J9I A;  2ZBK A;  2XAS A;  1SFX A;  4QPO A;  4OMY A;  2X1D A;  3Q9V A;  1YYV A;  2OZU A;  3BG9 A;  4RM3 A;  3I54 A;  1P9Q C;  5KVR A;  3CO7 C;  3AL0 B;  5J1U A;  4MTE A;  3K9T A;  4C2U A;  2WAD A;  3B73 A;  3LA7 A;  3GZ6 A;  2HPI A;  2ME6 A;  2CMP A;  2ZB9 A;  5EG0 A;  3H5R A;  3F6O A;  3W6V A;  2O8K A;  2XKP A;  1ITY A;  2VKD A;  3IKV A;  2R5Y B;  5DD8 A;  2HXO A;  5J3L A;  1IAW A;  3WTS C;  1MW7 A;  2RC4 A;  5LRR A;  2W4S A;  5TJJ A;  2DYS H;  1DGW Y;  1U8R A;  4XN0 A;  1ZRD A;  3RKX A;  1FY7 A;  2DOE A;  2EZH A;  4BGD A;  4I02 A;  1TT5 B;  3S15 J;  3SJM A;  4DYC A;  3ZMV A;  2W25 A;  1RET A;  3WGI A;  3M8F A;  3F72 A;  4AVZ A;  4FQG A;  3VOD A;  9ANT A;  3HTU A;  3DBH B;  3GTQ J;  4HW0 A;  1JGS A;  1NTC A;  2AQE A;  1G4D A;  5EDN A;  3CC4 I;  2XAH A;  3DLA A;  3S32 A;  1BR4 A;  3LSJ A;  4GCV A;  2KZV A;  3TW7 A;  3CTA A;  1YRN B;  4S04 A;  1IRX A;  2V1U A;  3JCU C;  1M1E B;  1K4T A;  2GLO A;  4HEA 2;  5ICE A;  3Q5P A;  4RGX A;  3HJE A;  4XID A;  1Z6T A;  3CF2 A;  2YR2 A;  4II2 A;  3OYB A;  3DF8 A;  1UJ8 A;  2TDX A;  2DA7 A;  1WCM J;  4M71 A;  2R5Y A;  3A1Y A;  2W82 A;  1MKM A;  4Y17 A;  3VYR B;  4X6A J;  3J81 Z;  5DUK A;  5D6F A;  2AQF A;  3DBR B;  3HG9 A;  2B9S A;  4Q48 A;  3DQV C;  4N9H A;  5IT9 Z;  1HDD C;  3K4L A;  4CH7 A;  2DFF A;  3DTI A;  1H9G A;  1WZ2 A;  4XRM A;  1VND A;  1BR1 A;  5JFR A;  4A3G J;  1G3W A;  3BG6 A;  2VQH A;  1KGS A;  3I4M J;  4CUG A;  3RJP A;  2DJN A;  1XGN A;  4LFU A;  4MIM A;  3GTK J;  4MEX F;  2JJ7 A;  5TIS C;  3WGG A;  1OFC X;  4D5F A;  1W5C C;  3I71 A;  3OYN A;  3TBI A;  2MG4 A;  4J00 A;  1FEX A;  5IYC J;  3HHH A;  2ZC2 A;  2OCC H;  3K4B A;  2R7R A;  2A6H F;  3V8J A;  5IPA A;  4G7Z F;  2VL8 A;  1WJF A;  4G6D A;  4ZYD A;  1S7A A;  3FKJ A;  3HYI A;  1ETK A;  3LQR A;  5FLX K;  4M9Z A;  2AHQ A;  4XLE A;  3MD2 A;  2K9S A;  4UXN A;  1YO5 C;  3BWG A;  1YRN A;  4U88 A;  1J2X A;  3DTK A;  1TNT A;  3ZQL A;  3IRQ A;  1B4A A;  5L3B A;  1W1W E;  1WRJ A;  3KP7 A;  5FB2 A;  4L9J A;  2OTJ I;  2HU9 A;  2DQR A;  3BZK A;  3BPV A;  3NWT A;  3FMR A;  3IH4 A;  2KT0 A;  3BR6 A;  4UY8 I;  3E6D A;  4XOT A;  3G1O A;  2QQB A;  2LFB A;  3JRI A;  2VN2 A;  2M5W A;  1PP8 F;  2BW3 B;  4F3Q A;  5L3C A;  2IJL A;  1IN6 A;  3CQZ J;  1F1Z A;  4LMY A;  2RN7 A;  2NVX J;  3OOU A;  5F27 A;  2Y0M A;  1IO2 A;  1E3H A;  2MW8 A;  4M72 A;  3E6M A;  3HUG B;  4QLC U;  4CCN A;  2OF7 A;  3M7G A;  3CF5 F;  4A3F J;  3OYC A;  3I4P A;  4L5I A;  3FF5 A;  2E71 A;  3H9G A;  1GLN A;  5J8F A;  4NHJ A;  2I8D A;  1XN7 A;  3R0A A;  2XAJ A;  3BT9 A;  2VBY A;  5B1B H;  1FWZ A;  2E5Z A;  3V42 A;  1BIB A;  4DIQ A;  4OIO F;  1VQK I;  1B9M A;  3KP4 A;  5D6E A;  2V26 A;  2KZG A;  2WB1 N;  4IRI A;  2NS0 A;  5C3E J;  3OYG A;  1P4A A;  4C3H J;  2MSY A;  3DKX A;  1OKR A;  5IOZ A;  1XG1 A;  2JK3 A;  4HLX A;  1I5Z A;  2DTZ A;  4RA2 A;  2E1N A;  1RES A;  2LF8 A;  3K1P A;  3L2R A;  1K61 A;  3K2A A;  3IV5 A;  2P5V A;  4F93 B;  2CV2 A;  3HOT A;  1IV8 A;  5K7H A;  4HSR A;  4BQO A;  2VKH A;  1TNS A;  2K4J A;  4E7J A;  3CD6 I;  2ZXJ A;  2R7Z J;  1YFH A;  3GTJ J;  4M3D A;  4L0Y B;  2HOT A;  1E0E A;  4YEL A;  4UVC A;  2VT2 A;  3CC2 I;  1W36 D;  3GFJ A;  5FD5 A;  3BY6 A;  1ZHF A;  3E5Q A;  2J5P A;  3BCB A;  3FK6 A;  2L54 A;  1UST A;  1JKQ C;  2EIL H;  2V6E A;  3HUG A;  1AOY A;  1XX5 A;  1DP7 P;  2KIS A;  4LD5 A;  4RAZ A;  2FUG 2;  1XGS A;  1YW9 A;  2LTP A;  2YX4 A;  4D5C A;  4G8X A;  2ZXH A;  2R7V A;  1MGT A;  2P0W A;  4AYB A;  3LSG A;  3FM3 A;  2GIV A;  1QHH D;  2VJJ A;  1SAN A;  4A3L J;  1UHW A;  1SAX A;  1LJ9 A;  2BHZ A;  2QSG X;  3MFK A;  3KYL A;  2IGN A;  4R1H A;  2LR8 A;  1XGM A;  4I01 A;  3M9A A;  4A0X A;  3RZD J;  1QPM A;  2E19 A;  2XIG A;  4HX8 A;  1HLV A;  1F4K A;  5CLS A;  3ZCO A;  3BJA A;  2Y0S A;  2D1H A;  1MBJ A;  2EA2 A;  1ETV A;  1R4M B;  2DU9 A;  2OQG A;  5EEG A;  2I10 A;  2DT5 A;  3I5U A;  1ACI A;  4V2F A;  4DQ2 A;  2EH3 A;  1U9O A;  4PGG A;  1LDD A;  3AG4 H;  2VJ4 A;  1IXC A;  5DM6 F;  2V4J C;  4M74 A;  2XRO A;  2LRD A;  2HTS A;  4XMY A;  4EGZ A;  3BR1 A;  1XTA A;  3W6J B;  2O9L A;  1XCV A;  3U1K A;  2NS8 A;  2LP0 A;  3W6K B;  4RDU A;  4ZJZ A;  1LEA A;  3PNV A;  1DU6 A;  4A0Y A;  4NNJ A;  1U3E M;  2LKX A;  1YLF A;  3J80 K;  1Q1V A;  3S93 A;  1R5H A;  1T33 A;  3IL2 A;  1SMY F;  1K78 B;  3QYB A;  4BE1 A;  1OCT C;  4UV9 A;  1JXS A;  2K9N A;  1ORK A;  4X0G A;  4B43 A;  5F04 A;  1IG7 A;  2JRT A;  3BG5 A;  5CVU A;  3TOB A;  5J40 A;  3ZMS A;  1UG0 A;  3FMS A;  2E1O A;  2L7F P;  3G3Z A;  2A6E F;  2Y30 A;  4R8H A;  4BQN A;  1ZAO A;  4YG2 F;  5LFA A;  4FCY A;  1O3T A;  4L18 B;  2VPL A;  1MJB A;  3EUK L;  2R0Q C;  3ZQH A;  1IDZ A;  1KON A;  3B49 A;  1LUJ B;  4OAZ A;  2WBM A;  1Z3Y A;  4E7Z A;  2F6C A;  3EDP A;  3TOA A;  1T38 A;  4KIS A;  2RNJ A;  3GTL J;  3EUA A;  2XB0 X;  4XLC A;  1SD7 A;  4E7S A;  5EZH A;  5C4J J;  2RNG A;  2IPQ X;  1WI9 A;  2DT6 A;  3LQQ A;  3T0Y A;  1T8I A;  1ERD A;  4FX4 A;  2W7N A;  2DYR H;  3RTR A;  1UFM A;  5FGM A;  3HPG A;  5GTI C;  4L9V A;  1IRG A;  3P5J A;  5HOO A;  4FE7 A;  2V1D A;  1A36 A;  1OCZ H;  1QO0 D;  4Y33 A;  2GBY A;  3S17 J;  1FX7 A;  3EQL F;  3L2C A;  4B0Y A;  4ZTF A;  1XB4 A;  3QU3 A;  4M6Y A;  4BHP A;  4ENJ A;  5A2Q K;  4KMF A;  2FNA A;  3E5X A;  4HF2 A;  1DPU A;  2W85 A;  1WI3 A;  4JK1 X;  2QLZ A;  3JSO A;  2FNP A;  1LDJ A;  2KIU A;  2LYC A;  3KE2 A;  5KAI C;  4IL6 C;  4J01 A;  3MZY A;  1HF0 A;  1QZY A;  4WXD A;  2VXZ A;  1K78 A;  2XAF A;  2P81 A;  3WTX C;  4L5E A;  1DQU A;  2JT1 A;  4ASN A;  5JHF A;  2XDV A;  2H6B A;  2W48 A;  2OBP A;  2F48 A;  2HXI A;  4ZYA A;  1LPQ A;  3HKZ A;  1ON2 A;  3I53 A;  1G2H A;  1HKS A;  2DCE A;  2OCE A;  4IHY A;  1FP1 D;  3BDD A;  5DM7 F;  2R7F A;  2RV8 A;  5ILS A;  3DKW A;  1YJW I;  3KYD B;  3Q0U A;  1G3T A;  3LAJ A;  2ACJ A;  5CQE A;  2H8W A;  2GIZ A;  5EGO B;  1TWC J;  2XV4 S;  4XBF A;  4BXF A;  2EJR A;  3R0J A;  2XF5 A;  5E17 F;  2MD5 A;  4DNC A;  3DPT A;  1I1G A;  4UB8 C;  2NVT J;  2ELJ A;  4BBR J;  4ZH4 F;  3WOD F;  4PCQ A;  2XPW A;  4IJA A;  3VDX A;  2R7U A;  2G7H A;  3J7Z I;  4RMN A;  1U5T B;  2DDB A;  2MAB A;  2BGC A;  3VWB A;  2A3S A;  3SYT A;  4G7O F;  3KZY A;  2DXI A;  1EXJ A;  4GO1 A;  4EJU A;  1MMD A;  2AO9 A;  1RZ4 A;  3ZGK A;  3CCL I;  1J5Y A;  4QSH A;  2WAE A;  3O8G A;  4CHU A;  1Z9C A;  3ZN0 A;  3DPL C;  2X48 A;  5AIP A;  1HW2 A;  3R60 A;  1FMV A;  5FKO A;  1BI2 A;  3R61 A;  2CU7 A;  1H88 C;  1XMX A;  2W24 A;  2CO5 A;  3BR2 A;  2HS5 A;  2LH9 A;  1SC7 A;  3OR2 C;  1QVU A;  2X1E A;  5HDG A;  3AAF A;  5M5Y J;  1DU0 A;  2JMW A;  2LY2 A;  3OV8 A;  1LE8 B;  2KMU A;  4Y13 A;  2CW7 A;  3V8K A;  2ZJ2 A;  4ZDL A;  4BDZ A;  2JUG A;  1NK3 P;  2E2I J;  1T0F C;  2Y9Y A;  2M0M A;  1Z91 A;  1F9N A;  5EGO A;  1ZGW A;  1Z21 A;  3ABK H;  4IRG A;  4BS9 A;  1SMT A;  1BA5 A;  3BQY A;  4Z6Y A;  3KET A;  4E6K G;  3E0H A;  4XOR A;  3KX2 A;  1P4X A;  3CCU I;  4RBO A;  2X9D A;  2QGU A;  1KQ9 A;  2R92 J;  4MO7 A;  3BOQ A;  2A69 F;  1OCP A;  1E2X A;  1U5T A;  1TWA J;  1JUP A;  1QZE A;  4MQV A;  1UB9 A;  3K1N A;  4BDY A;  4JP0 A;  2KRF A;  4A2U A;  4HNT A;  2NOG A;  4UUV A;  4BQQ A;  3AFH A;  2XSJ C;  5FFZ A;  4B1R A;  4CZZ A;  2JA6 J;  5CVJ A;  2ADU A;  2A5Y B;  3K70 D;  1VI0 A;  4RB2 C;  3D0S A;  1TT0 A;  3FHN A;  3HBL A;  2M45 A;  4UVB A;  3TL4 X;  5GAH J;  4I76 A;  1DDN A;  1IJW C;  1ZRF A;  2MD0 A;  2K27 A;  1R58 A;  1R22 A;  1XSD A;  2KQR A;  1Z1D A;  1B72 B;  2A61 A;  2IGM A;  5LD2 C;  4UNO A;  2QBY B;  3C3W A;  3S2H J;  1NK2 P;  1A04 A;  2E1C A;  1LE8 A;  2ESH A;  3D70 A;  1OR7 C;  4RGR A;  2F4M B;  2L0K A;  1BL0 A;  4N4N B;  3SDB A;  1QZZ A;  4AU7 A;  1FYL A;  2OQR A;  3GUD A;  4PDK A;  3KFW X;  2CGP A;  5K5R A;  4XSX F;  5H20 A;  4PJ0 C;  1DGR M;  3QQA A;  3VPR A;  4AC0 A;  3G1L A;  1TW2 A;  2DAO A;  5D5X B;  5JVG F;  2GM4 A;  3N97 A;  4A6E A;  1MSE C;  5KAF C;  3CCV I;  3G73 A;  1WFX A;  4CA0 A;  2BXZ A;  4NC8 A;  2DMP A;  2G7U A;  3GO5 A;  3SHF A;  3DP7 A;  1T6S A;  2CUF A;  1P6R A;  4LB6 B;  4ESJ A;  1X3U A;  1ODD A;  3E1S A;  1K6O A;  4Y7N J;  1VQP I;  1JGG A;  5H2F C;  3S3O A;  1A6Q A;  3MCZ A;  4ZYE A;  4UB6 C;  2EFO A;  1B9N A;  3LFK A;  1ZYR F;  3PNY A;  2DBB A;  2KRC A;  3LFU A;  4LOC A;  1TTY A;  3AG1 H;  3WU2 C;  2IAI A;  4M3G A;  2WC2 A;  4RAG A;  1B72 A;  4LG3 A;  2WAQ A;  2Q0O A;  5D4S A;  2QBY A;  3HXL A;  2VOO A;  3MKZ A;  2VJI A;  2FU4 A;  4LLG F;  3A4C A;  1HOM A;  4OU0 A;  5IYB J;  3OMY A;  2DA2 A;  5JLW A;  2WWY A;  2IEK A;  4NDL A;  2BVM A;  3W2W A;  1IN8 A;  5LEK A;  1BOA A;  2IS4 A;  4Q5S F;  1HW1 A;  4XKV A;  1D0Y A;  4I0A A;  3L2V A;  2NNY A;  2DDA A;  2KIM A;  2PI0 A;  2BY3 A;  4HDV A;  1BOB A;  1Z05 A;  4KYW A;  3J7A O;  4A3E J;  1MBG A;  2X6O A;  1FJL A;  2LOO A;  4XLA A;  5J1Y A;  2QQA A;  4C2M J;  2OPT A;  2MLK A;  3OL4 A;  4NQW B;  1V55 H;  3ABT A;  4CO8 A;  3V7S A;  4U87 A;  2FF4 A;  4D0P A;  2QEX I;  4M6V A;  3PNT A;  5FKK A;  1W7P A;  2VPR A;  2BBY A;  2DOF A;  3RPU A;  2XHK A;  4KT6 A;  3IAO A;  4U0Y A;  5FO5 A;  1SFU A;  3GTG J;  1ETX A;  2Y75 A;  2W84 A;  3RYR A;  3E6C C;  2AXT C;  5IP7 J;  2ZFU A;  1ZH5 A;  2HVS A;  4XKW A;  2EZI A;  1YOV B;  1I50 J;  1MD0 A;  3R6S A;  5E1W A;  4IOC F;  4XKB A;  4QPQ A;  2D5V A;  1X1P A;  4PGH A;  4BBS J;  1G8X A;  2CFX A;  1FOK A;  3KZZ A;  1QBJ A;  5HVQ C;  3W2V A;  4CXF A;  4V19 K;  5LEJ A;  4P5O A;  3WTU C;  1LFB A;  1GV5 A;  2HOA A;  1HXD A;  5K7F A;  3PO2 J;  1REP C;  3ERE D;  3QPT A;  1BI0 A;  2GOX B;  2ID6 A;  2FD5 A;  5F1R A;  4NB5 A;  3EYI A;  3MKW B;  3A0B C;  3BG7 A;  1XSX A;  1ZLK A;  4MGR A;  3IWF A;  1TW3 A;  4HRI A;  2RQQ A;  2QSF X;  2PEX A;  4A3B J;  2JZY A;  2VC0 A;  4XIC A;  2F4O B;  3SEQ A;  4NQW A;  2EFW A;  4RB1 A;  1P7I A;  4AUX A;  2CJJ A;  1F43 A;  4M9S A;  1AKH B;  1WJB A;  1JKO C;  2E34 A;  2YUS A;  4CCK A;  2HOS A;  2Z1D A;  4Y52 J;  1W5T A;  1SVO A;  1CF7 B;  5B1A H;  3WE3 A;  3MMY B;  4A0Z A;  5CYV A;  1JE8 A;  2DW4 A;  1WJA A;  3HGY A;  3HPH A;  3CJR B;  3SZG A;  1C0W A;  3I58 A;  4OMZ A;  4I2O A;  2WB1 A;  2R7D A;  2F5V A;  5HLT A;  1TQI A;  2KRH A;  2XAU A;  2DA4 A;  2CS3 A;  4I09 A;  1GDT A;  2PMZ N;  1TL8 A;  3ECO A;  3ZMZ A;  4HPQ A;  4ZDP A;  2VKV A;  1BOW A;  4A3I J;  3ULQ B;  3KP2 A;  4EEF G;  4L0Z B;  4BH9 A;  1BBY A;  1T0F A;  3KLO A;  3IH2 A;  4C3J J;  4HBL A;  3S2D J;  2X51 A;  3R4K A;  4AID A;  3LA2 A;  4IRH A;  4CCO A;  5E79 C;  5CQG A;  3TW6 A;  2MC4 A;  3FXK A;  4ESB A;  1FIA A;  4ZZD A;  3KEO A;  1N77 A;  1G3S A;  2HI3 A;  1T08 B;  3PO3 J;  1CGP A;  2ZSH B;  1ZRE A;  1I3Q J;  4EM2 A;  2CH0 A;  1JHF A;  3ONQ A;  2NVY J;  3JAM K;  4C30 A;  1J75 A;  1VQM I;  1AKH A;  3OL3 A;  4UV8 A;  1CF7 A;  2JQ7 A;  3G1M A;  1SVL A;  3VSK A;  3CMM A;  2X85 A;  3L00 A;  3IKT A;  3ZMT A;  4HYE A;  3OYJ A;  3CCJ I;  3BTL A;  5LGT A;  1RI7 A;  2RVC A;  3CES A;  3M1C A;  3UNG C;  1UMQ A;  3MZ8 A;  3Q5F A;  3HHG A;  2YX7 A;  2DOA A;  5KAU A;  3GYH X;  2M1B A;  3DTE A;  3PQK A;  1CQT A;  1HKQ A;  5ICF A;  4HZF A;  5CPR B;  4A1M A;  4UHT A;  4U7D A;  4O5V A;  3UR3 C;  5LLQ A;  4PK4 A;  2GOM A;  1SFK A;  3LSH A;  1VQ5 I;  2XF7 A;  1NH3 A;  3C18 A;  4I6Z A;  2PQ8 A;  1OR7 A;  3GCM A;  3SEZ A;  4U7B A;  1GXP A;  3HM5 A;  3KYC B;  3IHU A;  4HX4 A;  4M9X A;  3HOY J;  1UZC A;  1S8N A;  2XGX A;  1KU2 A;  3CMA I;  1SEU A;  1Z7L A;  3QP5 A;  4V2G A;  3P9C A;  3MAJ A;  4U0V A;  5F64 A;  3BRO A;  2H1L A;  4G6Q A;  3WTW C;  1VQL I;  2E2J J;  2DOD A;  2G0E A;  5IYD J;  1B8I B;  1KQ8 A;  1ZRC A;  3OYE A;  3QRF F;  2M87 A;  3PUF A;  2FSW A;  3RKW A;  1XD7 A;  3PFI A;  3RYP A;  1S7O A;  2LLK A;  2DMN A;  2DPU A;  1X4O A;  4XM3 A;  2CUJ A;  4DJA A;  1MBF A;  2EBI A;  4BHB A;  1BW5 A;  2JVH A;  2OD5 A;  1S9H A;  3N4M A;  3Q9S A;  1HQC A;  2DMT A;  4FT8 A;  2E7X A;  1O4X A;  5ICG A;  1R49 A;  2E60 A;  2BEO A;  2ELH A;  2HOE A;  5EZG A;  1TLH B;  4PFO A;  5DYM A;  3MEX A;  1F36 A;  2YU9 J;  1RC9 A;  2L4A A;  3TKY A;  2E36 A;  4KN4 X;  1R5G A;  2CV1 A;  4BNC A;  3Q1M A;  4DBR A;  1JTY A;  1JTX A;  2V9P A;  1XDU A;  3OOP A;  1IV6 A;  4O6J A;  1EJ9 A;  2ZFW A;  3H3U A;  4AYZ B;  2ZSI B;  4C2T A;  1TC3 C;  2HYF A;  2N8G A;  1GVD A;  3CCM I;  2HZT A;  1Z0X A;  1EV7 A;  3KEQ A;  3W3C A;  2XSD C;  3P9K A;  2XRL A;  2HZD A;  4LLN A;  2UUZ A;  3M3Y J;  5M5X J;  2Y9Z A;  3TGN A;  1B8I A;  2CW8 A;  2K9M A;  3BLY A;  4BJT A;  3WTT C;  1TWG J;  5J6X A;  2JUC A;  2LC2 A;  3F8F A;  5L3D A;  2FX0 A;  1YI2 I;  1QQI A;  1PVE A;  2VBW A;  2ELK A;  1X3W B;  1LFP A;  3AG2 H;  1O3S A;  1VF9 A;  1N25 A;  2EFN A;  3JRE A;  1LB2 A;  1FBU A;  1LFU P;  4F92 B;  2O5R A;  5JI6 A;  5BS6 A;  3NQO A;  2DT7 B;  1Y8R B;  3BQZ A;  1JYH A;  1MMG A;  2IRF G;  3TP0 A;  3DEW A;  2O6G E;  1MH3 A;  4P1W A;  1FTZ A;  2M9H A;  5EJC A;  5HS7 A;  4H0E A;  1BIA A;  2V1X A;  4Y3O A;  5FRN A;  2LRE A;  3GZ5 A;  4Y4R A;  3SDG A;  2CQQ A;  3JTG A;  4HDU A;  1R36 A;  3KPH A;  4M3B A;  5FRM A;  3QYF A;  2K3F A;  4BY1 J;  3LUR A;  3FXU A;  2YSR A;  2COM A;  4HST A;  3DWL E;  3GME A;  2CSO A;  1ETW A;  3TQN A;  1T95 A;  3HSE A;  2CYY A;  2HKO A;  4AYZ A;  2MGQ A;  1K4S A;  2MLG A;  1S29 A;  3H3Z A;  1T39 A;  1SFO J;  1SVM A;  1QGP A;  1IN7 A;  3WG9 A;  1HSJ A;  2JRM A;  1Z67 A;  2WY8 Q;  4P9F A;  1TZL A;  1IRZ A;  4B8X A;  1OYW A;  2EIJ H;  5B5E C;  4I98 B;  1J0R A;  4IHV A;  1QVT A;  1X58 A;  5TGT A;  3LSK A;  3L2U A;  2R7Q A;  2XPU A;  3K1M A;  5E8G A;  3ASO H;  4G7H F;  2LY9 A;  1ZLJ A;  1FBQ A;  3RDI A;  3ESW B;  5D5U B;  2HYJ A;  3LWF A;  3PQJ A;  4II3 A;  3I64 A;  1KQ0 A;  4X1E A;  3GXO A;  1ZK8 A;  3OY9 A;  2MH9 A;  4EAT A;  3HOZ J;  2EA4 A;  5K5Q A;  4E7H A;  2BY2 A;  4HV5 A;  4YFK F;  1PP7 U;  2GOV A;  2DFH A;  1VQ7 I;  2TCT A;  2IW5 A;  3IAM 2;  1DUX C;  4KN7 X;  1D5V A;  2Y2Z A;  3VYS B;  3P9I A;  2K40 A;  4E7K A;  4CCL A;  2Z3Y A;  2Q8K A;  3G4S I;  1OCR H;  2KJC A;  1AHD P;  5FD6 A;  2EWN A;  3FXM A;  4CDG A;  2X4H A;  1IXR C;  2IXS A;  5KCM A;  1KU9 A;  1POG A;  1B1B A;  5BQT A;  2Z9O A;  2GXB A;  1EKE A;  5LHG A;  4BHC A;  5L3E A;  3D6Y A;  3H5N A;  1ENH A;  2KP6 A;  3GF2 A;  1YW8 A;  1OPC A;  3B6C A;  2PLY A;  3DXJ F;  3C1D A;  2V9V A;  1NG6 A;  3NWS A;  4B4C A;  3JR9 A;  4HQM A;  3QWL A;  4KMU X;  1JKR C;  4M3F A;  5LHI A;  2PFB A;  3L09 A;  1G59 A;  2DLL A;  1VTN C;  5ILV A;  2QCO A;  3F8C A;  1WVR A;  1XDS A;  1D0Z A;  1D8K A;  2PX9 A;  4KA4 A;  2EIK H;  3F8N A;  4XNF A;  2NS7 A;  3O2P E;  2Y48 A;  3MWM A;  2QYO A;  2NYX A;  3FK7 A;  3HC7 A;  4K2E A;  1SAU A;  5LGN A;  2R3S A;  5HDK A;  1V4R A;  2DA1 A;  1ETY A;  5J1R A;  3QP6 A;  3BZ6 A;  3CCE I;  1R9T J;  4N0B A;  1PYV A;  3QOE A;  3O6B B;  3KCC A;  4IHW A;  5GPC A;  2K9L A;  1OCO H;  5E1X A;  3JRG A;  4IQ4 A;  3JRD A;  2ME0 A;  2L7K A;  2VBX A;  4Z2Y A;  1FOW A;  1RPW A;  2LSO A;  4KJZ A;  3O8H A;  3DFG A;  3FDY A;  2QKL B;  2AS5 F;  1U9N A;  4ESF A;  3FBI B;  2QA4 I;  1SD4 A;  4ANJ A;  2O7O A;  3KP3 A;  3UKG A;  1IN5 A;  1TP4 A;  3RQ4 A;  4IOA F;  3QPH A;  4PJL A;  1R1U A;  3FHZ A;  5HOD A;  1S6L A;  1D1A A;  1JJ8 C;  3S3M A;  2L4M A;  5J4Y A;  2G9W A;  5KAX A;  1Z7U A;  2A5W A;  4ZYH A;  1YX5 A;  5FLX Z;  1YIT I;  4B47 A;  2Y31 A;  2CW0 F;  2DMQ A;  2L01 A;  1AU7 A;  3HOU J;  3OR1 C;  3PFY A;  1WQ2 A;  2D2W A;  1FLI A;  1VFC A;  3NAR A;  2CQ7 A;  2HQN A;  3DCF A;  2E7W A;  2VJ5 A;  1X2N A;  3KIO A;  2RKH A;  2ZKZ A;  1RUO A;  2DN0 A;  3T8R A;  2M2E A;  3IUO A;  4LIU A;  3OYA A;  1ZGA A;  3F3X A;  3M8E A;  3CCQ I;  3DU6 A;  5KAV A;  4WF2 A;  1OIS A;  4WX9 A;  4WXC A;  3RZO J;  3D5S C;  5HNH A;  3WHC A;  1U2W A;  4XR6 A;  3HRS A;  3WE2 A;  1WJC A;  3F22 A;  3GTP J;  2F2E A;  3OIP A;  4XLP F;  4RLF A;  1Y6I A;  3X2Q H;  4G94 A;  4DBQ A;  5ILU A;  4D7M A;  5F08 A;  3KEY A;  1L3L A;  2H8R A;  5ERI A;  3QU6 A;  3SQN A;  2WY7 Q;  2COB A;  3OIO A;  5K1Y A;  5D8L B;  3PL8 A;  5LHH A;  1WHU A;  4CYC B;  1I6X A;  1YJN I;  3W2A A;  2L2O A;  1OQY A;  3I59 B;  1FNN A;  3REO A;  5EEA A;  2CQN A;  2CWE A;  1YHQ I;  5C4X J;  4P9U A;  2DO7 A;  4XLH A;  3QPL A;  1GV2 A;  3NRV A;  3VB2 A;  2EIN H;  3B02 A;  3H0D A;  4GDF A;  3DPU A;  3CC7 I;  4F7Z A;  1TWF J;  3OS1 A;  3J81 K;  2O0Y A;  3QPS A;  4FAS D;  5E3N A;  3K69 A;  5IT9 K;  1I1S A;  4ABZ A;  1MBE A;  4KDP A;  3AL0 C;  2A05 A;  2DFE A;  5FRO A;  1JT6 A;  3FKI J;  4PFP A;  2VIX A;  4MEY F;  3ZPL A;  2L02 A;  3FXO A;  4FTH A;  4ZZL A;  1FMW A;  1H0M A;  2IBD A;  4JBA A;  3FXR A;  1Z77 A;  1WH5 A;  3BR5 A;  3F21 A;  5CJ9 A;  3C2G A;  5BPD A;  1X4P A;  4DZP A;  3PM1 A;  1IUF A;  1WPK A;  3RCO A;  1IRF A;  2TRT A;  2KJB A;  2R7W A;  1Y39 A;  1K6Y A;  2PBI A;  1OLT A;  4C9Y A;  4ON0 A;  2FXA A;  3LSM A;  2P8T A;  2BY1 A;  4IVN A;  1XPX A;  1Y56 A;  2IT0 A;  2EK5 A;  1N78 A;  1YIJ I;  3BTJ A;  1KA8 A;  2W57 A;  4XRS G;  2YPR A;  1JI8 A;  2XAG A;  1FTT A;  2HDW A;  2ECB A;  3EUH C;  2ZCW A;  3WTV C;  2JA2 A;  1TQP A;  4CYC A;  5IP9 J;  1B59 A;  3MKY B;  3WTZ A;  2BXY A;  4CCM A;  2IGK A;  4MFE A;  3I59 A;  1E17 A;  4GYG A;  2DA3 A;  2PN6 A;  3HRM A;  3ZRG A;  2VON A;  2HQ5 A;  5L3F A;  3CDH A;  1NHA A;  3DEU A;  2JTV A;  2QQ9 A;  4LIV A;  5F0C A;  2LVS A;  5KK1 A;  2RQP A;  3O3K A;  1FZP B;  1QU3 A;  2R7X A;  3F0C A;  3IRR A;  4DYR A;  4KIC A;  5D8K B;  4E4H A;  1FT9 A;  2CV0 A;  2KL4 A;  2KIQ A;  3TED A;  4XKC A;  4ENK A;  3OYK A;  2EQR A;  2GAU A;  1YX3 A;  4XN3 A;  2XKO A;  1T56 A;  3WGH A;  2Q2E B;  3JRC A;  4EJO A;  1T98 A;  2GXA A;  3R8K A;  3FIW A;  1FC3 A;  4BXU A;  2HGC A;  5JHU A;  1WJ5 A;  3LL7 A;  1S7E A;  1MH4 A;  2CUZ A;  1W7P B;  3SZT A;  2KCU A;  5BPI A;  3M8J A;  4MLO A;  3SFI A;  3TO7 A;  2CQK A;  2HFH A;  2CFO A;  4EJV A;  3S1R J;  3FXJ A;  1AA7 A;  1WSU A;  1K83 J;  2PMZ A;  2EIM H;  2IGO A;  2JSC A;  2EFP A;  1H8A C;  3J80 Z;  2ISZ A;  2HWV A;  1R1V A;  5C44 J;  4D1Q A;  5FJ8 J;  4F52 A;  3ABU A;  5ED4 A;  2XB5 A;  3CJN A;  3RKQ A;  3BR0 A;  3DEE A;  4A12 A;  3TO9 A;  1D5Y A;  2STT A;  4HF1 A;  4CGZ A;  3VEP A;  2BHY A;  3T5X A;  4RAY A;  1HW5 A;  4P96 A;  1V5G A;  3BJO A;  1OCC H;  2D1V A;  3CLQ A;  5DDG A;  3GBG A;  2OC6 A;  4RS8 A;  1HST A;  1V5E A;  2P4W A;  2UXN A;  5F1J A;  3FX3 A;  2Q2E A;  2NXN B; 
#chains in the Genus database with same CATH homology
 3MN2 A;  1WH7 A;  3BR1 A;  4A1M A;  1RKW A;  2O9L A;  2NS8 A;  2LP0 A;  4RDU A;  4I6Z A;  2FJ1 A;  1DU6 A;  3HM5 A;  4BKX A;  2LK2 A;  3HOY J;  1JT0 A;  2LKX A;  1Q1V A;  2JWT A;  1T33 A;  4V2G A;  4JYK A;  4A3J J;  2NVQ J;  1MNM C;  1ETO A;  1OCT C;  2E2J J;  2G0E A;  1MBK A;  2K9N A;  3M4O J;  5IYD J;  1ORK A;  1B8I B;  1IG7 A;  5F04 A;  3BG5 A;  4DYQ A;  1Y1V J;  2XGC A;  4B3A A;  2E1O A;  2LLK A;  2L7F P;  2DMN A;  3Q0V A;  2Y30 A;  1A5J A;  1PUF B;  3HGG A;  4FCY A;  2R5Z B;  4M3E A;  2R0Q C;  1MBF A;  2EBI A;  3ZQH A;  3LSP A;  2JA7 J;  5K7Z A;  5FLM J;  4JX4 A;  1IDZ A;  3B49 A;  2RAE A;  4QTR A;  4A3K J;  1BW5 A;  3JRB A;  4IHX A;  2DMT A;  3GTL J;  2EZL A;  2XB0 X;  1O4X A;  5C4J J;  5EZH A;  4JX5 A;  5EZG A;  1F36 A;  4A3M J;  2YU9 J;  2DA5 A;  1U78 A;  1HCR A;  4FE7 A;  3Q1M A;  2GBY A;  3S17 J;  1JTY A;  1JTX A;  2CRG A;  4B0Y A;  3A03 A;  1IV6 A;  3HKZ N;  4MFD A;  1XC5 A;  1I6H J;  4AYZ B;  1X2M A;  1WI3 A;  3HB9 A;  2N8G A;  1GVD A;  1Z0X A;  5E3L A;  3ZQC A;  2XSD C;  1HF0 A;  2XRL A;  3GK6 A;  2M0C A;  2HDD A;  2P81 A;  3M3Y J;  5M5X J;  2Y9Z A;  4L5E A;  5M5W J;  3WHB A;  1B8I A;  2W48 A;  1TWG J;  2HXI A;  3MVP A;  2FX0 A;  1RKT A;  4XK4 A;  1ZR4 A;  3GTM J;  2ELK A;  1PUF A;  4IHY A;  2R5Z A;  2M8G X;  1G2H A;  1EXI A;  1VF9 A;  3JRE A;  1LFU P;  3JRA A;  3H0G J;  1JKP C;  3BQZ A;  1JYH A;  3TP0 A;  5EYR A;  3DEW A;  1MH3 A;  3HDD A;  2WAQ N;  3Q0U A;  2M9H A;  1FTZ A;  1OJL A;  5M3F J;  3K7A J;  5EGO B;  5DTD A;  1TWC J;  3SDG A;  2CQQ A;  1EF4 A;  3NAU A;  5EF6 A;  4IEJ A;  4M3B A;  1HDP A;  1MBH A;  4BY1 J;  3LUR A;  3Q0W A;  2NVT J;  3OSF A;  4QIW N;  3CCY A;  3TP3 A;  4BBR J;  1U8B A;  1BW6 A;  1ETW A;  2XPW A;  5GQQ A;  4G12 A;  2JA8 J;  3JRH A;  1IGN A;  2MGQ A;  4AYZ A;  5KAW A;  3C2B A;  1Y1W J;  2BOW A;  1EXJ A;  1SFO J;  2HVA A;  5JLX A;  2AO9 A;  1IRZ A;  1ETQ A;  5FLV A;  4QSH A;  3O8G A;  1W0U A;  5EG0 B;  2X48 A;  5FKO A;  4IHV A;  1QVT A;  1X58 A;  2CU7 A;  1H88 C;  2XPU A;  2LY9 A;  3S16 J;  3BR2 A;  3Q3S A;  3Q5R A;  2HYJ A;  1QVU A;  5BNG A;  4X1E A;  5GPA A;  1W0T A;  4FE4 A;  5M5Y J;  1ZK8 A;  1XS9 A;  1DU0 A;  2JMW A;  3HOZ J;  1APL C;  1LE8 B;  1JUM A;  3ZQF A;  5DS9 A;  3BTC A;  1NK3 P;  2E2I J;  2H1K A;  3I4N J;  2Y9Y A;  3MKL A;  2GOV A;  2TCT A;  5EGO A;  1ZGW A;  2Y2Z A;  1AHD P;  2K40 A;  3LOC A;  1BA5 A;  3BQY A;  2L9R A;  2VKE A;  3E0H A;  1GT0 C;  3A02 A;  1IDY A;  4XRS A;  1POG A;  2XGD A;  5GP9 A;  4RBO A;  2X9D A;  4J19 A;  3OSG A;  3IH3 A;  4FIS A;  2VUM J;  2L7M P;  3JRF A;  3D6Y A;  2KDZ A;  1ENH A;  2R92 J;  4MO7 A;  3B6C A;  3Q5S A;  1OCP A;  3Q3D A;  1TWA J;  1JUP A;  4B4C A;  3JR9 A;  4JP0 A;  1JKR C;  2NOG A;  4M3F A;  3BG9 A;  2B63 J;  2EZK A;  3BTI A;  4B1R A;  5J1U A;  3S14 J;  4A3C J;  2JA6 J;  2QCO A;  1VI0 A;  2ME6 A;  2ZB9 A;  4BY7 J;  5EG0 A;  3HBL A;  3W6V A;  1BJZ A;  2O8K A;  1ITY A;  2CUE A;  2NS7 A;  1GUU A;  2JN6 A;  2R5Y B;  4I76 A;  1MSF C;  5KCB A;  1IJW C;  2CQX A;  3FK7 A;  2HXO A;  5J3L A;  3HOW J;  2DA1 A;  1B72 B;  4UUT A;  3LNQ A;  1ETY A;  5J1R A;  2JA5 J;  3S2H J;  1NK2 P;  1R9T J;  1LE8 A;  4DW6 A;  3D70 A;  4HNV A;  4IHW A;  2EZH A;  5GPC A;  3CDL A;  3S15 J;  3SJM A;  3JRG A;  4DYC A;  4A3D J;  3JRD A;  2ECC A;  2L0K A;  2ME0 A;  1BL0 A;  1RET A;  1RPW A;  1UG2 A;  5IOY A;  3S1N J;  3O8H A;  9ANT A;  2XPV A;  1U9N A;  3GTQ J;  1NTC A;  5E3M A;  3QQA A;  3VPR A;  2O7O A;  4AC0 A;  3G1L A;  5EDN A;  5M3M J;  3UKG A;  2GM4 A;  3S1Q J;  1WGX A;  1MSE C;  5F0F A;  3LSJ A;  1FIP A;  2WV1 A;  1ZR2 A;  3TW7 A;  1YRN B;  5HOD A;  2L7Z A;  1JJ8 C;  2DMP A;  2GLO A;  5KAX A;  3Q5P A;  3S1M J;  2CUF A;  4XID A;  1JJ6 C;  2Y31 A;  4Y7N J;  2DMQ A;  3HOU J;  1AU7 A;  1JGG A;  2DA7 A;  1WCM J;  2R5Y A;  1VFC A;  3NAR A;  3DCF A;  3HEF A;  4W1U A;  4X6A J;  1E3O C;  2ID3 A;  4LOC A;  1X2N A;  2IAI A;  2DN0 A;  4M3G A;  5FKM A;  2M2E A;  1B72 A;  1HDD C;  5KAV A;  3RZO J;  4XRM A;  1HOM A;  1VND A;  4A3G J;  5IYB J;  3WHC A;  1A6I A;  3A01 B;  3GTP J;  2DA2 A;  3I4M J;  5JLW A;  2IEK A;  2DJN A;  3GTK J;  4MIM A;  4A93 J;  4NDL A;  2JJ7 A;  3Q2Y A;  4D7M A;  5F08 A;  4UUS B;  1OFC X;  4D5F A;  4GFB A;  1FEX A;  2MG4 A;  2H8R A;  5IYC J;  2COB A;  3OIO A;  5IPA A;  3B6A A;  4CYC B;  3BR3 A;  3H3V K;  1ETK A;  4A3E J;  1MBG A;  2X6O A;  1FJL A;  2AHQ A;  3RQI A;  2K9S A;  2YS9 A;  5J1Y A;  4A69 C;  1YRN A;  5EEA A;  4C2M J;  2OPT A;  5C4X J;  3ZQL A;  3QPL A;  1GV2 A;  1ZTR A;  1QRY A;  3CMY A;  1TWF J;  4BXX J;  4M6V A;  3QPS A;  5E3N A;  3GTO J;  3IH4 A;  5FKK A;  2KT0 A;  2VPR A;  4ABZ A;  3BR6 A;  1MBE A;  3IAO A;  3G1O A;  2LFB A;  3JRI A;  3GTG J;  5KAT A;  1ETX A;  2DMU A;  1JT6 A;  5IP7 J;  3FKI J;  1H89 C;  3CQZ J;  2EZI A;  1I50 J;  4FTH A;  2NVX J;  3OOU A;  2IBD A;  5F27 A;  2D5V A;  2MW8 A;  1Z77 A;  3BR5 A;  1WH5 A;  1TC3 C;  2OF7 A;  4BBS J;  4A3F J;  4DZP A;  3A01 A;  3PM1 A;  1IUF A;  1WPK A;  5IP6 A;  2TRT A;  1LFB A;  1GV5 A;  2HOA A;  2K9Q A;  5F0H A;  4UUS A;  5K7F A;  3PO2 J;  4C3I J;  3BT9 A;  2QF7 A;  2ID6 A;  2FD5 A;  3BTJ A;  4XRS G;  1FTT A;  2ECB A;  3L1P A;  2WB1 N;  4CYC A;  5C3E J;  5IP9 J;  4C3H J;  2MSY A;  2XGE A;  2DA6 A;  5IOZ A;  4MFE A;  1XG1 A;  2JK3 A;  4A3B J;  4XIC A;  2DTZ A;  4W97 A;  2DA3 A;  3BG3 A;  2HQ5 A;  2E2H J;  1P7I A;  5FKN A;  3D71 A;  1RES A;  5F0C A;  4AUX A;  2CJJ A;  2LVS A;  3K2A A;  4D7N A;  3IV5 A;  1K61 A;  1AKH B;  1F43 A;  3D6Z A;  1JKO C;  4Y52 J;  2YUS A;  5K7H A;  2HOS A;  4DZJ A;  3E7L A;  3F0C A;  4DYR A;  3ZQI A;  3HGY A;  2R7Z J;  3GTJ J;  4AYB N;  4M3D A;  2HOT A;  3TED A;  3LSR A;  2EQR A;  3R8J A;  2M34 A;  2DA4 A;  3FK6 A;  1GDT A;  1T56 A;  2PMZ N;  3JRC A;  1JKQ C;  3R8K A;  3FIW A;  2VKV A;  1BOW A;  1UHS A;  4A3I J;  1ZKG A;  1S7E A;  4EEF G;  1MH4 A;  2VI6 A;  2LTP A;  3FIS A;  4D5C A;  2KCU A;  2R93 J;  3IH2 A;  2Y0S N;  4C3J J;  1ZQ3 P;  1TWH J;  4MLO A;  3LSG A;  3SFI A;  3S2D J;  1QPI A;  1SAN A;  4A3L J;  3S1R J;  1K83 J;  3TW6 A;  1H8A C;  1FIA A;  1P7J A;  2HI3 A;  5C44 J;  2LR8 A;  5FJ8 J;  3PO3 J;  1JUS A;  1I3Q J;  3D1N I;  2LD5 A;  2XB5 A;  3RZD J;  2E19 A;  3ZOB A;  2NVY J;  1HLV A;  3HOV J;  1R8E A;  2FQ4 A;  3RKQ A;  1AKH A;  1MBJ A;  3BR0 A;  5FKL A;  1D5Y A;  1ETV A;  3G1M A;  2I10 A;  1IC8 A;  4V2F A;  5E3O A;  2EH3 A;  3BTL A;  1U9O A;  1UMQ A;  3ZQG A;  3HOX J;  3GBG A;  1RR7 A;  5KAU A;  5F1J A;  4JX6 A;  1CQT A;  4S0H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...