1D5YA

Crystal structure of the e. coli rob transcription factor in complex with dna
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
288
Chain Sequence
QAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRSPEWSAFGIRPPLRLGEFTMPEHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLNLTRRKGQDIERYYPAEDDRPINLRCELLIPIRRKLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Escherichia coli Rob transcription factor in complex with DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*AP*CP*AP*GP*CP*AP*CP*TP*GP*AP*AP*TP*GP*TP*C
total genus 83
structure length 288
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06445 GyrI-like GyrI-like small molecule binding domain
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1d5yA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1d5yA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1d5yA03
2HYJA 1FTTA 1HF0A 1MNMC 4G12A 4A3DJ 1GV2A 1SFOJ 2IBDA 5JLXA 3BR5A 1GV5A 1WH7A 3FIWA 1X2MA 3JRAA 2ECCA 1TWFJ 1AU7A 5J1RA 4DYRA 1WI3A 2HOAA 1GDTA 1JJ8C 4CYCA 2HQ5A 3JRBA 2HVAA 4MFDA 3JRIA 2JA8J 4BBRJ 2R5ZA 5M5XJ 1I50J 2VUMJ 1JJ6C 2CUEA 3BR6A 2R92J 4AC0A 5C4JJ 3GTMJ 2NS8A 3B6AA 1FTZA 3CCYA 4EEFG 4A3IJ 2DA5A 3RZDJ 2HDDA 1G2HA 1U78A 4A3CJ 3S16J 3I4NJ 1APLC 4C2MJ 4DW6A 1POGA 5DTDA 3TW6A 1Z0XA 2M9HA 2DA6A 5KAVA 3GTKJ 2HI3A 4DYQA 1IG7A 2XRLA 3PO2J 3Q5RA 3CDLA 1RETA 1MBJA 4GFBA 3MVPA 3Q5SA 2AHQA 2NOGA 1EF4A 1HOMA 2ECBA 3FISA 1BJZA 1HDPA 1U9NA 3CQZJ 4M3GA 5J3LA 1MBHA 5EGOB 3FK7A 5F0FA 1RKWA 4XRSG 4HNVA 3HOXJ 4M3BA 5J1UA 1E3OC 3GTPJ 5EGOA 2DN0A 3LNQA 3PM1A 3G1LA 5IPAA 4D5FA 3Q5PA 2XSDC 2IEKA 1ETXA 1BL0A 1IJWC 5IOYA 2WB1N 1ZKGA 2JK3A 5GPCA 3BG5A 3W6VA 4FTHA 2JMWA 4W97A 4D7MA 3K7AJ 3JRDA 2EH3A 5E3NA 1OFCX 2YS9A 4B0YA 2XPWA 1ZTRA 2ME0A 1RKTA 2ELKA 1Y1VJ 3GBGA 5FKOA 3TW7A 4ABZA 1HDDC 5J1YA 5IYCJ 2GLOA 2CJJA 4D7NA 4QTRA 3ZQGA 5F08A 3OSGA 2WAQN 3E7LA 1Z77A 1IDYA 1AHDP 4QSHA 3C2BA 4C3JJ 2QCOA 1H8AC 2BOWA 1JYHA 2OPTA 4NDLA 4BBSJ 1D5YA 1EXIA 1MBFA 3HGGA 2CUFA 2HOTA 5EZGA 3H3VK 2TCTA 4V2GA 2R7ZJ 3LSRA 4Y52J 2L7FP 3HM5A 3ZQCA 1BW6A 4MO7A 5JLWA 3BTJA 5EYRA 4A3MJ 3FKIJ 1LE8B 4A69C 4UUSB 1IGNA 5F1JA 1EXJA 4JX5A 5EZHA 5C4XJ 3TEDA 4JX6A 3NARA 3WHBA 1LE8A 1JGGA 3ZQHA 3TP3A 4B1RA 1W0UA 2DTZA 2LY9A 3IAOA 2NS7A 3HEFA 5FKNA 4QIWN 1VNDA 2VPRA 2EBIA 5IYDJ 2IAIA 3OOUA 2H8RA 1RPWA 1I3QJ 1MBEA 3JR9A 4RBOA 3O8GA 1ENHA 3BR3A 3CMYA 2E2IJ 3GTQJ 1GVDA 3M4OJ 3NAUA 1MSFC 1ZR4A 2DA7A 2MW8A 5FJ8J 2Y9YA 3VPRA 1GUUA 2NVYJ 2CQXA 1IC8A 3WHCA 2LP0A 1JUSA 1UHSA 3ZQFA 1NK3P 2LR8A 2G0EA 3SFIA 3RZOJ 5GPAA 4A1MA 3BG3A 3HOUJ 4B4CA 1PUFA 2K40A 5EF6A 2O7OA 5C3EJ 2GBYA 5IP7J 5EG0B 1XS9A 2JA6J 1JT6A 1FIAA 3ZQLA 4S0HB 2R5YB 4FE7A 5EG0A 1A5JA 3S15J 1XC5A 4XRMA 2NVXJ 1WCMJ 3Q3SA 1OJLA 1OCPA 3BR2A 1YRNB 5M5WJ 2W48A 2R5YA 1VI0A 3HKZN 1ETYA 3LSGA 2AO9A 5HODA 2KT0A 2XGEA 3LSPA 3GTOJ 4M3DA 1MH4A 1AKHB 4IEJA 2Y2ZA 3JRGA 1O4XA 1R8EA 1XG1A 4XK4A 1VF9A 4L5EA 3IH4A 1K61A 3Q0WA 3S1MJ 1ETKA 1BW5A 4A3LJ 3RKQA 1U8BA 2RAEA 2LK2A 2XGCA 3S17J 4A3KJ 3QQAA 3R8KA 2GOVA 1MBGA 1DU6A 2I10A 2XPUA 2B63J 4LOCA 4FCYA 4A3JJ 4IHXA 3IV5A 1TWGJ 1T33A 1CQTA 3S1QJ 5K7HA 2LFBA 1JKQC 3S14J 1H89C 3MN2A 2YU9J 1ITYA 1T56A 3Q0UA 5IP6A 1I6HJ 3BG9A 3K2AA 3A01B 3HDDA 1B72B 1QVTA 4A3EJ 2EQRA 1A6IA 1JUPA 3LSJA 4MLOA 1JKOC 4IHVA 3HB9A 4V2FA 2TRTA 4BY1J 3PO3J 5FKKA 3S1NJ 3O8HA 5M3MJ 4C3IJ 2DMQA 1ZGWA 4XIDA 3D1NI 3SDGA 5F0HA 5E3MA 3BTCA 4XICA 5BNGA 1QPIA 1F36A 1WPKA 2NVTJ 4FE4A 1MSEC 4X6AJ 2D5VA 4UUTA 4MFEA 4MIMA 1BA5A 1TWAJ 2LVSA 2FD5A 3Q3DA 1ETOA 2CQQA 2PMZN 5GP9A 2N8GA 3B6CA 3HGYA 4W1UA 4I76A 4B3AA 1TC3C 3BQZA 1JKPC 2LTPA 3D71A 2ME6A 5IYBJ 2X6OA 1ZK8A 5K7FA 3S2HJ 2GM4A 3JRCA 2E1OA 3BR0A 5KCBA 5IP9J 3BT9A 3D6YA 2JWTA 2DJNA 3QPLA 3LOCA 2EZKA 3ZOBA 2L7ZA 3QPSA 4BKXA 1AKHA 2VKEA 5F04A 1ETWA 2JJ7A 1JKRC 2Y31A 4FISA 2FJ1A 2ID3A 2VI6A 4A3BJ 1P7IA 1UG2A 1W0TA 2FX0A 5F27A 4A3GJ 1PUFB 1JT0A 3E0HA 5F0CA 3BTIA 4DZPA 3A02A 1NTCA 5M3FJ 2OF7A 4M3FA 3GTJJ 1NK2P 4M6VA 1RR7A 3OSFA 1F43A 1SANA 3BR1A 2ZB9A 4DYCA 4C3HJ 4M3EA 3TP0A 4JP0A 3Q2YA 3HOVJ 1HCRA 2XGDA 3SJMA 4RDUA 3JRHA 2EZIA 2L7MP 4Y7NJ 3A01A 2M34A 2HXIA 3S2DJ 4AUXA 3A03A 2VKVA 3S1RJ 4CYCB 3GTLJ 4X1EA 2QF7A 1DU0A 2JA7J 1IDZA 2R5ZB 5E3LA 1FIPA 5DS9A 3H0GJ 1JTXA 3DEWA 2R93J 3DCFA 4AYZA 4BY7J 5GQQA 3HBLA 4UUSA 1MBKA 4A3FJ 2DMUA 1TWCJ 2O8KA 2MG4A 1P7JA 5IOZA 3BTLA 1RESA 2E2JJ 2CRGA 3JREA 1LFBA 1IUFA 2LLKA 2Y0SN 2KDZA 3G1OA 4AYBN 3B49A 2XB0X 2EZLA 2NVQJ 3HOZJ 2LD5A 1JTYA 1B72A 5KATA 3F0CA 2K9SA 2DMPA 3BQYA 2XPVA 4BXXJ 2JN6A 5FLMJ 1B8IA 3D6ZA 3L1PA 2DA3A 1Q1VA 5E3OA 3JRFA 2M0CA 5FLVA 3GK6A 5K7ZA 3HOYJ 1GT0C 2COBA 1FEXA 1B8IB 2CU7A 3IH3A 1WGXA 1U9OA 2K9QA 2E19A 4I6ZA 5EDNA 1TWHJ 2ID6A 1X2NA 2MGQA 3FK6A 5FKLA 3MKLA 1WH5A 1FJLA 1QRYA 1H88C 2M2EA 2O9LA 4D5CA 2X48A 3IH2A 1ETVA 5KAWA 1X58A 3M3YJ 1K83J 2HXOA 5FKMA 5EEAA 3UKGA 5KAUA 3Q1MA 2Y9ZA 4JX4A 1Y1WJ 2L0KA 1YRNA 2DA4A 1MH3A 2Y30A 1S7EA 2E2HJ 1UMQA 2P81A 1JUMA 3Q0VA 3I4MJ 2X9DA 1ZQ3P 1IV6A 2M8GX 2R0QC 2JA5J 4IHWA 1ORKA 2MSYA 1OCTC 2L9RA 4XRSA 4IHYA 3LURA 2DMTA 2LKXA 2DA2A 2H1KA 3G1MA 4DZJA 1R9TJ 5C44J 2XB5A 3RQIA 9ANTA 2KCUA 1QVUA 2DMNA 2DA1A 2FQ4A 4JYKA 1ZR2A 3OIOA 1IRZA 5M5YJ 2EZHA 4AYZB 3ZQIA 2K9NA 2WV1A 1ETQA 1LFUP 4J19A 3D70A 3R8JA 3HOWJ 1VFCA 4A93J 1HLVA 2YUSA 5KAXA 1BOWA 2HOSA 3GTGJ
chains in the Genus database with same CATH superfamily
2M30A 1HF0A 1Q1HA 4A3DJ 1GV2A 1BOBA 2IBDA 3PFIA 2L2OA 5AIPA 1FSHA 4HLXA 4XRFA 3FXRA 4NC6A 1WI3A 3LA2A 4A0XA 1F5TA 1FZPB 4IQJA 1TTYA 1YIJI 4CCKA 1WVRA 3DP7A 4BBRJ 2A69F 1FBUA 2R92J 1FPQA 4MQ9F 3E3VA 4KIGA 1AOYA 4XLCA 2H6BA 3CCYA 4EEFG 4A3IJ 1K78A 4YIIA 3E0JB 5TJJA 3S16J 3K10A 3GFLA 1FP1D 1Z0XA 4LITA 2M9HA 2XF7A 5KAVA 4U0VA 3VODA 1O3SA 3KYDB 2Q2EB 3HHGA 5B5EC 1R36A 3OYHA 5KK1A 1RETA 1W7PD 2L9NA 4CO8A 2CUJA 3K4NA 4HV5A 2XIGA 4ON0A 3SFZA 2HQRA 3NWSA 3ZPLA 3OWTA 4XQFA 2EFPA 3HHHA 3CQZJ 4KITB 4GYIA 2LRDA 1MBHA 1NH3A 1P4WA 4JK1X 4XRSG 4OMYA 1UHWA 5F6FA 3J7ZI 4KNYA 3TKYA 4QPQA 4D5FA 1EA3A 3Q5PA 2X51A 4ENNA 1OPCA 5ED4A 2KPMA 3BLYA 2XSDC 2IGKA 5IOYA 2WB1N 5GTIC 2ZJPF 3W6VA 2E1NA 5CKTA 5HNFA 2JMWA 4HX4A 4LG0A 4D7MA 4HF2A 1QGPA 3RPQA 4BXFA 4EJVA 3ELKA 1ZTRA 2DTRA 2ELKA 1Y1VJ 4UB6C 3TW7A 1HDDC 3LSTA 5IYCJ 2CJJA 3FMQA 5GAGJ 1UFMA 1Z7LA 4LLGF 4O3MA 2J5PA 1Z77A 4UV8A 4DIQA 3OL4A 2BOWA 1YW9A 1RUNA 2OPTA 3WG9A 4BBSJ 1HSTA 2R7WA 2QA4I 2L9SA 2CUFA 5D5VB 3QYBA 1DDNA 3H5AA 2CFOA 1IZ1A 2WAQA 3IKTA 5K1YA 2F6CA 4OOIA 3EETA 3M8FA 3OYFA 2R7ZJ 3CCVI 3EUHA 3F8NA 2ICWG 2P5LC 3HRUA 3MFKA 3ZQCA 1BW6A 3V7CA 4CCOA 3KETA 5EYRA 5J40A 4IZZA 3VWBA 4A69C 3RKYA 4UUSB 1IGNA 5EZHA 3ZMZA 1QBJA 2P7CB 3SDBA 1KYWA 1WJCA 2KDOA 1YLFA 2DYRH 1WJ5A 2YU3A 3GF2A 1JGGA 4MTDA 1FYKA 3A0HC 2F2EA 3FF5A 2DTZA 2NS7A 4YG2F 3HEFA 1WQ2A 3JSOA 1XX5A 2IAIA 1U0JA 2LREA 3OOUA 4BJTA 4RGRA 3P9KA 3JR9A 2RQQA 4NQWA 3TO7A 4R8HA 3CMYA 3LSKA 3M1EA 3L2WA 1MDMA 2CYYA 3A0BC 2F4OB 1ZR4A 2EFOA 2DA7A 2OTJI 5FJ8J 5IT9Z 4PZJA 1MDMB 2NVYJ 1RIOH 2CQXA 3D0SA 2CQKA 1S29A 5TISC 3WHCA 3CF2A 4A5MA 1USTA 1L3LA 1FNNA 1UHSA 1VQKI 3CC2I 2B0LA 1WJDA 4RGSA 2LY2A 3DEEA 2WV0A 3HRTA 3SFIA 4KN4X 3TDUC 2BOLA 3H0DA 1PUFA 2K40A 3JTGA 2O7OA 3KP5A 2GBYA 1D1BA 2VIXA 5CVRA 5J4YA 5EG0B 1XS9A 2G9WA 2FOKA 3DBHB 4BYYA 3K4JA 3ZQLA 4S0HB 1D8KA 5EG0A 1A5JA 5JHFA 3L09A 3WU0A 3S15J 3K0LA 1B9NA 2NVXJ 3I54A 1KGSA 4FETA 5CJ9A 4CZCA 2QBYA 2EA4A 4GO1A 1VQ4I 1J9IA 3LSGA 3HUGA 2XGEA 5HLHA 4CCMA 4ENJA 4M3DA 5CVUA 1MH4A 3GZ5A 4IEJA 4KUMA 4M6XA 2HVSA 3JRGA 4ZYEA 1R8EA 2JPBA 2L01A 4L5EA 2STWA 5FO5A 3IH4A 3BPXA 1E0EA 3KFWX 2JVGA 4I0AA 1BW5A 4A3LJ 2E60A 3RKQA 4U0WA 4DNCA 5BMZA 3GEZA 1VQ5I 2RREA 4DGWB 2ZNZA 5CQGA 3I5UA 2VOPA 1DU6A 2O3FA 4IQ4A 3ZQ7A 4B44A 3DWLE 1EH8A 1NG6A 1JE8A 4AIHA 1CQTA 1LFPA 1IF1A 2BBYA 2EFQA 2LFBA 1SMYF 4WF2A 4HDUA 3MN2A 1YFHA 5DD4A 4D9JA 1ITYA 5IP6A 1MNDA 2ZFWA 3H3UA 2DT5A 2FBHA 4XKBA 3KEOA 3HDDA 2DO7A 4IJAA 3JSPA 1KQ9A 1B72B 2V4JC 4HAMA 2P8TA 4IHVA 1JKOC 3OYJA 1UHMA 2JA2A 3HB9A 4ETSA 2OTLI 3K4MA 1MW7A 3KEYA 3DPTA 1NG7A 2A5WA 2M4KA 5FROA 3KYLA 2OJED 3D1NI 4LG3A 5F0HA 2F5EA 5E3MA 4XICA 3RYPA 3SEZA 4QPOA 2PJRB 3L2VA 3RYRA 3TO9A 3J81Z 2FQ3A 1WPKA 2W4SA 3U1DA 2VQLA 2NVTJ 4XOPA 2STTA 5ICCA 4UUTA 5HLTA 3REOA 4MIMA 3M1CA 3PNTA 3LFKA 5J47A 1ETOA 4BQOA 4W1UA 2PMUA 3BCBA 3HGYA 5GP9A 2D45A 1AWCA 4I76A 2EFNA 4XOTA 4A6EA 2LTPA 5J6XA 2O6GE 3D71A 3VYSB 1S72I 2R7VA 2JUCA 4IO9F 4G94A 1TW3A 3EYYA 5FGMA 4V19K 1Y39A 2VXDA 3S2HJ 3I3LA 1XPXA 2P4WA 3BT9A 4MTEA 1WJBA 1R22A 3QPLA 3LOCA 5DCMB 2L7ZA 3QPSA 1X3UA 3C1DA 1ETWA 5D5UB 1R00A 1PP8F 5H6RA 4B47A 2FJ1A 2ID3A 1J09A 2XAUA 5F27A 3SYTA 3CCSI 1PUFB 2KMUA 1JT0A 1QZYA 2KFDA 2BXZA 3BTIA 3S3NA 1OCZH 1NTCA 1ZAOA 4XLEA 3GYHX 2OF7A 4EJUA 3KPHA 2MLKA 1NK2P 2QM3A 4CICA 4LB6B 4UXNA 2IXSA 1T2KA 2KLOA 3RJPA 3TP0A 5E1XA 4U87A 1BC8C 1VQLI 3HOVJ 2XGDA 2OU2A 3R0JA 1VQ9I 2EK5A 4IX7A 2KKOA 2L7MP 1SD7A 1X1AA 2P6TA 4NC8A 3N97A 2BEOA 3G6EI 2EV6A 3ESWB 4XSXF 5K5QA 4ESBA 1IDZA 2ZXHA 4BJ5C 1FSEA 2HOEA 3LSHA 1ZLKA 5E3LA 2ZXJA 3T0YA 3V8LA 5D8KB 5DS9A 4JQFA 3W3CA 2PJPA 3DEWA 5BOXA 3K4KA 2ZSHB 3MKZA 4BY7J 3HBLA 1SMTA 2K5CA 3KP2A 2M87A 1FMWA 1TWCJ 1VZ0A 2NNNA 2XV4S 2A6HF 2EIKH 3BTLA 1RESA 4A0ZA 5IOZA 2CRGA 1IRXA 3JREA 3FXJA 5K5RA 2Z1DA 1LFBA 2LLKA 2KDZA 3G1OA 1BI3A 2XB0X 2QQ9A 3DF8A 2O5RA 3FXUA 4UY8I 1JTYA 2E34A 1B72A 2K9SA 5KAIC 5A2QK 2CV0A 2BVLA 3K9TA 2DMPA 2M4GA 3OL3A 2XPVA 2JN6A 1N77A 1YIOA 1UJ8A 2IA0A 2V6EA 1X1PA 4E7ZA 3AAFA 5KVRA 2IS4A 3WTWC 2COBA 2GXBA 1FX7A 2OUMA 2CU7A 3IH3A 1FEXA 4PGGA 1WSUA 3BCAA 2NAZA 4RAYA 4YELA 4CUGA 5HS9A 4UHTA 2E36A 3WGGA 1TWHJ 3HPGA 3H5RA 4G9YA 4KT6A 1X2NA 4XKWA 2VJIA 5FKLA 3RKWA 3MKLA 1E17A 4RB3C 1QRYA 4Y15A 3S2WA 1X1CA 1DGWY 4ANJA 4D5CA 2X48A 2VC1A 4BEHB 3M3YJ 3HRSA 2QQ8A 2HTJA 3ZP5A 3MZHA 1XSDA 1J2XA 1FT9A 4HYEA 1HC8A 4P9FA 1Z91A 2HVQA 2X85A 3KYCB 4Z2YA 1FLIA 1YITI 5E79C 2EB7A 2XF6A 2EJRA 1LNWA 3ISPA 3I4MJ 3X2QH 1KQ0A 2QKMB 3DTKA 2F5DA 2JA5J 2L9RA 2VODA 3LURA 2TDXA 2DA2A 1YQAA 4XNFA 1R9TJ 1V55H 3LA3A 3WODF 2JRTA 4E4HA 2C6YA 2QGUA 1QZEA 3RQIA 3C3WA 3WGIA 3QYEA 1MJBA 2ZC2A 5ICGA 5B3SH 2I5UA 2WAFA 3ASNH 1E3PA 2HYFA 1BIAA 2FQ4A 4HW0A 1ZLJA 3EQLF 4JYKA 4KICA 2OZUA 3IRQA 1IRZA 2DI3A 4AIDA 4DJAA 2EWNA 4HPQA 2EZHA 3HOTA 1IXCA 1R5ID 3ERED 3CZ6A 2V7FA 2W1OA 3ZQIA 3CCEI 3BG7A 1T6SA 5HLIA 3D5LA 4G6QA 2NYXA 2WV1A 4ASNA 1D0ZA 1ETQA 1LFUP 3I56I 4J19A 4ZYHA 4Q48A 2KIQA 3D70A 1VFCA 4FT8A 2V1NA 2HYJA 1QU3A 2HVRA 2GA2A 5JLXA 1GV5A 3DQVC 1X2MA 2HZDA 2MFZA 3IC7A 3PL8A 3J80Z 2F5FA 4DYRA 3FXQA 2HVAA 4PUSA 3OYAA 1SFEA 2JA8J 1YOVB 1D1AA 2EPFA 4M9SA 3DKWA 4XL9A 2CUEA 3GXOA 4AC0A 3PQJA 2PBIA 5C4JJ 1X1BA 4IRGA 3DLLF 2WBMA 3E6CC 1FTZA 3DBRB 2HDDA 1IN5A 2NXNB 4AIKA 3OYDA 4A3CJ 3TDZC 2KIMA 3R4KA 1POGA 3FXMA 1W7PB 3PUBA 5DTDA 3TW6A 3QWLA 2PLYA 3OYGA 1S7OA 2V6CA 3ZCOA 4BDYA 2XAJA 3PO2J 6PAXA 1OYIA 1U2WA 3MVPA 3P7NA 5J8CA 2MD5A 3FISA 4ZDLA 3EUHC 4CGZA 1U9NA 4M3GA 4PJLA 5J3LA 4HF1A 1MIJA 2GZWA 3WTZA 2UWMA 1KU2A 2OCCH 5IT3A 4HNVA 2L4MA 1SFUA 4XMYA 3H35A 5DYMA 3PJRA 2EV5A 2VOOA 3KZZA 3HZJA 3LA7A 2Y48A 3PM1A 3RIRA 5DUIA 1RZ4A 3G1LA 1ZRDA 2BY3A 2XKOA 3FWEA 3BWGA 2QKLB 1WKMA 4N9IA 2IEKA 3M07A 2A68F 3VEPA 1BL0A 4M72A 3TBIA 4BEHA 3OS0A 3HL2A 3E6BA 4F55A 3F6VA 3QPTA 4L5IA 4W97A 1FYLA 3K7AJ 2VN2A 3AFHA 2XSJC 2L02A 3EUKL 2YS9A 3G73A 4A5NA 3KZYA 5FB2A 1O57A 1I6XA 1ULYA 2DT7B 2WTEA 3GMEA 5FRNA 1YHQI 1I1GA 5CVIA 4G7OF 2IGMA 3VFZA 4QTRA 3ZQGA 5F08A 4UNOA 2WAQN 3E97A 3E7LA 2GXAA 3ZN0A 4QSHA 1PJRA 3G71I 2RN7A 2H09A 4HG2A 3NWTA 1EXIA 1RRJA 4HDVA 1SFXA 3I53A 2KJBA 3HSFA 3GWZA 1BR4A 2PQ8A 5EZGA 2DQRA 4F52A 3G3ZA 2HOTA 1MMSA 1O7LA 3CCRI 3H3VK 5HDNA 1FBSA 3KLNA 3GFJA 1TZLA 1TP4A 1X3WB 4V2GA 3ZMDA 3LSRA 4L0ZB 1QA6A 5L3BA 1PP7U 1K78B 2ZSIB 5JLWA 4M6YA 4ENMA 5C4XJ 2Z5UA 5E18F 1TLHB 4XKCA 5GAHJ 2RQPA 4JX6A 4HQEA 1FOYA 2F4IA 1LE8A 3GUDA 4CCNA 4RM2A 3CCMI 4AVZA 2Q2EA 4B1RA 3TP3A 1IRGA 3S8PA 1RUOA 2FUG2 4QIWN 1W4MA 1OKRA 1V5GA 5IYDJ 2FRHA 1R58A 3W2AA 3O8GA 1ENHA 3BR3A 1YX5A 4K2EA 4OMZA 1FYMA 2AXTC 4LMYA 3R60A 1QZZA 2MW8A 4AD9A 3E5XA 3CTAA 3VPRA 4B09A 4M71A 1YTYA 1J5YA 2KQRA 3VYTB 1IC8A 2LP0A 2Y69H 2GIVA 3Q9VA 5D5WB 1JUSA 1QO0D 3ZQFA 4M9ZA 1VQ8I 1IXRC 1IV8A 1XN7A 1ZHFA 3V8JA 2JPCA 1R6RA 2F4MB 3FHZA 3E6MA 1LDDA 2KZVA 3BG3A 1PUEE 2NVUB 3GO5A 1Y0UA 4YIFA 4ZDPA 4B4CA 4EM2A 3GLXA 2IS2A 1J0RA 1ZG3A 4EV0A 2JA6J 3E1SA 4LG0B 1FIAA 5HS8A 4IHTA 4FE7A 4ESJA 4BGDA 3I59B 4XRMA 4I01A 4MGRA 1Z3XA 4EJWA 1IXSB 1OJLA 4R79A 3SQNA 1QHGA 2W48A 2R5YA 4XLAA 4NB5A 3T5XA 5JI6A 1EH7A 3L9FA 3LSPA 4UVAA 3ABKH 5HNHA 4BDZA 3IWZA 1TL8A 4UV9A 4MEXF 4ENKA 4BHBA 1DUXC 2ADUA 1K61A 2FMYA 1EKEA 2IJLA 4RS8A 4HA8A 2WC2A 4E7JA 1PYVA 2M1BA 5E1ZB 1MJ9A 3CO7C 4E7IA 2XGCA 3K1NA 4A3KJ 1OR7A 1A6QA 3R8KA 4BXUA 2LG4A 2XPUA 3OR2C 3ECHA 3ASOH 3GZNB 2DDAA 2VQGA 1HW5A 1P2FA 4A3JJ 3GW2A 5LHGA 3IV5A 1IAWA 2FNAA 3OV8A 4XN3A 1T33A 5GADJ 3S1QJ 3WG7H 3LFUA 1U6GA 3DKYA 4A0YA 3S14J 3RCOA 1HA8A 1S5LC 2RDPA 4ZYAA 4N4NB 1R71A 1Y0NA 2WAEA 1V3FA 1QVTA 4Y13A 3HIFA 2CWEA 1W36D 2X6XA 1JUPA 3LSJA 4MLOA 2CH0A 3FM3A 3SZGA 4OIPF 4EMSA 5FKKA 5M3MJ 5TRDA 1BIBA 4XIDA 1OCRH 3RPUA 1V5FA 2ZBKA 2QLZA 3DEUA 3COAC 3AG4H 2CFXA 2LKPA 5B66C 1UZCA 2XC7A 4QLCU 5CQEA 4X6AJ 5IY5H 2L5QA 2D5VA 4WX9A 2FE3A 2WY8Q 1BA5A 1YJNI 4KT5C 2D1HA 3H1CA 3T8TA 2FD5A 3F23A 3Q3DA 5H2FC 1GXQA 2EILH 2LC2A 2W00A 3CLQA 2N8GA 4XBFA 3BQZA 2IA2A 4I02A 1N78A 4N0BA 3BJOA 3PNVA 1TW2A 1IN7A 5K7FA 4KA4A 2E1OA 4ESFA 2VQCA 5KCBA 1W1WE 5IP9J 1Z3YA 1VQ7I 2VJ5A 5LGUA 3D6YA 2EZKA 4AU7A 3F9KA 4YRVA 2VKEA 2NS0A 2WA0A 1T38A 2JJ7A 2ZFUA 1T39A 1JKRC 4FISA 2V1UA 2VI6A 1JXSA 1EV7A 3LMMA 1E2XA 1UG2A 1W5SA 5A2QZ 1W0TA 1I3AA 3BJ6A 3RQ4A 4UVCA 4KYWA 2ZMEC 1HKTA 2E7XA 1FBQA 3SZTA 3TOBA 3QP6A 2XHKA 1KU9A 3LQRA 4U0YA 2G7HA 3V4GA 1RR7A 4BQNA 2P6SA 1F43A 4I99C 4DBRA 4DYCA 1G4DA 1ZELA 1IN4A 2AS5F 4I09A 4DQ2A 2QEXI 2PX9A 4O6JA 2A07F 3Q2YA 2DU9A 1YI2I 1HCRA 1Z6RA 4RDUA 2MABA 5DCFA 5F64A 1XDUA 3I55I 4Y7NJ 1CGPA 2M34A 2HXIA 4CCLA 1LEAA 4LJZF 3HXLA 1K4SA 2LSOA 2VBZA 1LDJA 3B73A 3WTSC 2IT0A 3S1RJ 4CYCB 3CDHA 2DDBA 4JBAA 5ICFA 2QF7A 3FXOA 3CF5F 4IVNA 2Z33A 1V4RA 1FMVA 1FIPA 1S8NA 1WJEA 1ZH5A 4IRHA 4G8XA 2L3DA 3CMMA 3NQOA 1KU3A 1B1BA 3DCFA 3OYNA 1KONA 4A3FJ 1MBKA 1W36C 4CHUA 1XTAA 2YSRA 4BE2A 3L2QA 3VYUB 1REPC 5L3CA 3EDPA 4KMFA 3WU2C 3I4PA 2GOMA 4WXDA 2FU4A 2M3AA 2DPUA 3CUQC 3B49A 3IKVA 2V1XA 4R1HA 4AYBN 2KP6A 3KZIC 1OYYA 3V8KA 2NVQJ 1SVMA 5J4VA 3TGNA 3F0CA 4M74A 2FOWA 1IO2A 4O5VA 4OWRB 3BQYA 4D0PA 2CV1A 4WXHA 4BXXJ 3BROA 1SD5A 5FLMJ 2R7TA 4XKVA 3D6ZA 3L1PA 2VONA 3J80K 3H3ZA 1SAUA 3GK6A 4NUBA 2VT2A 2AQFA 4XLPF 5K7ZA 1WFXA 3I9V2 4EM1A 4OIRF 1K6YA 2FNPA 1P92A 1BR1A 2X4HA 2CUZA 2DQLA 2V9PA 5EDNA 1OCCH 2MGQA 1H9TA 3FK6A 2EIMH 4BJ6C 5ILUA 3BPVA 3DTEA 3C18A 4OAZA 3AL0C 4BAYA 1UAAA 2O03A 2BE5F 4L9JA 3IH2A 3ZMVA 5KAWA 3I0TA 2VE8A 3UKGA 2YR2A 5KAUA 4KJZA 2BHZA 3GFIA 1PDNC 3EPZA 5L3GA 2Y9ZA 3Q1MA 2ETHA 1YRNA 4EM0B 1HW2A 1D3YA 2Y30A 4XM3A 3MQ0A 3AL0B 3O3KA 3HJEA 2MH2A 4RLFA 3Q0VA 3L2UA 1KU7A 1OQYA 3Q9SA 1IV6A 3G2BA 3H92A 2F48A 2R0QC 2E35A 2BZTA 1ORKA 2D1VA 1UB9A 1T8IA 2FA5A 3PIOF 1Z05A 3DLAA 2XGXA 3OOPA 1GVJA 5C44J 4FASD 5K5OA 2CQNA 2KCUA 1XD7A 1WWXA 1JHHA 2DMNA 1HXDA 1XMXA 2LYCA 2GIZA 1OMIA 3OIOA 1YW7A 5M5YJ 3FBIB 5L3FA 2BVMA 2PG4A 1S3JA 3R8JA 3ZR8X 5KCMA 3AG3H 1XGMA 2HFHA 2Q1ZB 3IWFA 1HLVA 3KP6A 2FMLA 1X1DA 4XLHA 4BE1A 1BOWA 4AYBA 4N9HA 3GTGJ 3OYKA 3OYIA 1XCBA 4PK4A 1FTTA 3MD2A 3KP4A 2E1MB 2KRHA 2IVMA 1MNEA 3BR5A 1A31A 3ZMSA 1WH7A 3JRAA 2FXAA 2MYSA 1GLNA 1TWFJ 2YX4A 4IKFA 5LRRA 2HOAA 1T95A 4GYGA 4CYCA 3MCZA 2HQ5A 3GVAA 3JRBA 3FXKA 3L2RA 2R7FA 3F6OA 1ZN2A 2VUMJ 1XMAA 1Z9CA 2E1MC 2DXIA 3QOEA 1LKXA 3B6AA 1UCRA 4F7ZA 3HKZA 2DA5A 3RZDJ 3A4CA 1G2HA 1VQPI 5CPRB 1U78A 4RB0A 2V1DA 2HPIA 1APLC 5JR3A 4HEA2 5KNLA 2HI3A 4DYQA 3LQQA 4U7DA 1WI9A 2XRLA 5HOOA 1TQIA 4GFBA 3J7AO 1IUYA 2NOGA 2OD5A 4RMNA 4ZC3A 2CSOA 2ECBA 3K1PA 1MMGA 4H4KC 2K86A 3KCCA 2WB1A 4G6TB 4EATA 3CJQB 5KHDA 2UZKA 5EGOB 5FRMA 5F0FA 4H0EA 2K85A 2JTVA 3QP5A 3RI4A 1YX3A 2PFBA 5LEJA 4BHCA 1SEUA 3F3XA 5J1UA 5D4SA 3WTTC 1FOKA 5EGOA 2Z9OA 5E8IA 4LGWA 3BZCA 5EEHA 1TT0A 2LDUA 1CF7A 1ETXA 4L0YB 1YG2A 2FEZA 1IJWC 1ZKGA 2JK3A 4PSXA 4L18B 3ZXSA 5B1AH 4FTHA 3BZ6A 2DW4A 3U1KA 2EH3A 5E3NA 1A36A 1BJAA 3ZMTA 2L4AA 5LEKA 4I0BA 1X4PA 4YFKF 2LNBA 4HBLA 5J1YA 3IAM2 1WJAA 5E20A 4CCJA 2ZJRF 2H6CA 3F8BA 1TQMA 3OSGA 2ELJA 2MBFA 1IDYA 1AHDP 3C2BA 4C3JJ 2QCOA 4LK1F 4LIUA 1H8AC 1JYHA 1IW7F 1H9GA 4NDLA 1D5YA 2K02A 3QAHA 4ITVA 1MBFA 2M7AA 4PJJA 3HGGA 2E71A 1X4OA 3M8JA 4EGZA 2DFEA 4ZH4F 5ERIA 2TCTA 4P1WA 3TMOA 1RC9A 4A93J 4Y52J 3HG9A 1K4TA 2L7FP 5LD2C 1HSJA 3HM5A 4MO7A 2K9MA 1FOWA 4A3MJ 3FKIJ 2UXNA 4OAYA 2A5YB 2HQNA 1D8JA 1I1SA 4PJNA 1G59A 3NARA 5D6EA 4GDFA 3CJNA 3PUFA 5LFAA 4IOCF 1TT5B 5BQTA 4F3QA 1WZ2A 3ZQHA 1W0UA 4MHGA 4NQWB 5HLGA 3I58A 3J81K 4AM3A 1ZYRF 1VNDA 2VPRA 4M73A 2EBIA 4Q47A 2H8RA 2A6TA 4RLQA 4C9YA 1KA8A 4XONA 2E2IJ 3GTQJ 2DOAA 1YW8A 2COMA 1SVLA 1ACIA 2ZNYA 5GAEJ 1OLTA 2Y9YA 1Y6IA 1Y8QB 1R4MB 1OISA 4HZFA 2HR3A 2ZXWH 3D5RC 1VQMI 3MWMA 1EH6A 2LR8A 5J8FA 2XAHA 2QZ8A 2G0EA 3RZOJ 2GAUA 2WY7Q 3HOUJ 2ZO4A 3J7AY 1QQIA 3S32A 2ACJA 5IP7J 1IN8A 4LK0F 3PSIA 1JT6A 3E5UA 3AG1H 2K7LA 2LBFB 1DQUA 3KEQA 2QSGX 1UG0A 3H9QA 2IS1A 3BR2A 1OCPA 5M5WJ 2VT3A 1VI0A 3HKZN 2FSWA 4NC7A 3DFGA 4KIBA 3CCUI 1XGNA 5HODA 2KT0A 3JAMZ 3GTOJ 3L00A 3IRRA 1GXPA 1AKHB 2XRNA 4XLFA 2X6WA 3T8RA 3LL7A 1W5CC 5TGTA 1LVKA 3FHNA 5DM7F 1DP7P 1P4XA 2CS3A 2BW3B 2DJIA 2DPDA 5H20A 3R61A 5L3DA 3U21A 3OS2A 1BM9A 1LJ9A 2LK2A 3U9GA 2HDWA 1LQ1A 3S17J 4OIQF 1T98A 2BW3A 4P96A 3CO6C 2GOVA 3HSRA 1MBGA 2I10A 1QPMA 2B63J 4LOCA 1RI7A 2HS5A 4E7KA 5KAFC 4IHXA 1TWGJ 3S93A 2Z99A 1LDKB 5D5XB 4F91B 5K7HA 2MC3A 1H89C 2PEXA 2YU9J 1T56A 3Q0UA 1I6HJ 3BG9A 2GXGA 3K2AA 3A01B 3ZRGA 3ML6A 4BQQA 3R0AA 2ZMEA 5JVGF 4A3EJ 1F4KA 2EQRA 2HWVA 2IA1A 1A6IA 5IT9K 4KN7X 3GCMA 4GXOA 4U88A 2ZMEB 3KE2A 1OCOH 3K1MA 3O8HA 1KZHA 1OYWA 1R49A 2DMQA 1G3TA 2OCEA 2HKXA 5DV5A 5BNGA 1QPIA 1P6RA 4XSZF 3G4SI 1T0FC 2IP2A 4WK8F 1T0FA 1YYVA 3UNGC 1K7AA 2OAZA 4FE4A 3K70D 2BHYA 2MLGA 2ZJQF 2A61A 4BE0A 2W25A 4B8XA 1TWAJ 1YS7A 2LVSA 2DFHA 2ZKZA 3GZ6A 1XCVA 1D0XA 3H9JA 2CQQA 2PMZN 4B3AA 2XKPA 2P5KA 3CCLI 2V9KA 4RGUA 1Z6TA 3P5JA 4CXFA 1FOXA 2X6OA 2K9LA 2GM4A 4CH7A 2UXXA 4G6DA 3F72A 4WXCA 5ICEA 4KFCA 2JWTA 3O2PE 2J5OA 2JVHA 5DDGA 5FD6A 2CV2A 2UV1A 1BI0A 4LB5A 2Y31A 1ZRCA 1D1CA 1UELB 1WRJA 4J01A 1O3RA 4A3GJ 1KYZA 2HEOA 2HDCA 3E0HA 1GHCA 1BR2A 1DGRM 2V9VA 1U5TA 5M3FJ 3BOQA 1X19A 4M3FA 4L9VA 3K4BA 3DU6A 3OSFA 3IUOA 3MKYB 1P9QC 1SANA 3BR1A 3RTRA 2XDVA 3F8CA 2Z3YA 2R7OA 4M3EA 3QOPA 2QBYB 3PQKA 4RM3A 1SD4A 3SJMA 2ISZA 3KLOA 3HUGB 3PNYA 2CO5A 4I2OA 2RNJA 1ZGAA 1Y56A 4G7ZF 4RAZA 4E70A 2L7KA 5L3EA 4RB1A 2WWYA 1U3EM 2VKVA 3CESA 3O6BB 2JQ7A 3GFMA 2QQAA 3GTLJ 4X1EA 2DCEA 1DU0A 5HVQC 2CW8A 2R5ZB 1V54H 3BJAA 4B3XA 2PI0A 2KISA 3AG2H 2R93J 4E7HA 4AYZA 2VXZA 5BS6A 4UUSA 2M0MA 2DMUA 2OBPA 1FY7A 3C2HA 2O8KA 2MG4A 2VKHA 2E2JJ 3FX3A 1S9HA 3WGHA 2K3PA 2VPLA 4HQMA 4PFOA 2LOOA 2JT1A 2EZLA 1MD0A 2LD5A 1XGSA 2D2WA 1ZRFA 2R7SA 5KATA 2CW7A 4BH9A 3HSEA 1G6NA 4UB8C 4S04A 2M5WA 4C30A 2P7VB 2DA3A 3F22A 1A04A 1Q1VA 1S6LA 5E3OA 4WWCA 5FLVA 4LIVA 3CJRB 3HOYJ 2FBKA 3CMEI 1WGXA 1IN6A 4EGYA 2B9SA 2R7QA 1MMDA 2Z2SB 3GX4X 2PJRA 3MAJA 2QQBA 4ZZDA 3WE3A 1DPUA 5LRSA 3AKZA 2R7RA 3VOEA 1E3HA 5EEGA 1WH5A 1FJLA 3MZ8A 2H94A 3ULQB 2DT6A 2WADA 1XSXA 2Q8KA 5JHUA 1ETVA 4MEYF 3DPLC 2DYSH 5FKMA 5EEAA 3IL2A 1YS6A 1YO5C 1BI1A 2MA3A 1ZREA 2OC6A 2QSHX 3T1BA 3B02A 1MH3A 2E2HJ 2NNYA 3OMYA 1O3TA 3CC4I 2IGOA 3PFYA 3CCJI 2LF8A 2M8GX 1V5EA 3L2CA 2DK5A 3I59A 4IHWA 2LMDA 1OCTC 2Z16A 4XRSA 4IHYA 2DMTA 2VC0A 4ZDOA 2VLAA 1F1ZA 2LKXA 2MH9A 4HV6A 3CMAI 2GWRA 4PCQA 4DZJA 3QPHA 4NNJA 3RDIA 2PMHA 1HKQA 5D4RA 4LD5A 1QVUA 4RGXA 5CYVA 3OIQA 3OYMA 1ZR2A 2VQHA 3RSNA 4PJ0C 4AVPA 2X1EA 2K9NA 5D6FA 3CUQA 1H0MA 3UR3C 3WU1B 3HOWJ 2EINH 1XDSA 2YUSA 5KAXA 2BXYA 1TQPA 2F5CA 4KMUX 1B9MA 1JHFA 1MNMC 4A6DA 4G12A 1SFOJ 2IS6A 4E7LA 2R3SA 3FIWA 4ZJZA 2YPRA 2ECCA 3CJTB 2MC4A 1AU7A 5J1RA 2O8XA 3BDDA 4KISA 2BY2A 1GDTA 3SZPA 1JJ8C 1VQ6I 3LAPA 1J59A 4MFDA 3JRIA 4IHSA 2R5ZA 5M5XJ 1I50J 1ON1A 1JJ6C 3C2GA 1L0OC 3BR6A 2E5ZA 4X0GA 3GTMJ 2NS8A 2QUFA 4IXAA 4RAGA 1YJ9I 3MZYA 1ERDA 4Q4ZF 1DP3A 3OR1C 3C7JA 3MMYB 5DD8A 4CDGA 2E1CA 1B6AA 3I4NJ 4AIJA 3FMSA 4C2MJ 4DW6A 4Z6YA 3ZN1A 1K6OA 1R23A 3EUAA 2DA6A 2DBBA 3PIPF 3CC7I 3GTKJ 1VQOI 2ESHA 4PDKA 1IG7A 2RVCA 5E17F 2L9VA 3NRVA 1TNTA 3Q5RA 3CDLA 3Q5SA 1MBJA 4EJTA 2AHQA 3M8EA 1EF4A 1HOMA 2KIFA 5H6QA 4KIFA 2W85A 2LF7A 1BJZA 3VYRB 1HDPA 1U5TC 2AQEA 5DCMA 4CSWA 3FK7A 2HPMA 3BP8A 1B59A 1RKWA 5LGTA 4CYDA 3HOXJ 2BV6A 2FF4A 4M3BA 1E3OC 3GTPJ 1B4AA 5LGNA 2DN0A 4HSTA 3TQNA 2XROA 2YX7A 1HQCA 3LNQA 1TBXA 5IPAA 1P4AA 1U5TB 2DODA 3NEUA 3ZQQA 4IOAF 4HX7A 5GPCA 3FXLA 3QODA 3BG5A 3L7WA 2Q0OA 2LBFA 3JRDA 1A35A 2DFIA 2VE9A 2K4BA 1R1UA 1OFCX 1R5HA 4B0YA 2XPWA 2ME0A 1LVAA 2P0WA 1RKTA 2Y75A 3N4MA 1MGTA 3GBGA 5FKOA 2JRMA 4ABZA 2GLOA 3DKXA 2I8DA 4B48A 1N25A 4HNUA 4D7NA 1I5ZA 4GCVA 1MJAA 2XAFA 1G3WA 3K69A 3ZMUA 3IHUA 4EJOA 1D0YA 4B43A 4YIRX 1ZGJA 3EYIA 3FBNB 5D8LB 2JUGA 2OV7A 4RAFA 4HOBA 1FWZA 3V7RA 2XUBA 3CP2A 3WTVC 3HYIA 2IGNA 3D5SC 2XVCA 2R7DA 2UUZA 3K2ZA 1G8XA 3BTJA 1LE8B 4ZTFA 1EXJA 5F1JA 4JX5A 3CCQI 1HW1A 3TEDA 2HYGD 2RC4A 4Y17A 3WHBA 1BI2A 2A3SA 3HRMA 3F8FA 5JVTA 4Q5SF 3SEQA 3JCUC 4FQGA 1MMNA 2LY9A 1AA7A 3IAOA 2Y0MA 2AXLA 5E1WA 5FKNA 4C2TA 4D1QA 1RPWA 3N05A 2CW0F 1I3QJ 1MBEA 4YFNF 5F1RA 2VBWA 3JTHA 4RBOA 2ESNA 1K79A 3LSIA 1GVDA 2RGVA 3M4OJ 3IAS2 1MZBA 2E7WA 3NAUA 1MSFC 5EJCA 3F21A 3JW4A 4QWQA 3RPUD 4BS9A 4HNTA 1ONVA 1GUUA 1RR8C 4PGHA 3CD6I 3VSKA 5AIQA 1QNTA 1W5TA 1NK3P 3QYFA 5ILVA 3DU5A 4HX8A 3P9CA 1F9NA 2XF5A 4S05A 5GPAA 4A1MA 5EF6A 1C0WA 2HTSA 1MMAA 2XASA 2L54A 5C3EJ 5LBQA 4KDPA 2RNGA 2R7XA 5CVVA 4ZYGA 1QHHD 4Y33A 2KJCA 4ZTJA 2R5YB 2O0YA 3ABMH 3BG6A 1O3QA 1XC5A 2X6YA 4BACA 1D5VA 4E6KG 1WCMJ 3Q3SA 5FFZA 5DM6F 3WTXC 1YRNB 2EIJH 3H5NA 3K4CA 3V7SA 2K3FA 1ETYA 5JFRA 2AO9A 4CA0A 2XAQA 2F5VA 1SD6A 4L9NA 1BC7C 4IF4A 3SHFA 1R5GA 2Y2ZA 1SVOA 1O4XA 3QU6A 1XG1A 2W82A 3FDYA 2XAGA 4XK4A 2K27A 3DTIA 1VF9A 4J00A 3Q0WA 5CVJA 2IRFG 3S1MJ 2QVOA 1ETKA 1LPQA 1R1TA 3K4LA 3A1YA 4ZZLA 2OA4A 1U8BA 2RAEA 1BBYA 3LSMA 4NHJA 3QQAA 1DPRA 1TC3C 4OINF 1R7JA 1FC3A 3I64A 3DPUA 3HTSB 3TL4X 4IRIA 4FCYA 4BHPA 2MD0A 4XORA 4YEJA 3PSFA 2PN6A 4MNUA 2LH9A 4OIOF 4OU0A 1JKQC 3U2RA 3VSLA 4BNCA 1T08B 2HU9A 2RKHA 5BPDA 3LAJA 2W24A 2G7UA 3ERMA 2QSFX 1Y8RB 2OQGA 4EQQA 1VTNC 1VQNI 1G3SA 3KX2A 5FLXK 3OY9A 2R7UA 1XMKA 1ZG1A 1R1VA 2JZYA 4V2FA 3ABUA 4E7SA 2TRTA 2GA1A 3V42A 2KRCA 1Z21A 5LHIA 3JAMK 2FBIA 4BY1J 4C3IJ 3PO3J 3S1NJ 2M8EA 3MKWB 1ZGWA 3H9GA 2KL4A 2PMZA 4MQVA 4N4OB 3SDGA 5E8GA 3BTCA 1F36A 1N75A 3KP7A 4FX0A 1R4NB 3VB2A 2DFFA 1W7PA 4YFXF 2W84A 2IW5A 5FLXZ 1OR7C 2DAOA 1MSEC 2H8WA 2VKDA 2VJJA 2Y0SA 2HQAA 4MFEA 3W6JB 1JGSA 1SC7A 2OQRA 4FX4A 2ELHA 2CGPA 2H1LA 3B6CA 3OIPA 3ABTA 2B7EA 3E6DA 1JKPC 4JOMA 3HPHA 2ME6A 2DOEA 2DOFA 3CP8A 3TOAA 3A2KA 1ZARA 3MEXA 4FHTA 4GGGA 5IYBJ 1ZK8A 3JRCA 2V79A 3BR0A 4UVBA 3VDXA 2VJ4A 1BN5A 3TO6A 2K4JA 3LWFA 3SXYA 1S7AA 3K6GA 2VBXA 4P55A 4PFPA 2DJNA 3ZOBA 4BKXA 2VL8A 1AKHA 5F04A 5BPIA 3R6SA 3OYBA 4I7HA 4C2UA 3IP4B 2H27A 4HF0A 4M9XA 4CZZA 3BZKA 4A3BJ 1P7IA 2ZCWA 5HDGA 2FX0A 1XB4A 4NBQA 2M45A 5F0CA 4DZPA 3A02A 2X0LA 3HC7A 3FKJA 4PSWA 3E5QA 3GTJJ 2HZTA 1I39A 2ISYA 4M6VA 1U8RA 3QRFF 4WCGA 1STZA 4XR6A 2ZB9A 1WJFA 3DXJF 3OYLA 3ECOA 4C3HJ 1EJ9A 4LLLA 1SFKA 3BC8A 3OS1A 4JP0A 1WHUA 4IPAA 4A2UA 4HRIA 2A6EF 3JRHA 4PJMA 2EZIA 2CMPA 2KIUA 2ZXIA 3A01A 3ABLH 3S2DJ 3CDIA 2OZ6A 4AUXA 1X3ZB 3A03A 4Y3OA 5CLSA 3ONQA 3W6KB 1PVEA 5HS7A 1O7FA 4I98B 3S3OA 4XLNF 3J7YJ 2JA7J 3KIOA 2W7NA 3S3MA 2HGCA 3H0GJ 5DUKA 1JTXA 4L9TA 4LFUA 3I71A 5ILSA 3FMRA 5GQQA 2EV0A 3CUQB 4G7HF 5FD5A 1P7JA 2HKOA 2V26A 2HNHA 3HTUA 2BYVE 5LHHA 3WE2A 4DBQA 1IUFA 1XSVA 1Z7UA 2Y0SN 3BY6A 2BY0A 4LLNA 4BUPA 1I27A 3HOZJ 1YE9A 1HBXG 4F93B 4RB2C 3HOSA 2JSCA 4EVIA 2IPQX 1B8IA 3H36A 4HSRA 4BL0B 1J75A 4RA2A 3K70C 1KQ8A 1XGOA 2KRFA 2VASA 3JRFA 2M0CA 2VBYA 3OYEA 2GQQA 4AWXB 1GT0C 2ZJ2A 1B8IB 1U9OA 1HKSA 2K9QA 2QYOA 2E19A 5AONA 4I6ZA 4II3A 3OYCA 2ID6A 2JSPA 2P5VA 4ZYDA 2X1CA 3M9AA 3W2WA 4TV7A 4P9UA 4UUVA 1BOAA 5B1BH 1H88C 2M2EA 2NRAC 3M7GA 1CF7B 2O9LA 3CUOA 3KP3A 2DK8A 2VB6A 1X58A 1K83J 2HXOA 2RV8A 4II2A 4F92B 4IL6C 3WTUC 2LY1A 1M1EB 4XN0A 2BGCA 2DLLA 4JX4A 3W2VA 1ODDA 2L0KA 3ZGKA 3QU3A 1Y1WJ 2LKSA 1LEBA 2DA4A 2BY1A 1JI8A 1S7EA 2CG4A 2KHMA 3WTYC 1USSA 1ZG5A 1UMQA 2P81A 4GRIA 4HLYA 2CQ7A 4A12A 1JUMA 2X9DA 1ZQ3P 1Z67A 1Z1DA 1FP2A 1SAXA 3DV8A 1NHAA 2GOXB 5LLQA 2MSYA 5GTHC 2EFWA 4BU2A 3DBLB 4BQAA 3P9IA 3GLLA 5FFXA 3ROUA 2H1KA 1YJWI 2X1DA 3G1MA 2NOJB 3Q5FA 2XB5A 2EA2A 2QWWA 9ANTA 3RKXA 4DOZA 4U7BA 1J7KA 2W57A 2DA1A 3F8MA 2A05A 1LUJB 2R4GA 4AYZB 5HDKA 3CLOA 1RNLA 1IRFA 3FM5A 2M7BA 2KZGA 1LB2A 3FZVA 4P5OA 4L5JA 2E5NA 2O61A 1TNSA 2QENA 1ON2A 1G3YA 4Y4RA 2HOSA 5DEQA 1MKMA
chains in the Genus database with same CATH topology
2HYJA 1FTTA 1HF0A 1MNMC 4G12A 4A3DJ 1GV2A 1SFOJ 2IBDA 5JLXA 3BR5A 1GV5A 1WH7A 3FIWA 1X2MA 3JRAA 2ECCA 1TWFJ 1AU7A 5J1RA 4DYRA 1WI3A 2HOAA 1GDTA 1JJ8C 4CYCA 2HQ5A 3JRBA 2HVAA 4MFDA 3JRIA 2JA8J 4BBRJ 2R5ZA 5M5XJ 1I50J 2VUMJ 1JJ6C 2CUEA 3BR6A 2R92J 4AC0A 5C4JJ 3GTMJ 2NS8A 3B6AA 1FTZA 3CCYA 4EEFG 4A3IJ 2DA5A 3RZDJ 2HDDA 1G2HA 1U78A 4A3CJ 3S16J 3I4NJ 1APLC 4C2MJ 4DW6A 1POGA 5DTDA 3TW6A 1Z0XA 2M9HA 2DA6A 5KAVA 3GTKJ 2HI3A 4DYQA 1IG7A 2XRLA 3PO2J 3Q5RA 3CDLA 1RETA 1MBJA 4GFBA 3MVPA 3Q5SA 2AHQA 2NOGA 1EF4A 1HOMA 2ECBA 3FISA 1BJZA 1HDPA 1U9NA 3CQZJ 4M3GA 5J3LA 1MBHA 5EGOB 3FK7A 5F0FA 1RKWA 4XRSG 4HNVA 3HOXJ 4M3BA 5J1UA 1E3OC 3GTPJ 5EGOA 2DN0A 3LNQA 3PM1A 3G1LA 5IPAA 4D5FA 3Q5PA 2XSDC 2IEKA 1ETXA 1BL0A 1IJWC 5IOYA 2WB1N 1ZKGA 2JK3A 5GPCA 3BG5A 3W6VA 4FTHA 2JMWA 4W97A 4D7MA 3K7AJ 3JRDA 2EH3A 5E3NA 1OFCX 2YS9A 4B0YA 2XPWA 1ZTRA 2ME0A 1RKTA 2ELKA 1Y1VJ 3GBGA 5FKOA 3TW7A 4ABZA 1HDDC 5J1YA 5IYCJ 2GLOA 2CJJA 4D7NA 4QTRA 3ZQGA 5F08A 3OSGA 2WAQN 3E7LA 1Z77A 1IDYA 1AHDP 4QSHA 3C2BA 4C3JJ 2QCOA 1H8AC 2BOWA 1JYHA 2OPTA 4NDLA 4BBSJ 1D5YA 1EXIA 1MBFA 3HGGA 2CUFA 2HOTA 5EZGA 3H3VK 2TCTA 4V2GA 2R7ZJ 3LSRA 4Y52J 2L7FP 3HM5A 3ZQCA 1BW6A 4MO7A 5JLWA 3BTJA 5EYRA 4A3MJ 3FKIJ 1LE8B 4A69C 4UUSB 1IGNA 5F1JA 1EXJA 4JX5A 5EZHA 5C4XJ 3TEDA 4JX6A 3NARA 3WHBA 1LE8A 1JGGA 3ZQHA 3TP3A 4B1RA 1W0UA 2DTZA 2LY9A 3IAOA 2NS7A 3HEFA 5FKNA 4QIWN 1VNDA 2VPRA 2EBIA 5IYDJ 2IAIA 3OOUA 2H8RA 1RPWA 1I3QJ 1MBEA 3JR9A 4RBOA 3O8GA 1ENHA 3BR3A 3CMYA 2E2IJ 3GTQJ 1GVDA 3M4OJ 3NAUA 1MSFC 1ZR4A 2DA7A 2MW8A 5FJ8J 2Y9YA 3VPRA 1GUUA 2NVYJ 2CQXA 1IC8A 3WHCA 2LP0A 1JUSA 1UHSA 3ZQFA 1NK3P 2LR8A 2G0EA 3SFIA 3RZOJ 5GPAA 4A1MA 3BG3A 3HOUJ 4B4CA 1PUFA 2K40A 5EF6A 2O7OA 5C3EJ 2GBYA 5IP7J 5EG0B 1XS9A 2JA6J 1JT6A 1FIAA 3ZQLA 4S0HB 2R5YB 4FE7A 5EG0A 1A5JA 3S15J 1XC5A 4XRMA 2NVXJ 1WCMJ 3Q3SA 1OJLA 1OCPA 3BR2A 1YRNB 5M5WJ 2W48A 2R5YA 1VI0A 3HKZN 1ETYA 3LSGA 2AO9A 5HODA 2KT0A 2XGEA 3LSPA 3GTOJ 4M3DA 1MH4A 1AKHB 4IEJA 2Y2ZA 3JRGA 1O4XA 1R8EA 1XG1A 4XK4A 1VF9A 4L5EA 3IH4A 1K61A 3Q0WA 3S1MJ 1ETKA 1BW5A 4A3LJ 3RKQA 1U8BA 2RAEA 2LK2A 2XGCA 3S17J 4A3KJ 3QQAA 3R8KA 2GOVA 1MBGA 1DU6A 2I10A 2XPUA 2B63J 4LOCA 4FCYA 4A3JJ 4IHXA 3IV5A 1TWGJ 1T33A 1CQTA 3S1QJ 5K7HA 2LFBA 1JKQC 3S14J 1H89C 3MN2A 2YU9J 1ITYA 1T56A 3Q0UA 5IP6A 1I6HJ 3BG9A 3K2AA 3A01B 3HDDA 1B72B 1QVTA 4A3EJ 2EQRA 1A6IA 1JUPA 3LSJA 4MLOA 1JKOC 4IHVA 3HB9A 4V2FA 2TRTA 4BY1J 3PO3J 5FKKA 3S1NJ 3O8HA 5M3MJ 4C3IJ 2DMQA 1ZGWA 4XIDA 3D1NI 3SDGA 5F0HA 5E3MA 3BTCA 4XICA 5BNGA 1QPIA 1F36A 1WPKA 2NVTJ 4FE4A 1MSEC 4X6AJ 2D5VA 4UUTA 4MFEA 4MIMA 1BA5A 1TWAJ 2LVSA 2FD5A 3Q3DA 1ETOA 2CQQA 2PMZN 5GP9A 2N8GA 3B6CA 3HGYA 4W1UA 4I76A 4B3AA 1TC3C 3BQZA 1JKPC 2LTPA 3D71A 2ME6A 5IYBJ 2X6OA 1ZK8A 5K7FA 3S2HJ 2GM4A 3JRCA 2E1OA 3BR0A 5KCBA 5IP9J 3BT9A 3D6YA 2JWTA 2DJNA 3QPLA 3LOCA 2EZKA 3ZOBA 2L7ZA 3QPSA 4BKXA 1AKHA 2VKEA 5F04A 1ETWA 2JJ7A 1JKRC 2Y31A 4FISA 2FJ1A 2ID3A 2VI6A 4A3BJ 1P7IA 1UG2A 1W0TA 2FX0A 5F27A 4A3GJ 1PUFB 1JT0A 3E0HA 5F0CA 3BTIA 4DZPA 3A02A 1NTCA 5M3FJ 2OF7A 4M3FA 3GTJJ 1NK2P 4M6VA 1RR7A 3OSFA 1F43A 1SANA 3BR1A 2ZB9A 4DYCA 4C3HJ 4M3EA 3TP0A 4JP0A 3Q2YA 3HOVJ 1HCRA 2XGDA 3SJMA 4RDUA 3JRHA 2EZIA 2L7MP 4Y7NJ 3A01A 2M34A 2HXIA 3S2DJ 4AUXA 3A03A 2VKVA 3S1RJ 4CYCB 3GTLJ 4X1EA 2QF7A 1DU0A 2JA7J 1IDZA 2R5ZB 5E3LA 1FIPA 5DS9A 3H0GJ 1JTXA 3DEWA 2R93J 3DCFA 4AYZA 4BY7J 5GQQA 3HBLA 4UUSA 1MBKA 4A3FJ 2DMUA 1TWCJ 2O8KA 2MG4A 1P7JA 5IOZA 3BTLA 1RESA 2E2JJ 2CRGA 3JREA 1LFBA 1IUFA 2LLKA 2Y0SN 2KDZA 3G1OA 4AYBN 3B49A 2XB0X 2EZLA 2NVQJ 3HOZJ 2LD5A 1JTYA 1B72A 5KATA 3F0CA 2K9SA 2DMPA 3BQYA 2XPVA 4BXXJ 2JN6A 5FLMJ 1B8IA 3D6ZA 3L1PA 2DA3A 1Q1VA 5E3OA 3JRFA 2M0CA 5FLVA 3GK6A 5K7ZA 3HOYJ 1GT0C 2COBA 1FEXA 1B8IB 2CU7A 3IH3A 1WGXA 1U9OA 2K9QA 2E19A 4I6ZA 5EDNA 1TWHJ 2ID6A 1X2NA 2MGQA 3FK6A 5FKLA 3MKLA 1WH5A 1FJLA 1QRYA 1H88C 2M2EA 2O9LA 4D5CA 2X48A 3IH2A 1ETVA 5KAWA 1X58A 3M3YJ 1K83J 2HXOA 5FKMA 5EEAA 3UKGA 5KAUA 3Q1MA 2Y9ZA 4JX4A 1Y1WJ 2L0KA 1YRNA 2DA4A 1MH3A 2Y30A 1S7EA 2E2HJ 1UMQA 2P81A 1JUMA 3Q0VA 3I4MJ 2X9DA 1ZQ3P 1IV6A 2M8GX 2R0QC 2JA5J 4IHWA 1ORKA 2MSYA 1OCTC 2L9RA 4XRSA 4IHYA 3LURA 2DMTA 2LKXA 2DA2A 2H1KA 3G1MA 4DZJA 1R9TJ 5C44J 2XB5A 3RQIA 9ANTA 2KCUA 1QVUA 2DMNA 2DA1A 2FQ4A 4JYKA 1ZR2A 3OIOA 1IRZA 5M5YJ 2EZHA 4AYZB 3ZQIA 2K9NA 2WV1A 1ETQA 1LFUP 4J19A 3D70A 3R8JA 3HOWJ 1VFCA 4A93J 1HLVA 2YUSA 5KAXA 1BOWA 2HOSA 3GTGJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYJ A;  1FTT A;  1HF0 A;  1MNM C;  4G12 A;  4A3D J;  1GV2 A;  1SFO J;  2IBD A;  5JLX A;  3BR5 A;  1GV5 A;  1WH7 A;  3FIW A;  1X2M A;  3JRA A;  2ECC A;  1TWF J;  1AU7 A;  5J1R A;  4DYR A;  1WI3 A;  2HOA A;  1GDT A;  1JJ8 C;  4CYC A;  2HQ5 A;  3JRB A;  2HVA A;  4MFD A;  3JRI A;  2JA8 J;  4BBR J;  2R5Z A;  5M5X J;  1I50 J;  2VUM J;  1JJ6 C;  2CUE A;  3BR6 A;  2R92 J;  4AC0 A;  5C4J J;  3GTM J;  2NS8 A;  3B6A A;  1FTZ A;  3CCY A;  4EEF G;  4A3I J;  2DA5 A;  3RZD J;  2HDD A;  1G2H A;  1U78 A;  4A3C J;  3S16 J;  3I4N J;  1APL C;  4C2M J;  4DW6 A;  1POG A;  5DTD A;  3TW6 A;  1Z0X A;  2M9H A;  2DA6 A;  5KAV A;  3GTK J;  2HI3 A;  4DYQ A;  1IG7 A;  2XRL A;  3PO2 J;  3Q5R A;  3CDL A;  1RET A;  1MBJ A;  4GFB A;  3MVP A;  3Q5S A;  2AHQ A;  2NOG A;  1EF4 A;  1HOM A;  2ECB A;  3FIS A;  1BJZ A;  1HDP A;  1U9N A;  3CQZ J;  4M3G A;  5J3L A;  1MBH A;  5EGO B;  3FK7 A;  5F0F A;  1RKW A;  4XRS G;  4HNV A;  3HOX J;  4M3B A;  5J1U A;  1E3O C;  3GTP J;  5EGO A;  2DN0 A;  3LNQ A;  3PM1 A;  3G1L A;  5IPA A;  4D5F A;  3Q5P A;  2XSD C;  2IEK A;  1ETX A;  1BL0 A;  1IJW C;  5IOY A;  2WB1 N;  1ZKG A;  2JK3 A;  5GPC A;  3BG5 A;  3W6V A;  4FTH A;  2JMW A;  4W97 A;  4D7M A;  3K7A J;  3JRD A;  2EH3 A;  5E3N A;  1OFC X;  2YS9 A;  4B0Y A;  2XPW A;  1ZTR A;  2ME0 A;  1RKT A;  2ELK A;  1Y1V J;  3GBG A;  5FKO A;  3TW7 A;  4ABZ A;  1HDD C;  5J1Y A;  5IYC J;  2GLO A;  2CJJ A;  4D7N A;  4QTR A;  3ZQG A;  5F08 A;  3OSG A;  2WAQ N;  3E7L A;  1Z77 A;  1IDY A;  1AHD P;  4QSH A;  3C2B A;  4C3J J;  2QCO A;  1H8A C;  2BOW A;  1JYH A;  2OPT A;  4NDL A;  4BBS J;  1D5Y A;  1EXI A;  1MBF A;  3HGG A;  2CUF A;  2HOT A;  5EZG A;  3H3V K;  2TCT A;  4V2G A;  2R7Z J;  3LSR A;  4Y52 J;  2L7F P;  3HM5 A;  3ZQC A;  1BW6 A;  4MO7 A;  5JLW A;  3BTJ A;  5EYR A;  4A3M J;  3FKI J;  1LE8 B;  4A69 C;  4UUS B;  1IGN A;  5F1J A;  1EXJ A;  4JX5 A;  5EZH A;  5C4X J;  3TED A;  4JX6 A;  3NAR A;  3WHB A;  1LE8 A;  1JGG A;  3ZQH A;  3TP3 A;  4B1R A;  1W0U A;  2DTZ A;  2LY9 A;  3IAO A;  2NS7 A;  3HEF A;  5FKN A;  4QIW N;  1VND A;  2VPR A;  2EBI A;  5IYD J;  2IAI A;  3OOU A;  2H8R A;  1RPW A;  1I3Q J;  1MBE A;  3JR9 A;  4RBO A;  3O8G A;  1ENH A;  3BR3 A;  3CMY A;  2E2I J;  3GTQ J;  1GVD A;  3M4O J;  3NAU A;  1MSF C;  1ZR4 A;  2DA7 A;  2MW8 A;  5FJ8 J;  2Y9Y A;  3VPR A;  1GUU A;  2NVY J;  2CQX A;  1IC8 A;  3WHC A;  2LP0 A;  1JUS A;  1UHS A;  3ZQF A;  1NK3 P;  2LR8 A;  2G0E A;  3SFI A;  3RZO J;  5GPA A;  4A1M A;  3BG3 A;  3HOU J;  4B4C A;  1PUF A;  2K40 A;  5EF6 A;  2O7O A;  5C3E J;  2GBY A;  5IP7 J;  5EG0 B;  1XS9 A;  2JA6 J;  1JT6 A;  1FIA A;  3ZQL A;  4S0H B;  2R5Y B;  4FE7 A;  5EG0 A;  1A5J A;  3S15 J;  1XC5 A;  4XRM A;  2NVX J;  1WCM J;  3Q3S A;  1OJL A;  1OCP A;  3BR2 A;  1YRN B;  5M5W J;  2W48 A;  2R5Y A;  1VI0 A;  3HKZ N;  1ETY A;  3LSG A;  2AO9 A;  5HOD A;  2KT0 A;  2XGE A;  3LSP A;  3GTO J;  4M3D A;  1MH4 A;  1AKH B;  4IEJ A;  2Y2Z A;  3JRG A;  1O4X A;  1R8E A;  1XG1 A;  4XK4 A;  1VF9 A;  4L5E A;  3IH4 A;  1K61 A;  3Q0W A;  3S1M J;  1ETK A;  1BW5 A;  4A3L J;  3RKQ A;  1U8B A;  2RAE A;  2LK2 A;  2XGC A;  3S17 J;  4A3K J;  3QQA A;  3R8K A;  2GOV A;  1MBG A;  1DU6 A;  2I10 A;  2XPU A;  2B63 J;  4LOC A;  4FCY A;  4A3J J;  4IHX A;  3IV5 A;  1TWG J;  1T33 A;  1CQT A;  3S1Q J;  5K7H A;  2LFB A;  1JKQ C;  3S14 J;  1H89 C;  3MN2 A;  2YU9 J;  1ITY A;  1T56 A;  3Q0U A;  5IP6 A;  1I6H J;  3BG9 A;  3K2A A;  3A01 B;  3HDD A;  1B72 B;  1QVT A;  4A3E J;  2EQR A;  1A6I A;  1JUP A;  3LSJ A;  4MLO A;  1JKO C;  4IHV A;  3HB9 A;  4V2F A;  2TRT A;  4BY1 J;  3PO3 J;  5FKK A;  3S1N J;  3O8H A;  5M3M J;  4C3I J;  2DMQ A;  1ZGW A;  4XID A;  3D1N I;  3SDG A;  5F0H A;  5E3M A;  3BTC A;  4XIC A;  5BNG A;  1QPI A;  1F36 A;  1WPK A;  2NVT J;  4FE4 A;  1MSE C;  4X6A J;  2D5V A;  4UUT A;  4MFE A;  4MIM A;  1BA5 A;  1TWA J;  2LVS A;  2FD5 A;  3Q3D A;  1ETO A;  2CQQ A;  2PMZ N;  5GP9 A;  2N8G A;  3B6C A;  3HGY A;  4W1U A;  4I76 A;  4B3A A;  1TC3 C;  3BQZ A;  1JKP C;  2LTP A;  3D71 A;  2ME6 A;  5IYB J;  2X6O A;  1ZK8 A;  5K7F A;  3S2H J;  2GM4 A;  3JRC A;  2E1O A;  3BR0 A;  5KCB A;  5IP9 J;  3BT9 A;  3D6Y A;  2JWT A;  2DJN A;  3QPL A;  3LOC A;  2EZK A;  3ZOB A;  2L7Z A;  3QPS A;  4BKX A;  1AKH A;  2VKE A;  5F04 A;  1ETW A;  2JJ7 A;  1JKR C;  2Y31 A;  4FIS A;  2FJ1 A;  2ID3 A;  2VI6 A;  4A3B J;  1P7I A;  1UG2 A;  1W0T A;  2FX0 A;  5F27 A;  4A3G J;  1PUF B;  1JT0 A;  3E0H A;  5F0C A;  3BTI A;  4DZP A;  3A02 A;  1NTC A;  5M3F J;  2OF7 A;  4M3F A;  3GTJ J;  1NK2 P;  4M6V A;  1RR7 A;  3OSF A;  1F43 A;  1SAN A;  3BR1 A;  2ZB9 A;  4DYC A;  4C3H J;  4M3E A;  3TP0 A;  4JP0 A;  3Q2Y A;  3HOV J;  1HCR A;  2XGD A;  3SJM A;  4RDU A;  3JRH A;  2EZI A;  2L7M P;  4Y7N J;  3A01 A;  2M34 A;  2HXI A;  3S2D J;  4AUX A;  3A03 A;  2VKV A;  3S1R J;  4CYC B;  3GTL J;  4X1E A;  2QF7 A;  1DU0 A;  2JA7 J;  1IDZ A;  2R5Z B;  5E3L A;  1FIP A;  5DS9 A;  3H0G J;  1JTX A;  3DEW A;  2R93 J;  3DCF A;  4AYZ A;  4BY7 J;  5GQQ A;  3HBL A;  4UUS A;  1MBK A;  4A3F J;  2DMU A;  1TWC J;  2O8K A;  2MG4 A;  1P7J A;  5IOZ A;  3BTL A;  1RES A;  2E2J J;  2CRG A;  3JRE A;  1LFB A;  1IUF A;  2LLK A;  2Y0S N;  2KDZ A;  3G1O A;  4AYB N;  3B49 A;  2XB0 X;  2EZL A;  2NVQ J;  3HOZ J;  2LD5 A;  1JTY A;  1B72 A;  5KAT A;  3F0C A;  2K9S A;  2DMP A;  3BQY A;  2XPV A;  4BXX J;  2JN6 A;  5FLM J;  1B8I A;  3D6Z A;  3L1P A;  2DA3 A;  1Q1V A;  5E3O A;  3JRF A;  2M0C A;  5FLV A;  3GK6 A;  5K7Z A;  3HOY J;  1GT0 C;  2COB A;  1FEX A;  1B8I B;  2CU7 A;  3IH3 A;  1WGX A;  1U9O A;  2K9Q A;  2E19 A;  4I6Z A;  5EDN A;  1TWH J;  2ID6 A;  1X2N A;  2MGQ A;  3FK6 A;  5FKL A;  3MKL A;  1WH5 A;  1FJL A;  1QRY A;  1H88 C;  2M2E A;  2O9L A;  4D5C A;  2X48 A;  3IH2 A;  1ETV A;  5KAW A;  1X58 A;  3M3Y J;  1K83 J;  2HXO A;  5FKM A;  5EEA A;  3UKG A;  5KAU A;  3Q1M A;  2Y9Z A;  4JX4 A;  1Y1W J;  2L0K A;  1YRN A;  2DA4 A;  1MH3 A;  2Y30 A;  1S7E A;  2E2H J;  1UMQ A;  2P81 A;  1JUM A;  3Q0V A;  3I4M J;  2X9D A;  1ZQ3 P;  1IV6 A;  2M8G X;  2R0Q C;  2JA5 J;  4IHW A;  1ORK A;  2MSY A;  1OCT C;  2L9R A;  4XRS A;  4IHY A;  3LUR A;  2DMT A;  2LKX A;  2DA2 A;  2H1K A;  3G1M A;  4DZJ A;  1R9T J;  5C44 J;  2XB5 A;  3RQI A;  9ANT A;  2KCU A;  1QVU A;  2DMN A;  2DA1 A;  2FQ4 A;  4JYK A;  1ZR2 A;  3OIO A;  1IRZ A;  5M5Y J;  2EZH A;  4AYZ B;  3ZQI A;  2K9N A;  2WV1 A;  1ETQ A;  1LFU P;  4J19 A;  3D70 A;  3R8J A;  3HOW J;  1VFC A;  4A93 J;  1HLV A;  2YUS A;  5KAX A;  1BOW A;  2HOS A;  3GTG J; 
#chains in the Genus database with same CATH topology
 2M30 A;  1HF0 A;  1Q1H A;  4A3D J;  1GV2 A;  1BOB A;  2IBD A;  3PFI A;  2L2O A;  5AIP A;  1FSH A;  4HLX A;  4XRF A;  3FXR A;  4NC6 A;  1WI3 A;  3LA2 A;  4A0X A;  1F5T A;  1FZP B;  4IQJ A;  1TTY A;  1YIJ I;  4CCK A;  1WVR A;  3DP7 A;  4BBR J;  2A69 F;  1FBU A;  2R92 J;  1FPQ A;  4MQ9 F;  3E3V A;  4KIG A;  1AOY A;  4XLC A;  2H6B A;  3CCY A;  4EEF G;  4A3I J;  1K78 A;  4YII A;  3E0J B;  5TJJ A;  3S16 J;  3K10 A;  3GFL A;  1FP1 D;  1Z0X A;  4LIT A;  2M9H A;  2XF7 A;  5KAV A;  4U0V A;  3VOD A;  1O3S A;  3KYD B;  2Q2E B;  3HHG A;  5B5E C;  1R36 A;  3OYH A;  5KK1 A;  1RET A;  1W7P D;  2L9N A;  4CO8 A;  2CUJ A;  3K4N A;  4HV5 A;  2XIG A;  4ON0 A;  3SFZ A;  2HQR A;  3NWS A;  3ZPL A;  3OWT A;  4XQF A;  2EFP A;  3HHH A;  3CQZ J;  4KIT B;  4GYI A;  2LRD A;  1MBH A;  1NH3 A;  1P4W A;  4JK1 X;  4XRS G;  4OMY A;  1UHW A;  5F6F A;  3J7Z I;  4KNY A;  3TKY A;  4QPQ A;  4D5F A;  1EA3 A;  3Q5P A;  2X51 A;  4ENN A;  1OPC A;  5ED4 A;  2KPM A;  3BLY A;  2XSD C;  2IGK A;  5IOY A;  2WB1 N;  5GTI C;  2ZJP F;  3W6V A;  2E1N A;  5CKT A;  5HNF A;  2JMW A;  4HX4 A;  4LG0 A;  4D7M A;  4HF2 A;  1QGP A;  3RPQ A;  4BXF A;  4EJV A;  3ELK A;  1ZTR A;  2DTR A;  2ELK A;  1Y1V J;  4UB6 C;  3TW7 A;  1HDD C;  3LST A;  5IYC J;  2CJJ A;  3FMQ A;  5GAG J;  1UFM A;  1Z7L A;  4LLG F;  4O3M A;  2J5P A;  1Z77 A;  4UV8 A;  4DIQ A;  3OL4 A;  2BOW A;  1YW9 A;  1RUN A;  2OPT A;  3WG9 A;  4BBS J;  1HST A;  2R7W A;  2QA4 I;  2L9S A;  2CUF A;  5D5V B;  3QYB A;  1DDN A;  3H5A A;  2CFO A;  1IZ1 A;  2WAQ A;  3IKT A;  5K1Y A;  2F6C A;  4OOI A;  3EET A;  3M8F A;  3OYF A;  2R7Z J;  3CCV I;  3EUH A;  3F8N A;  2ICW G;  2P5L C;  3HRU A;  3MFK A;  3ZQC A;  1BW6 A;  3V7C A;  4CCO A;  3KET A;  5EYR A;  5J40 A;  4IZZ A;  3VWB A;  4A69 C;  3RKY A;  4UUS B;  1IGN A;  5EZH A;  3ZMZ A;  1QBJ A;  2P7C B;  3SDB A;  1KYW A;  1WJC A;  2KDO A;  1YLF A;  2DYR H;  1WJ5 A;  2YU3 A;  3GF2 A;  1JGG A;  4MTD A;  1FYK A;  3A0H C;  2F2E A;  3FF5 A;  2DTZ A;  2NS7 A;  4YG2 F;  3HEF A;  1WQ2 A;  3JSO A;  1XX5 A;  2IAI A;  1U0J A;  2LRE A;  3OOU A;  4BJT A;  4RGR A;  3P9K A;  3JR9 A;  2RQQ A;  4NQW A;  3TO7 A;  4R8H A;  3CMY A;  3LSK A;  3M1E A;  3L2W A;  1MDM A;  2CYY A;  3A0B C;  2F4O B;  1ZR4 A;  2EFO A;  2DA7 A;  2OTJ I;  5FJ8 J;  5IT9 Z;  4PZJ A;  1MDM B;  2NVY J;  1RIO H;  2CQX A;  3D0S A;  2CQK A;  1S29 A;  5TIS C;  3WHC A;  3CF2 A;  4A5M A;  1UST A;  1L3L A;  1FNN A;  1UHS A;  1VQK I;  3CC2 I;  2B0L A;  1WJD A;  4RGS A;  2LY2 A;  3DEE A;  2WV0 A;  3HRT A;  3SFI A;  4KN4 X;  3TDU C;  2BOL A;  3H0D A;  1PUF A;  2K40 A;  3JTG A;  2O7O A;  3KP5 A;  2GBY A;  1D1B A;  2VIX A;  5CVR A;  5J4Y A;  5EG0 B;  1XS9 A;  2G9W A;  2FOK A;  3DBH B;  4BYY A;  3K4J A;  3ZQL A;  4S0H B;  1D8K A;  5EG0 A;  1A5J A;  5JHF A;  3L09 A;  3WU0 A;  3S15 J;  3K0L A;  1B9N A;  2NVX J;  3I54 A;  1KGS A;  4FET A;  5CJ9 A;  4CZC A;  2QBY A;  2EA4 A;  4GO1 A;  1VQ4 I;  1J9I A;  3LSG A;  3HUG A;  2XGE A;  5HLH A;  4CCM A;  4ENJ A;  4M3D A;  5CVU A;  1MH4 A;  3GZ5 A;  4IEJ A;  4KUM A;  4M6X A;  2HVS A;  3JRG A;  4ZYE A;  1R8E A;  2JPB A;  2L01 A;  4L5E A;  2STW A;  5FO5 A;  3IH4 A;  3BPX A;  1E0E A;  3KFW X;  2JVG A;  4I0A A;  1BW5 A;  4A3L J;  2E60 A;  3RKQ A;  4U0W A;  4DNC A;  5BMZ A;  3GEZ A;  1VQ5 I;  2RRE A;  4DGW B;  2ZNZ A;  5CQG A;  3I5U A;  2VOP A;  1DU6 A;  2O3F A;  4IQ4 A;  3ZQ7 A;  4B44 A;  3DWL E;  1EH8 A;  1NG6 A;  1JE8 A;  4AIH A;  1CQT A;  1LFP A;  1IF1 A;  2BBY A;  2EFQ A;  2LFB A;  1SMY F;  4WF2 A;  4HDU A;  3MN2 A;  1YFH A;  5DD4 A;  4D9J A;  1ITY A;  5IP6 A;  1MND A;  2ZFW A;  3H3U A;  2DT5 A;  2FBH A;  4XKB A;  3KEO A;  3HDD A;  2DO7 A;  4IJA A;  3JSP A;  1KQ9 A;  1B72 B;  2V4J C;  4HAM A;  2P8T A;  4IHV A;  1JKO C;  3OYJ A;  1UHM A;  2JA2 A;  3HB9 A;  4ETS A;  2OTL I;  3K4M A;  1MW7 A;  3KEY A;  3DPT A;  1NG7 A;  2A5W A;  2M4K A;  5FRO A;  3KYL A;  2OJE D;  3D1N I;  4LG3 A;  5F0H A;  2F5E A;  5E3M A;  4XIC A;  3RYP A;  3SEZ A;  4QPO A;  2PJR B;  3L2V A;  3RYR A;  3TO9 A;  3J81 Z;  2FQ3 A;  1WPK A;  2W4S A;  3U1D A;  2VQL A;  2NVT J;  4XOP A;  2STT A;  5ICC A;  4UUT A;  5HLT A;  3REO A;  4MIM A;  3M1C A;  3PNT A;  3LFK A;  5J47 A;  1ETO A;  4BQO A;  4W1U A;  2PMU A;  3BCB A;  3HGY A;  5GP9 A;  2D45 A;  1AWC A;  4I76 A;  2EFN A;  4XOT A;  4A6E A;  2LTP A;  5J6X A;  2O6G E;  3D71 A;  3VYS B;  1S72 I;  2R7V A;  2JUC A;  4IO9 F;  4G94 A;  1TW3 A;  3EYY A;  5FGM A;  4V19 K;  1Y39 A;  2VXD A;  3S2H J;  3I3L A;  1XPX A;  2P4W A;  3BT9 A;  4MTE A;  1WJB A;  1R22 A;  3QPL A;  3LOC A;  5DCM B;  2L7Z A;  3QPS A;  1X3U A;  3C1D A;  1ETW A;  5D5U B;  1R00 A;  1PP8 F;  5H6R A;  4B47 A;  2FJ1 A;  2ID3 A;  1J09 A;  2XAU A;  5F27 A;  3SYT A;  3CCS I;  1PUF B;  2KMU A;  1JT0 A;  1QZY A;  2KFD A;  2BXZ A;  3BTI A;  3S3N A;  1OCZ H;  1NTC A;  1ZAO A;  4XLE A;  3GYH X;  2OF7 A;  4EJU A;  3KPH A;  2MLK A;  1NK2 P;  2QM3 A;  4CIC A;  4LB6 B;  4UXN A;  2IXS A;  1T2K A;  2KLO A;  3RJP A;  3TP0 A;  5E1X A;  4U87 A;  1BC8 C;  1VQL I;  3HOV J;  2XGD A;  2OU2 A;  3R0J A;  1VQ9 I;  2EK5 A;  4IX7 A;  2KKO A;  2L7M P;  1SD7 A;  1X1A A;  2P6T A;  4NC8 A;  3N97 A;  2BEO A;  3G6E I;  2EV6 A;  3ESW B;  4XSX F;  5K5Q A;  4ESB A;  1IDZ A;  2ZXH A;  4BJ5 C;  1FSE A;  2HOE A;  3LSH A;  1ZLK A;  5E3L A;  2ZXJ A;  3T0Y A;  3V8L A;  5D8K B;  5DS9 A;  4JQF A;  3W3C A;  2PJP A;  3DEW A;  5BOX A;  3K4K A;  2ZSH B;  3MKZ A;  4BY7 J;  3HBL A;  1SMT A;  2K5C A;  3KP2 A;  2M87 A;  1FMW A;  1TWC J;  1VZ0 A;  2NNN A;  2XV4 S;  2A6H F;  2EIK H;  3BTL A;  1RES A;  4A0Z A;  5IOZ A;  2CRG A;  1IRX A;  3JRE A;  3FXJ A;  5K5R A;  2Z1D A;  1LFB A;  2LLK A;  2KDZ A;  3G1O A;  1BI3 A;  2XB0 X;  2QQ9 A;  3DF8 A;  2O5R A;  3FXU A;  4UY8 I;  1JTY A;  2E34 A;  1B72 A;  2K9S A;  5KAI C;  5A2Q K;  2CV0 A;  2BVL A;  3K9T A;  2DMP A;  2M4G A;  3OL3 A;  2XPV A;  2JN6 A;  1N77 A;  1YIO A;  1UJ8 A;  2IA0 A;  2V6E A;  1X1P A;  4E7Z A;  3AAF A;  5KVR A;  2IS4 A;  3WTW C;  2COB A;  2GXB A;  1FX7 A;  2OUM A;  2CU7 A;  3IH3 A;  1FEX A;  4PGG A;  1WSU A;  3BCA A;  2NAZ A;  4RAY A;  4YEL A;  4CUG A;  5HS9 A;  4UHT A;  2E36 A;  3WGG A;  1TWH J;  3HPG A;  3H5R A;  4G9Y A;  4KT6 A;  1X2N A;  4XKW A;  2VJI A;  5FKL A;  3RKW A;  3MKL A;  1E17 A;  4RB3 C;  1QRY A;  4Y15 A;  3S2W A;  1X1C A;  1DGW Y;  4ANJ A;  4D5C A;  2X48 A;  2VC1 A;  4BEH B;  3M3Y J;  3HRS A;  2QQ8 A;  2HTJ A;  3ZP5 A;  3MZH A;  1XSD A;  1J2X A;  1FT9 A;  4HYE A;  1HC8 A;  4P9F A;  1Z91 A;  2HVQ A;  2X85 A;  3KYC B;  4Z2Y A;  1FLI A;  1YIT I;  5E79 C;  2EB7 A;  2XF6 A;  2EJR A;  1LNW A;  3ISP A;  3I4M J;  3X2Q H;  1KQ0 A;  2QKM B;  3DTK A;  2F5D A;  2JA5 J;  2L9R A;  2VOD A;  3LUR A;  2TDX A;  2DA2 A;  1YQA A;  4XNF A;  1R9T J;  1V55 H;  3LA3 A;  3WOD F;  2JRT A;  4E4H A;  2C6Y A;  2QGU A;  1QZE A;  3RQI A;  3C3W A;  3WGI A;  3QYE A;  1MJB A;  2ZC2 A;  5ICG A;  5B3S H;  2I5U A;  2WAF A;  3ASN H;  1E3P A;  2HYF A;  1BIA A;  2FQ4 A;  4HW0 A;  1ZLJ A;  3EQL F;  4JYK A;  4KIC A;  2OZU A;  3IRQ A;  1IRZ A;  2DI3 A;  4AID A;  4DJA A;  2EWN A;  4HPQ A;  2EZH A;  3HOT A;  1IXC A;  1R5I D;  3ERE D;  3CZ6 A;  2V7F A;  2W1O A;  3ZQI A;  3CCE I;  3BG7 A;  1T6S A;  5HLI A;  3D5L A;  4G6Q A;  2NYX A;  2WV1 A;  4ASN A;  1D0Z A;  1ETQ A;  1LFU P;  3I56 I;  4J19 A;  4ZYH A;  4Q48 A;  2KIQ A;  3D70 A;  1VFC A;  4FT8 A;  2V1N A;  2HYJ A;  1QU3 A;  2HVR A;  2GA2 A;  5JLX A;  1GV5 A;  3DQV C;  1X2M A;  2HZD A;  2MFZ A;  3IC7 A;  3PL8 A;  3J80 Z;  2F5F A;  4DYR A;  3FXQ A;  2HVA A;  4PUS A;  3OYA A;  1SFE A;  2JA8 J;  1YOV B;  1D1A A;  2EPF A;  4M9S A;  3DKW A;  4XL9 A;  2CUE A;  3GXO A;  4AC0 A;  3PQJ A;  2PBI A;  5C4J J;  1X1B A;  4IRG A;  3DLL F;  2WBM A;  3E6C C;  1FTZ A;  3DBR B;  2HDD A;  1IN5 A;  2NXN B;  4AIK A;  3OYD A;  4A3C J;  3TDZ C;  2KIM A;  3R4K A;  1POG A;  3FXM A;  1W7P B;  3PUB A;  5DTD A;  3TW6 A;  3QWL A;  2PLY A;  3OYG A;  1S7O A;  2V6C A;  3ZCO A;  4BDY A;  2XAJ A;  3PO2 J;  6PAX A;  1OYI A;  1U2W A;  3MVP A;  3P7N A;  5J8C A;  2MD5 A;  3FIS A;  4ZDL A;  3EUH C;  4CGZ A;  1U9N A;  4M3G A;  4PJL A;  5J3L A;  4HF1 A;  1MIJ A;  2GZW A;  3WTZ A;  2UWM A;  1KU2 A;  2OCC H;  5IT3 A;  4HNV A;  2L4M A;  1SFU A;  4XMY A;  3H35 A;  5DYM A;  3PJR A;  2EV5 A;  2VOO A;  3KZZ A;  3HZJ A;  3LA7 A;  2Y48 A;  3PM1 A;  3RIR A;  5DUI A;  1RZ4 A;  3G1L A;  1ZRD A;  2BY3 A;  2XKO A;  3FWE A;  3BWG A;  2QKL B;  1WKM A;  4N9I A;  2IEK A;  3M07 A;  2A68 F;  3VEP A;  1BL0 A;  4M72 A;  3TBI A;  4BEH A;  3OS0 A;  3HL2 A;  3E6B A;  4F55 A;  3F6V A;  3QPT A;  4L5I A;  4W97 A;  1FYL A;  3K7A J;  2VN2 A;  3AFH A;  2XSJ C;  2L02 A;  3EUK L;  2YS9 A;  3G73 A;  4A5N A;  3KZY A;  5FB2 A;  1O57 A;  1I6X A;  1ULY A;  2DT7 B;  2WTE A;  3GME A;  5FRN A;  1YHQ I;  1I1G A;  5CVI A;  4G7O F;  2IGM A;  3VFZ A;  4QTR A;  3ZQG A;  5F08 A;  4UNO A;  2WAQ N;  3E97 A;  3E7L A;  2GXA A;  3ZN0 A;  4QSH A;  1PJR A;  3G71 I;  2RN7 A;  2H09 A;  4HG2 A;  3NWT A;  1EXI A;  1RRJ A;  4HDV A;  1SFX A;  3I53 A;  2KJB A;  3HSF A;  3GWZ A;  1BR4 A;  2PQ8 A;  5EZG A;  2DQR A;  4F52 A;  3G3Z A;  2HOT A;  1MMS A;  1O7L A;  3CCR I;  3H3V K;  5HDN A;  1FBS A;  3KLN A;  3GFJ A;  1TZL A;  1TP4 A;  1X3W B;  4V2G A;  3ZMD A;  3LSR A;  4L0Z B;  1QA6 A;  5L3B A;  1PP7 U;  1K78 B;  2ZSI B;  5JLW A;  4M6Y A;  4ENM A;  5C4X J;  2Z5U A;  5E18 F;  1TLH B;  4XKC A;  5GAH J;  2RQP A;  4JX6 A;  4HQE A;  1FOY A;  2F4I A;  1LE8 A;  3GUD A;  4CCN A;  4RM2 A;  3CCM I;  4AVZ A;  2Q2E A;  4B1R A;  3TP3 A;  1IRG A;  3S8P A;  1RUO A;  2FUG 2;  4QIW N;  1W4M A;  1OKR A;  1V5G A;  5IYD J;  2FRH A;  1R58 A;  3W2A A;  3O8G A;  1ENH A;  3BR3 A;  1YX5 A;  4K2E A;  4OMZ A;  1FYM A;  2AXT C;  4LMY A;  3R60 A;  1QZZ A;  2MW8 A;  4AD9 A;  3E5X A;  3CTA A;  3VPR A;  4B09 A;  4M71 A;  1YTY A;  1J5Y A;  2KQR A;  3VYT B;  1IC8 A;  2LP0 A;  2Y69 H;  2GIV A;  3Q9V A;  5D5W B;  1JUS A;  1QO0 D;  3ZQF A;  4M9Z A;  1VQ8 I;  1IXR C;  1IV8 A;  1XN7 A;  1ZHF A;  3V8J A;  2JPC A;  1R6R A;  2F4M B;  3FHZ A;  3E6M A;  1LDD A;  2KZV A;  3BG3 A;  1PUE E;  2NVU B;  3GO5 A;  1Y0U A;  4YIF A;  4ZDP A;  4B4C A;  4EM2 A;  3GLX A;  2IS2 A;  1J0R A;  1ZG3 A;  4EV0 A;  2JA6 J;  3E1S A;  4LG0 B;  1FIA A;  5HS8 A;  4IHT A;  4FE7 A;  4ESJ A;  4BGD A;  3I59 B;  4XRM A;  4I01 A;  4MGR A;  1Z3X A;  4EJW A;  1IXS B;  1OJL A;  4R79 A;  3SQN A;  1QHG A;  2W48 A;  2R5Y A;  4XLA A;  4NB5 A;  3T5X A;  5JI6 A;  1EH7 A;  3L9F A;  3LSP A;  4UVA A;  3ABK H;  5HNH A;  4BDZ A;  3IWZ A;  1TL8 A;  4UV9 A;  4MEX F;  4ENK A;  4BHB A;  1DUX C;  2ADU A;  1K61 A;  2FMY A;  1EKE A;  2IJL A;  4RS8 A;  4HA8 A;  2WC2 A;  4E7J A;  1PYV A;  2M1B A;  5E1Z B;  1MJ9 A;  3CO7 C;  4E7I A;  2XGC A;  3K1N A;  4A3K J;  1OR7 A;  1A6Q A;  3R8K A;  4BXU A;  2LG4 A;  2XPU A;  3OR2 C;  3ECH A;  3ASO H;  3GZN B;  2DDA A;  2VQG A;  1HW5 A;  1P2F A;  4A3J J;  3GW2 A;  5LHG A;  3IV5 A;  1IAW A;  2FNA A;  3OV8 A;  4XN3 A;  1T33 A;  5GAD J;  3S1Q J;  3WG7 H;  3LFU A;  1U6G A;  3DKY A;  4A0Y A;  3S14 J;  3RCO A;  1HA8 A;  1S5L C;  2RDP A;  4ZYA A;  4N4N B;  1R71 A;  1Y0N A;  2WAE A;  1V3F A;  1QVT A;  4Y13 A;  3HIF A;  2CWE A;  1W36 D;  2X6X A;  1JUP A;  3LSJ A;  4MLO A;  2CH0 A;  3FM3 A;  3SZG A;  4OIP F;  4EMS A;  5FKK A;  5M3M J;  5TRD A;  1BIB A;  4XID A;  1OCR H;  3RPU A;  1V5F A;  2ZBK A;  2QLZ A;  3DEU A;  3COA C;  3AG4 H;  2CFX A;  2LKP A;  5B66 C;  1UZC A;  2XC7 A;  4QLC U;  5CQE A;  4X6A J;  5IY5 H;  2L5Q A;  2D5V A;  4WX9 A;  2FE3 A;  2WY8 Q;  1BA5 A;  1YJN I;  4KT5 C;  2D1H A;  3H1C A;  3T8T A;  2FD5 A;  3F23 A;  3Q3D A;  5H2F C;  1GXQ A;  2EIL H;  2LC2 A;  2W00 A;  3CLQ A;  2N8G A;  4XBF A;  3BQZ A;  2IA2 A;  4I02 A;  1N78 A;  4N0B A;  3BJO A;  3PNV A;  1TW2 A;  1IN7 A;  5K7F A;  4KA4 A;  2E1O A;  4ESF A;  2VQC A;  5KCB A;  1W1W E;  5IP9 J;  1Z3Y A;  1VQ7 I;  2VJ5 A;  5LGU A;  3D6Y A;  2EZK A;  4AU7 A;  3F9K A;  4YRV A;  2VKE A;  2NS0 A;  2WA0 A;  1T38 A;  2JJ7 A;  2ZFU A;  1T39 A;  1JKR C;  4FIS A;  2V1U A;  2VI6 A;  1JXS A;  1EV7 A;  3LMM A;  1E2X A;  1UG2 A;  1W5S A;  5A2Q Z;  1W0T A;  1I3A A;  3BJ6 A;  3RQ4 A;  4UVC A;  4KYW A;  2ZME C;  1HKT A;  2E7X A;  1FBQ A;  3SZT A;  3TOB A;  3QP6 A;  2XHK A;  1KU9 A;  3LQR A;  4U0Y A;  2G7H A;  3V4G A;  1RR7 A;  4BQN A;  2P6S A;  1F43 A;  4I99 C;  4DBR A;  4DYC A;  1G4D A;  1ZEL A;  1IN4 A;  2AS5 F;  4I09 A;  4DQ2 A;  2QEX I;  2PX9 A;  4O6J A;  2A07 F;  3Q2Y A;  2DU9 A;  1YI2 I;  1HCR A;  1Z6R A;  4RDU A;  2MAB A;  5DCF A;  5F64 A;  1XDU A;  3I55 I;  4Y7N J;  1CGP A;  2M34 A;  2HXI A;  4CCL A;  1LEA A;  4LJZ F;  3HXL A;  1K4S A;  2LSO A;  2VBZ A;  1LDJ A;  3B73 A;  3WTS C;  2IT0 A;  3S1R J;  4CYC B;  3CDH A;  2DDB A;  4JBA A;  5ICF A;  2QF7 A;  3FXO A;  3CF5 F;  4IVN A;  2Z33 A;  1V4R A;  1FMV A;  1FIP A;  1S8N A;  1WJE A;  1ZH5 A;  4IRH A;  4G8X A;  2L3D A;  3CMM A;  3NQO A;  1KU3 A;  1B1B A;  3DCF A;  3OYN A;  1KON A;  4A3F J;  1MBK A;  1W36 C;  4CHU A;  1XTA A;  2YSR A;  4BE2 A;  3L2Q A;  3VYU B;  1REP C;  5L3C A;  3EDP A;  4KMF A;  3WU2 C;  3I4P A;  2GOM A;  4WXD A;  2FU4 A;  2M3A A;  2DPU A;  3CUQ C;  3B49 A;  3IKV A;  2V1X A;  4R1H A;  4AYB N;  2KP6 A;  3KZI C;  1OYY A;  3V8K A;  2NVQ J;  1SVM A;  5J4V A;  3TGN A;  3F0C A;  4M74 A;  2FOW A;  1IO2 A;  4O5V A;  4OWR B;  3BQY A;  4D0P A;  2CV1 A;  4WXH A;  4BXX J;  3BRO A;  1SD5 A;  5FLM J;  2R7T A;  4XKV A;  3D6Z A;  3L1P A;  2VON A;  3J80 K;  3H3Z A;  1SAU A;  3GK6 A;  4NUB A;  2VT2 A;  2AQF A;  4XLP F;  5K7Z A;  1WFX A;  3I9V 2;  4EM1 A;  4OIR F;  1K6Y A;  2FNP A;  1P92 A;  1BR1 A;  2X4H A;  2CUZ A;  2DQL A;  2V9P A;  5EDN A;  1OCC H;  2MGQ A;  1H9T A;  3FK6 A;  2EIM H;  4BJ6 C;  5ILU A;  3BPV A;  3DTE A;  3C18 A;  4OAZ A;  3AL0 C;  4BAY A;  1UAA A;  2O03 A;  2BE5 F;  4L9J A;  3IH2 A;  3ZMV A;  5KAW A;  3I0T A;  2VE8 A;  3UKG A;  2YR2 A;  5KAU A;  4KJZ A;  2BHZ A;  3GFI A;  1PDN C;  3EPZ A;  5L3G A;  2Y9Z A;  3Q1M A;  2ETH A;  1YRN A;  4EM0 B;  1HW2 A;  1D3Y A;  2Y30 A;  4XM3 A;  3MQ0 A;  3AL0 B;  3O3K A;  3HJE A;  2MH2 A;  4RLF A;  3Q0V A;  3L2U A;  1KU7 A;  1OQY A;  3Q9S A;  1IV6 A;  3G2B A;  3H92 A;  2F48 A;  2R0Q C;  2E35 A;  2BZT A;  1ORK A;  2D1V A;  1UB9 A;  1T8I A;  2FA5 A;  3PIO F;  1Z05 A;  3DLA A;  2XGX A;  3OOP A;  1GVJ A;  5C44 J;  4FAS D;  5K5O A;  2CQN A;  2KCU A;  1XD7 A;  1WWX A;  1JHH A;  2DMN A;  1HXD A;  1XMX A;  2LYC A;  2GIZ A;  1OMI A;  3OIO A;  1YW7 A;  5M5Y J;  3FBI B;  5L3F A;  2BVM A;  2PG4 A;  1S3J A;  3R8J A;  3ZR8 X;  5KCM A;  3AG3 H;  1XGM A;  2HFH A;  2Q1Z B;  3IWF A;  1HLV A;  3KP6 A;  2FML A;  1X1D A;  4XLH A;  4BE1 A;  1BOW A;  4AYB A;  4N9H A;  3GTG J;  3OYK A;  3OYI A;  1XCB A;  4PK4 A;  1FTT A;  3MD2 A;  3KP4 A;  2E1M B;  2KRH A;  2IVM A;  1MNE A;  3BR5 A;  1A31 A;  3ZMS A;  1WH7 A;  3JRA A;  2FXA A;  2MYS A;  1GLN A;  1TWF J;  2YX4 A;  4IKF A;  5LRR A;  2HOA A;  1T95 A;  4GYG A;  4CYC A;  3MCZ A;  2HQ5 A;  3GVA A;  3JRB A;  3FXK A;  3L2R A;  2R7F A;  3F6O A;  1ZN2 A;  2VUM J;  1XMA A;  1Z9C A;  2E1M C;  2DXI A;  3QOE A;  1LKX A;  3B6A A;  1UCR A;  4F7Z A;  3HKZ A;  2DA5 A;  3RZD J;  3A4C A;  1G2H A;  1VQP I;  5CPR B;  1U78 A;  4RB0 A;  2V1D A;  2HPI A;  1APL C;  5JR3 A;  4HEA 2;  5KNL A;  2HI3 A;  4DYQ A;  3LQQ A;  4U7D A;  1WI9 A;  2XRL A;  5HOO A;  1TQI A;  4GFB A;  3J7A O;  1IUY A;  2NOG A;  2OD5 A;  4RMN A;  4ZC3 A;  2CSO A;  2ECB A;  3K1P A;  1MMG A;  4H4K C;  2K86 A;  3KCC A;  2WB1 A;  4G6T B;  4EAT A;  3CJQ B;  5KHD A;  2UZK A;  5EGO B;  5FRM A;  5F0F A;  4H0E A;  2K85 A;  2JTV A;  3QP5 A;  3RI4 A;  1YX3 A;  2PFB A;  5LEJ A;  4BHC A;  1SEU A;  3F3X A;  5J1U A;  5D4S A;  3WTT C;  1FOK A;  5EGO A;  2Z9O A;  5E8I A;  4LGW A;  3BZC A;  5EEH A;  1TT0 A;  2LDU A;  1CF7 A;  1ETX A;  4L0Y B;  1YG2 A;  2FEZ A;  1IJW C;  1ZKG A;  2JK3 A;  4PSX A;  4L18 B;  3ZXS A;  5B1A H;  4FTH A;  3BZ6 A;  2DW4 A;  3U1K A;  2EH3 A;  5E3N A;  1A36 A;  1BJA A;  3ZMT A;  2L4A A;  5LEK A;  4I0B A;  1X4P A;  4YFK F;  2LNB A;  4HBL A;  5J1Y A;  3IAM 2;  1WJA A;  5E20 A;  4CCJ A;  2ZJR F;  2H6C A;  3F8B A;  1TQM A;  3OSG A;  2ELJ A;  2MBF A;  1IDY A;  1AHD P;  3C2B A;  4C3J J;  2QCO A;  4LK1 F;  4LIU A;  1H8A C;  1JYH A;  1IW7 F;  1H9G A;  4NDL A;  1D5Y A;  2K02 A;  3QAH A;  4ITV A;  1MBF A;  2M7A A;  4PJJ A;  3HGG A;  2E71 A;  1X4O A;  3M8J A;  4EGZ A;  2DFE A;  4ZH4 F;  5ERI A;  2TCT A;  4P1W A;  3TMO A;  1RC9 A;  4A93 J;  4Y52 J;  3HG9 A;  1K4T A;  2L7F P;  5LD2 C;  1HSJ A;  3HM5 A;  4MO7 A;  2K9M A;  1FOW A;  4A3M J;  3FKI J;  2UXN A;  4OAY A;  2A5Y B;  2HQN A;  1D8J A;  1I1S A;  4PJN A;  1G59 A;  3NAR A;  5D6E A;  4GDF A;  3CJN A;  3PUF A;  5LFA A;  4IOC F;  1TT5 B;  5BQT A;  4F3Q A;  1WZ2 A;  3ZQH A;  1W0U A;  4MHG A;  4NQW B;  5HLG A;  3I58 A;  3J81 K;  4AM3 A;  1ZYR F;  1VND A;  2VPR A;  4M73 A;  2EBI A;  4Q47 A;  2H8R A;  2A6T A;  4RLQ A;  4C9Y A;  1KA8 A;  4XON A;  2E2I J;  3GTQ J;  2DOA A;  1YW8 A;  2COM A;  1SVL A;  1ACI A;  2ZNY A;  5GAE J;  1OLT A;  2Y9Y A;  1Y6I A;  1Y8Q B;  1R4M B;  1OIS A;  4HZF A;  2HR3 A;  2ZXW H;  3D5R C;  1VQM I;  3MWM A;  1EH6 A;  2LR8 A;  5J8F A;  2XAH A;  2QZ8 A;  2G0E A;  3RZO J;  2GAU A;  2WY7 Q;  3HOU J;  2ZO4 A;  3J7A Y;  1QQI A;  3S32 A;  2ACJ A;  5IP7 J;  1IN8 A;  4LK0 F;  3PSI A;  1JT6 A;  3E5U A;  3AG1 H;  2K7L A;  2LBF B;  1DQU A;  3KEQ A;  2QSG X;  1UG0 A;  3H9Q A;  2IS1 A;  3BR2 A;  1OCP A;  5M5W J;  2VT3 A;  1VI0 A;  3HKZ N;  2FSW A;  4NC7 A;  3DFG A;  4KIB A;  3CCU I;  1XGN A;  5HOD A;  2KT0 A;  3JAM Z;  3GTO J;  3L00 A;  3IRR A;  1GXP A;  1AKH B;  2XRN A;  4XLF A;  2X6W A;  3T8R A;  3LL7 A;  1W5C C;  5TGT A;  1LVK A;  3FHN A;  5DM7 F;  1DP7 P;  1P4X A;  2CS3 A;  2BW3 B;  2DJI A;  2DPD A;  5H20 A;  3R61 A;  5L3D A;  3U21 A;  3OS2 A;  1BM9 A;  1LJ9 A;  2LK2 A;  3U9G A;  2HDW A;  1LQ1 A;  3S17 J;  4OIQ F;  1T98 A;  2BW3 A;  4P96 A;  3CO6 C;  2GOV A;  3HSR A;  1MBG A;  2I10 A;  1QPM A;  2B63 J;  4LOC A;  1RI7 A;  2HS5 A;  4E7K A;  5KAF C;  4IHX A;  1TWG J;  3S93 A;  2Z99 A;  1LDK B;  5D5X B;  4F91 B;  5K7H A;  2MC3 A;  1H89 C;  2PEX A;  2YU9 J;  1T56 A;  3Q0U A;  1I6H J;  3BG9 A;  2GXG A;  3K2A A;  3A01 B;  3ZRG A;  3ML6 A;  4BQQ A;  3R0A A;  2ZME A;  5JVG F;  4A3E J;  1F4K A;  2EQR A;  2HWV A;  2IA1 A;  1A6I A;  5IT9 K;  4KN7 X;  3GCM A;  4GXO A;  4U88 A;  2ZME B;  3KE2 A;  1OCO H;  3K1M A;  3O8H A;  1KZH A;  1OYW A;  1R49 A;  2DMQ A;  1G3T A;  2OCE A;  2HKX A;  5DV5 A;  5BNG A;  1QPI A;  1P6R A;  4XSZ F;  3G4S I;  1T0F C;  2IP2 A;  4WK8 F;  1T0F A;  1YYV A;  3UNG C;  1K7A A;  2OAZ A;  4FE4 A;  3K70 D;  2BHY A;  2MLG A;  2ZJQ F;  2A61 A;  4BE0 A;  2W25 A;  4B8X A;  1TWA J;  1YS7 A;  2LVS A;  2DFH A;  2ZKZ A;  3GZ6 A;  1XCV A;  1D0X A;  3H9J A;  2CQQ A;  2PMZ N;  4B3A A;  2XKP A;  2P5K A;  3CCL I;  2V9K A;  4RGU A;  1Z6T A;  3P5J A;  4CXF A;  1FOX A;  2X6O A;  2K9L A;  2GM4 A;  4CH7 A;  2UXX A;  4G6D A;  3F72 A;  4WXC A;  5ICE A;  4KFC A;  2JWT A;  3O2P E;  2J5O A;  2JVH A;  5DDG A;  5FD6 A;  2CV2 A;  2UV1 A;  1BI0 A;  4LB5 A;  2Y31 A;  1ZRC A;  1D1C A;  1UEL B;  1WRJ A;  4J01 A;  1O3R A;  4A3G J;  1KYZ A;  2HEO A;  2HDC A;  3E0H A;  1GHC A;  1BR2 A;  1DGR M;  2V9V A;  1U5T A;  5M3F J;  3BOQ A;  1X19 A;  4M3F A;  4L9V A;  3K4B A;  3DU6 A;  3OSF A;  3IUO A;  3MKY B;  1P9Q C;  1SAN A;  3BR1 A;  3RTR A;  2XDV A;  3F8C A;  2Z3Y A;  2R7O A;  4M3E A;  3QOP A;  2QBY B;  3PQK A;  4RM3 A;  1SD4 A;  3SJM A;  2ISZ A;  3KLO A;  3HUG B;  3PNY A;  2CO5 A;  4I2O A;  2RNJ A;  1ZGA A;  1Y56 A;  4G7Z F;  4RAZ A;  4E70 A;  2L7K A;  5L3E A;  4RB1 A;  2WWY A;  1U3E M;  2VKV A;  3CES A;  3O6B B;  2JQ7 A;  3GFM A;  2QQA A;  3GTL J;  4X1E A;  2DCE A;  1DU0 A;  5HVQ C;  2CW8 A;  2R5Z B;  1V54 H;  3BJA A;  4B3X A;  2PI0 A;  2KIS A;  3AG2 H;  2R93 J;  4E7H A;  4AYZ A;  2VXZ A;  5BS6 A;  4UUS A;  2M0M A;  2DMU A;  2OBP A;  1FY7 A;  3C2H A;  2O8K A;  2MG4 A;  2VKH A;  2E2J J;  3FX3 A;  1S9H A;  3WGH A;  2K3P A;  2VPL A;  4HQM A;  4PFO A;  2LOO A;  2JT1 A;  2EZL A;  1MD0 A;  2LD5 A;  1XGS A;  2D2W A;  1ZRF A;  2R7S A;  5KAT A;  2CW7 A;  4BH9 A;  3HSE A;  1G6N A;  4UB8 C;  4S04 A;  2M5W A;  4C30 A;  2P7V B;  2DA3 A;  3F22 A;  1A04 A;  1Q1V A;  1S6L A;  5E3O A;  4WWC A;  5FLV A;  4LIV A;  3CJR B;  3HOY J;  2FBK A;  3CME I;  1WGX A;  1IN6 A;  4EGY A;  2B9S A;  2R7Q A;  1MMD A;  2Z2S B;  3GX4 X;  2PJR A;  3MAJ A;  2QQB A;  4ZZD A;  3WE3 A;  1DPU A;  5LRS A;  3AKZ A;  2R7R A;  3VOE A;  1E3H A;  5EEG A;  1WH5 A;  1FJL A;  3MZ8 A;  2H94 A;  3ULQ B;  2DT6 A;  2WAD A;  1XSX A;  2Q8K A;  5JHU A;  1ETV A;  4MEY F;  3DPL C;  2DYS H;  5FKM A;  5EEA A;  3IL2 A;  1YS6 A;  1YO5 C;  1BI1 A;  2MA3 A;  1ZRE A;  2OC6 A;  2QSH X;  3T1B A;  3B02 A;  1MH3 A;  2E2H J;  2NNY A;  3OMY A;  1O3T A;  3CC4 I;  2IGO A;  3PFY A;  3CCJ I;  2LF8 A;  2M8G X;  1V5E A;  3L2C A;  2DK5 A;  3I59 A;  4IHW A;  2LMD A;  1OCT C;  2Z16 A;  4XRS A;  4IHY A;  2DMT A;  2VC0 A;  4ZDO A;  2VLA A;  1F1Z A;  2LKX A;  2MH9 A;  4HV6 A;  3CMA I;  2GWR A;  4PCQ A;  4DZJ A;  3QPH A;  4NNJ A;  3RDI A;  2PMH A;  1HKQ A;  5D4R A;  4LD5 A;  1QVU A;  4RGX A;  5CYV A;  3OIQ A;  3OYM A;  1ZR2 A;  2VQH A;  3RSN A;  4PJ0 C;  4AVP A;  2X1E A;  2K9N A;  5D6F A;  3CUQ A;  1H0M A;  3UR3 C;  3WU1 B;  3HOW J;  2EIN H;  1XDS A;  2YUS A;  5KAX A;  2BXY A;  1TQP A;  2F5C A;  4KMU X;  1B9M A;  1JHF A;  1MNM C;  4A6D A;  4G12 A;  1SFO J;  2IS6 A;  4E7L A;  2R3S A;  3FIW A;  4ZJZ A;  2YPR A;  2ECC A;  3CJT B;  2MC4 A;  1AU7 A;  5J1R A;  2O8X A;  3BDD A;  4KIS A;  2BY2 A;  1GDT A;  3SZP A;  1JJ8 C;  1VQ6 I;  3LAP A;  1J59 A;  4MFD A;  3JRI A;  4IHS A;  2R5Z A;  5M5X J;  1I50 J;  1ON1 A;  1JJ6 C;  3C2G A;  1L0O C;  3BR6 A;  2E5Z A;  4X0G A;  3GTM J;  2NS8 A;  2QUF A;  4IXA A;  4RAG A;  1YJ9 I;  3MZY A;  1ERD A;  4Q4Z F;  1DP3 A;  3OR1 C;  3C7J A;  3MMY B;  5DD8 A;  4CDG A;  2E1C A;  1B6A A;  3I4N J;  4AIJ A;  3FMS A;  4C2M J;  4DW6 A;  4Z6Y A;  3ZN1 A;  1K6O A;  1R23 A;  3EUA A;  2DA6 A;  2DBB A;  3PIP F;  3CC7 I;  3GTK J;  1VQO I;  2ESH A;  4PDK A;  1IG7 A;  2RVC A;  5E17 F;  2L9V A;  3NRV A;  1TNT A;  3Q5R A;  3CDL A;  3Q5S A;  1MBJ A;  4EJT A;  2AHQ A;  3M8E A;  1EF4 A;  1HOM A;  2KIF A;  5H6Q A;  4KIF A;  2W85 A;  2LF7 A;  1BJZ A;  3VYR B;  1HDP A;  1U5T C;  2AQE A;  5DCM A;  4CSW A;  3FK7 A;  2HPM A;  3BP8 A;  1B59 A;  1RKW A;  5LGT A;  4CYD A;  3HOX J;  2BV6 A;  2FF4 A;  4M3B A;  1E3O C;  3GTP J;  1B4A A;  5LGN A;  2DN0 A;  4HST A;  3TQN A;  2XRO A;  2YX7 A;  1HQC A;  3LNQ A;  1TBX A;  5IPA A;  1P4A A;  1U5T B;  2DOD A;  3NEU A;  3ZQQ A;  4IOA F;  4HX7 A;  5GPC A;  3FXL A;  3QOD A;  3BG5 A;  3L7W A;  2Q0O A;  2LBF A;  3JRD A;  1A35 A;  2DFI A;  2VE9 A;  2K4B A;  1R1U A;  1OFC X;  1R5H A;  4B0Y A;  2XPW A;  2ME0 A;  1LVA A;  2P0W A;  1RKT A;  2Y75 A;  3N4M A;  1MGT A;  3GBG A;  5FKO A;  2JRM A;  4ABZ A;  2GLO A;  3DKX A;  2I8D A;  4B48 A;  1N25 A;  4HNU A;  4D7N A;  1I5Z A;  4GCV A;  1MJA A;  2XAF A;  1G3W A;  3K69 A;  3ZMU A;  3IHU A;  4EJO A;  1D0Y A;  4B43 A;  4YIR X;  1ZGJ A;  3EYI A;  3FBN B;  5D8L B;  2JUG A;  2OV7 A;  4RAF A;  4HOB A;  1FWZ A;  3V7R A;  2XUB A;  3CP2 A;  3WTV C;  3HYI A;  2IGN A;  3D5S C;  2XVC A;  2R7D A;  2UUZ A;  3K2Z A;  1G8X A;  3BTJ A;  1LE8 B;  4ZTF A;  1EXJ A;  5F1J A;  4JX5 A;  3CCQ I;  1HW1 A;  3TED A;  2HYG D;  2RC4 A;  4Y17 A;  3WHB A;  1BI2 A;  2A3S A;  3HRM A;  3F8F A;  5JVT A;  4Q5S F;  3SEQ A;  3JCU C;  4FQG A;  1MMN A;  2LY9 A;  1AA7 A;  3IAO A;  2Y0M A;  2AXL A;  5E1W A;  5FKN A;  4C2T A;  4D1Q A;  1RPW A;  3N05 A;  2CW0 F;  1I3Q J;  1MBE A;  4YFN F;  5F1R A;  2VBW A;  3JTH A;  4RBO A;  2ESN A;  1K79 A;  3LSI A;  1GVD A;  2RGV A;  3M4O J;  3IAS 2;  1MZB A;  2E7W A;  3NAU A;  1MSF C;  5EJC A;  3F21 A;  3JW4 A;  4QWQ A;  3RPU D;  4BS9 A;  4HNT A;  1ONV A;  1GUU A;  1RR8 C;  4PGH A;  3CD6 I;  3VSK A;  5AIQ A;  1QNT A;  1W5T A;  1NK3 P;  3QYF A;  5ILV A;  3DU5 A;  4HX8 A;  3P9C A;  1F9N A;  2XF5 A;  4S05 A;  5GPA A;  4A1M A;  5EF6 A;  1C0W A;  2HTS A;  1MMA A;  2XAS A;  2L54 A;  5C3E J;  5LBQ A;  4KDP A;  2RNG A;  2R7X A;  5CVV A;  4ZYG A;  1QHH D;  4Y33 A;  2KJC A;  4ZTJ A;  2R5Y B;  2O0Y A;  3ABM H;  3BG6 A;  1O3Q A;  1XC5 A;  2X6Y A;  4BAC A;  1D5V A;  4E6K G;  1WCM J;  3Q3S A;  5FFZ A;  5DM6 F;  3WTX C;  1YRN B;  2EIJ H;  3H5N A;  3K4C A;  3V7S A;  2K3F A;  1ETY A;  5JFR A;  2AO9 A;  4CA0 A;  2XAQ A;  2F5V A;  1SD6 A;  4L9N A;  1BC7 C;  4IF4 A;  3SHF A;  1R5G A;  2Y2Z A;  1SVO A;  1O4X A;  3QU6 A;  1XG1 A;  2W82 A;  3FDY A;  2XAG A;  4XK4 A;  2K27 A;  3DTI A;  1VF9 A;  4J00 A;  3Q0W A;  5CVJ A;  2IRF G;  3S1M J;  2QVO A;  1ETK A;  1LPQ A;  1R1T A;  3K4L A;  3A1Y A;  4ZZL A;  2OA4 A;  1U8B A;  2RAE A;  1BBY A;  3LSM A;  4NHJ A;  3QQA A;  1DPR A;  1TC3 C;  4OIN F;  1R7J A;  1FC3 A;  3I64 A;  3DPU A;  3HTS B;  3TL4 X;  4IRI A;  4FCY A;  4BHP A;  2MD0 A;  4XOR A;  4YEJ A;  3PSF A;  2PN6 A;  4MNU A;  2LH9 A;  4OIO F;  4OU0 A;  1JKQ C;  3U2R A;  3VSL A;  4BNC A;  1T08 B;  2HU9 A;  2RKH A;  5BPD A;  3LAJ A;  2W24 A;  2G7U A;  3ERM A;  2QSF X;  1Y8R B;  2OQG A;  4EQQ A;  1VTN C;  1VQN I;  1G3S A;  3KX2 A;  5FLX K;  3OY9 A;  2R7U A;  1XMK A;  1ZG1 A;  1R1V A;  2JZY A;  4V2F A;  3ABU A;  4E7S A;  2TRT A;  2GA1 A;  3V42 A;  2KRC A;  1Z21 A;  5LHI A;  3JAM K;  2FBI A;  4BY1 J;  4C3I J;  3PO3 J;  3S1N J;  2M8E A;  3MKW B;  1ZGW A;  3H9G A;  2KL4 A;  2PMZ A;  4MQV A;  4N4O B;  3SDG A;  5E8G A;  3BTC A;  1F36 A;  1N75 A;  3KP7 A;  4FX0 A;  1R4N B;  3VB2 A;  2DFF A;  1W7P A;  4YFX F;  2W84 A;  2IW5 A;  5FLX Z;  1OR7 C;  2DAO A;  1MSE C;  2H8W A;  2VKD A;  2VJJ A;  2Y0S A;  2HQA A;  4MFE A;  3W6J B;  1JGS A;  1SC7 A;  2OQR A;  4FX4 A;  2ELH A;  2CGP A;  2H1L A;  3B6C A;  3OIP A;  3ABT A;  2B7E A;  3E6D A;  1JKP C;  4JOM A;  3HPH A;  2ME6 A;  2DOE A;  2DOF A;  3CP8 A;  3TOA A;  3A2K A;  1ZAR A;  3MEX A;  4FHT A;  4GGG A;  5IYB J;  1ZK8 A;  3JRC A;  2V79 A;  3BR0 A;  4UVB A;  3VDX A;  2VJ4 A;  1BN5 A;  3TO6 A;  2K4J A;  3LWF A;  3SXY A;  1S7A A;  3K6G A;  2VBX A;  4P55 A;  4PFP A;  2DJN A;  3ZOB A;  4BKX A;  2VL8 A;  1AKH A;  5F04 A;  5BPI A;  3R6S A;  3OYB A;  4I7H A;  4C2U A;  3IP4 B;  2H27 A;  4HF0 A;  4M9X A;  4CZZ A;  3BZK A;  4A3B J;  1P7I A;  2ZCW A;  5HDG A;  2FX0 A;  1XB4 A;  4NBQ A;  2M45 A;  5F0C A;  4DZP A;  3A02 A;  2X0L A;  3HC7 A;  3FKJ A;  4PSW A;  3E5Q A;  3GTJ J;  2HZT A;  1I39 A;  2ISY A;  4M6V A;  1U8R A;  3QRF F;  4WCG A;  1STZ A;  4XR6 A;  2ZB9 A;  1WJF A;  3DXJ F;  3OYL A;  3ECO A;  4C3H J;  1EJ9 A;  4LLL A;  1SFK A;  3BC8 A;  3OS1 A;  4JP0 A;  1WHU A;  4IPA A;  4A2U A;  4HRI A;  2A6E F;  3JRH A;  4PJM A;  2EZI A;  2CMP A;  2KIU A;  2ZXI A;  3A01 A;  3ABL H;  3S2D J;  3CDI A;  2OZ6 A;  4AUX A;  1X3Z B;  3A03 A;  4Y3O A;  5CLS A;  3ONQ A;  3W6K B;  1PVE A;  5HS7 A;  1O7F A;  4I98 B;  3S3O A;  4XLN F;  3J7Y J;  2JA7 J;  3KIO A;  2W7N A;  3S3M A;  2HGC A;  3H0G J;  5DUK A;  1JTX A;  4L9T A;  4LFU A;  3I71 A;  5ILS A;  3FMR A;  5GQQ A;  2EV0 A;  3CUQ B;  4G7H F;  5FD5 A;  1P7J A;  2HKO A;  2V26 A;  2HNH A;  3HTU A;  2BYV E;  5LHH A;  3WE2 A;  4DBQ A;  1IUF A;  1XSV A;  1Z7U A;  2Y0S N;  3BY6 A;  2BY0 A;  4LLN A;  4BUP A;  1I27 A;  3HOZ J;  1YE9 A;  1HBX G;  4F93 B;  4RB2 C;  3HOS A;  2JSC A;  4EVI A;  2IPQ X;  1B8I A;  3H36 A;  4HSR A;  4BL0 B;  1J75 A;  4RA2 A;  3K70 C;  1KQ8 A;  1XGO A;  2KRF A;  2VAS A;  3JRF A;  2M0C A;  2VBY A;  3OYE A;  2GQQ A;  4AWX B;  1GT0 C;  2ZJ2 A;  1B8I B;  1U9O A;  1HKS A;  2K9Q A;  2QYO A;  2E19 A;  5AON A;  4I6Z A;  4II3 A;  3OYC A;  2ID6 A;  2JSP A;  2P5V A;  4ZYD A;  2X1C A;  3M9A A;  3W2W A;  4TV7 A;  4P9U A;  4UUV A;  1BOA A;  5B1B H;  1H88 C;  2M2E A;  2NRA C;  3M7G A;  1CF7 B;  2O9L A;  3CUO A;  3KP3 A;  2DK8 A;  2VB6 A;  1X58 A;  1K83 J;  2HXO A;  2RV8 A;  4II2 A;  4F92 B;  4IL6 C;  3WTU C;  2LY1 A;  1M1E B;  4XN0 A;  2BGC A;  2DLL A;  4JX4 A;  3W2V A;  1ODD A;  2L0K A;  3ZGK A;  3QU3 A;  1Y1W J;  2LKS A;  1LEB A;  2DA4 A;  2BY1 A;  1JI8 A;  1S7E A;  2CG4 A;  2KHM A;  3WTY C;  1USS A;  1ZG5 A;  1UMQ A;  2P81 A;  4GRI A;  4HLY A;  2CQ7 A;  4A12 A;  1JUM A;  2X9D A;  1ZQ3 P;  1Z67 A;  1Z1D A;  1FP2 A;  1SAX A;  3DV8 A;  1NHA A;  2GOX B;  5LLQ A;  2MSY A;  5GTH C;  2EFW A;  4BU2 A;  3DBL B;  4BQA A;  3P9I A;  3GLL A;  5FFX A;  3ROU A;  2H1K A;  1YJW I;  2X1D A;  3G1M A;  2NOJ B;  3Q5F A;  2XB5 A;  2EA2 A;  2QWW A;  9ANT A;  3RKX A;  4DOZ A;  4U7B A;  1J7K A;  2W57 A;  2DA1 A;  3F8M A;  2A05 A;  1LUJ B;  2R4G A;  4AYZ B;  5HDK A;  3CLO A;  1RNL A;  1IRF A;  3FM5 A;  2M7B A;  2KZG A;  1LB2 A;  3FZV A;  4P5O A;  4L5J A;  2E5N A;  2O61 A;  1TNS A;  2QEN A;  1ON2 A;  1G3Y A;  4Y4R A;  2HOS A;  5DEQ A;  1MKM A; 
#chains in the Genus database with same CATH homology
 2HYJ A;  1FTT A;  1HF0 A;  1MNM C;  4G12 A;  4A3D J;  1GV2 A;  1SFO J;  2IBD A;  5JLX A;  3BR5 A;  1GV5 A;  1WH7 A;  3FIW A;  1X2M A;  3JRA A;  2ECC A;  1TWF J;  1AU7 A;  5J1R A;  4DYR A;  1WI3 A;  2HOA A;  1GDT A;  1JJ8 C;  4CYC A;  2HQ5 A;  3JRB A;  2HVA A;  4MFD A;  3JRI A;  2JA8 J;  4BBR J;  2R5Z A;  5M5X J;  1I50 J;  2VUM J;  1JJ6 C;  2CUE A;  3BR6 A;  2R92 J;  4AC0 A;  5C4J J;  3GTM J;  2NS8 A;  3B6A A;  1FTZ A;  3CCY A;  4EEF G;  4A3I J;  2DA5 A;  3RZD J;  2HDD A;  1G2H A;  1U78 A;  4A3C J;  3S16 J;  3I4N J;  1APL C;  4C2M J;  4DW6 A;  1POG A;  5DTD A;  3TW6 A;  1Z0X A;  2M9H A;  2DA6 A;  5KAV A;  3GTK J;  2HI3 A;  4DYQ A;  1IG7 A;  2XRL A;  3PO2 J;  3Q5R A;  3CDL A;  1RET A;  1MBJ A;  4GFB A;  3MVP A;  3Q5S A;  2AHQ A;  2NOG A;  1EF4 A;  1HOM A;  2ECB A;  3FIS A;  1BJZ A;  1HDP A;  1U9N A;  3CQZ J;  4M3G A;  5J3L A;  1MBH A;  5EGO B;  3FK7 A;  5F0F A;  1RKW A;  4XRS G;  4HNV A;  3HOX J;  4M3B A;  5J1U A;  1E3O C;  3GTP J;  5EGO A;  2DN0 A;  3LNQ A;  3PM1 A;  3G1L A;  5IPA A;  4D5F A;  3Q5P A;  2XSD C;  2IEK A;  1ETX A;  1BL0 A;  1IJW C;  5IOY A;  2WB1 N;  1ZKG A;  2JK3 A;  5GPC A;  3BG5 A;  3W6V A;  4FTH A;  2JMW A;  4W97 A;  4D7M A;  3K7A J;  3JRD A;  2EH3 A;  5E3N A;  1OFC X;  2YS9 A;  4B0Y A;  2XPW A;  1ZTR A;  2ME0 A;  1RKT A;  2ELK A;  1Y1V J;  3GBG A;  5FKO A;  3TW7 A;  4ABZ A;  1HDD C;  5J1Y A;  5IYC J;  2GLO A;  2CJJ A;  4D7N A;  4QTR A;  3ZQG A;  5F08 A;  3OSG A;  2WAQ N;  3E7L A;  1Z77 A;  1IDY A;  1AHD P;  4QSH A;  3C2B A;  4C3J J;  2QCO A;  1H8A C;  2BOW A;  1JYH A;  2OPT A;  4NDL A;  4BBS J;  1D5Y A;  1EXI A;  1MBF A;  3HGG A;  2CUF A;  2HOT A;  5EZG A;  3H3V K;  2TCT A;  4V2G A;  2R7Z J;  3LSR A;  4Y52 J;  2L7F P;  3HM5 A;  3ZQC A;  1BW6 A;  4MO7 A;  5JLW A;  3BTJ A;  5EYR A;  4A3M J;  3FKI J;  1LE8 B;  4A69 C;  4UUS B;  1IGN A;  5F1J A;  1EXJ A;  4JX5 A;  5EZH A;  5C4X J;  3TED A;  4JX6 A;  3NAR A;  3WHB A;  1LE8 A;  1JGG A;  3ZQH A;  3TP3 A;  4B1R A;  1W0U A;  2DTZ A;  2LY9 A;  3IAO A;  2NS7 A;  3HEF A;  5FKN A;  4QIW N;  1VND A;  2VPR A;  2EBI A;  5IYD J;  2IAI A;  3OOU A;  2H8R A;  1RPW A;  1I3Q J;  1MBE A;  3JR9 A;  4RBO A;  3O8G A;  1ENH A;  3BR3 A;  3CMY A;  2E2I J;  3GTQ J;  1GVD A;  3M4O J;  3NAU A;  1MSF C;  1ZR4 A;  2DA7 A;  2MW8 A;  5FJ8 J;  2Y9Y A;  3VPR A;  1GUU A;  2NVY J;  2CQX A;  1IC8 A;  3WHC A;  2LP0 A;  1JUS A;  1UHS A;  3ZQF A;  1NK3 P;  2LR8 A;  2G0E A;  3SFI A;  3RZO J;  5GPA A;  4A1M A;  3BG3 A;  3HOU J;  4B4C A;  1PUF A;  2K40 A;  5EF6 A;  2O7O A;  5C3E J;  2GBY A;  5IP7 J;  5EG0 B;  1XS9 A;  2JA6 J;  1JT6 A;  1FIA A;  3ZQL A;  4S0H B;  2R5Y B;  4FE7 A;  5EG0 A;  1A5J A;  3S15 J;  1XC5 A;  4XRM A;  2NVX J;  1WCM J;  3Q3S A;  1OJL A;  1OCP A;  3BR2 A;  1YRN B;  5M5W J;  2W48 A;  2R5Y A;  1VI0 A;  3HKZ N;  1ETY A;  3LSG A;  2AO9 A;  5HOD A;  2KT0 A;  2XGE A;  3LSP A;  3GTO J;  4M3D A;  1MH4 A;  1AKH B;  4IEJ A;  2Y2Z A;  3JRG A;  1O4X A;  1R8E A;  1XG1 A;  4XK4 A;  1VF9 A;  4L5E A;  3IH4 A;  1K61 A;  3Q0W A;  3S1M J;  1ETK A;  1BW5 A;  4A3L J;  3RKQ A;  1U8B A;  2RAE A;  2LK2 A;  2XGC A;  3S17 J;  4A3K J;  3QQA A;  3R8K A;  2GOV A;  1MBG A;  1DU6 A;  2I10 A;  2XPU A;  2B63 J;  4LOC A;  4FCY A;  4A3J J;  4IHX A;  3IV5 A;  1TWG J;  1T33 A;  1CQT A;  3S1Q J;  5K7H A;  2LFB A;  1JKQ C;  3S14 J;  1H89 C;  3MN2 A;  2YU9 J;  1ITY A;  1T56 A;  3Q0U A;  5IP6 A;  1I6H J;  3BG9 A;  3K2A A;  3A01 B;  3HDD A;  1B72 B;  1QVT A;  4A3E J;  2EQR A;  1A6I A;  1JUP A;  3LSJ A;  4MLO A;  1JKO C;  4IHV A;  3HB9 A;  4V2F A;  2TRT A;  4BY1 J;  3PO3 J;  5FKK A;  3S1N J;  3O8H A;  5M3M J;  4C3I J;  2DMQ A;  1ZGW A;  4XID A;  3D1N I;  3SDG A;  5F0H A;  5E3M A;  3BTC A;  4XIC A;  5BNG A;  1QPI A;  1F36 A;  1WPK A;  2NVT J;  4FE4 A;  1MSE C;  4X6A J;  2D5V A;  4UUT A;  4MFE A;  4MIM A;  1BA5 A;  1TWA J;  2LVS A;  2FD5 A;  3Q3D A;  1ETO A;  2CQQ A;  2PMZ N;  5GP9 A;  2N8G A;  3B6C A;  3HGY A;  4W1U A;  4I76 A;  4B3A A;  1TC3 C;  3BQZ A;  1JKP C;  2LTP A;  3D71 A;  2ME6 A;  5IYB J;  2X6O A;  1ZK8 A;  5K7F A;  3S2H J;  2GM4 A;  3JRC A;  2E1O A;  3BR0 A;  5KCB A;  5IP9 J;  3BT9 A;  3D6Y A;  2JWT A;  2DJN A;  3QPL A;  3LOC A;  2EZK A;  3ZOB A;  2L7Z A;  3QPS A;  4BKX A;  1AKH A;  2VKE A;  5F04 A;  1ETW A;  2JJ7 A;  1JKR C;  2Y31 A;  4FIS A;  2FJ1 A;  2ID3 A;  2VI6 A;  4A3B J;  1P7I A;  1UG2 A;  1W0T A;  2FX0 A;  5F27 A;  4A3G J;  1PUF B;  1JT0 A;  3E0H A;  5F0C A;  3BTI A;  4DZP A;  3A02 A;  1NTC A;  5M3F J;  2OF7 A;  4M3F A;  3GTJ J;  1NK2 P;  4M6V A;  1RR7 A;  3OSF A;  1F43 A;  1SAN A;  3BR1 A;  2ZB9 A;  4DYC A;  4C3H J;  4M3E A;  3TP0 A;  4JP0 A;  3Q2Y A;  3HOV J;  1HCR A;  2XGD A;  3SJM A;  4RDU A;  3JRH A;  2EZI A;  2L7M P;  4Y7N J;  3A01 A;  2M34 A;  2HXI A;  3S2D J;  4AUX A;  3A03 A;  2VKV A;  3S1R J;  4CYC B;  3GTL J;  4X1E A;  2QF7 A;  1DU0 A;  2JA7 J;  1IDZ A;  2R5Z B;  5E3L A;  1FIP A;  5DS9 A;  3H0G J;  1JTX A;  3DEW A;  2R93 J;  3DCF A;  4AYZ A;  4BY7 J;  5GQQ A;  3HBL A;  4UUS A;  1MBK A;  4A3F J;  2DMU A;  1TWC J;  2O8K A;  2MG4 A;  1P7J A;  5IOZ A;  3BTL A;  1RES A;  2E2J J;  2CRG A;  3JRE A;  1LFB A;  1IUF A;  2LLK A;  2Y0S N;  2KDZ A;  3G1O A;  4AYB N;  3B49 A;  2XB0 X;  2EZL A;  2NVQ J;  3HOZ J;  2LD5 A;  1JTY A;  1B72 A;  5KAT A;  3F0C A;  2K9S A;  2DMP A;  3BQY A;  2XPV A;  4BXX J;  2JN6 A;  5FLM J;  1B8I A;  3D6Z A;  3L1P A;  2DA3 A;  1Q1V A;  5E3O A;  3JRF A;  2M0C A;  5FLV A;  3GK6 A;  5K7Z A;  3HOY J;  1GT0 C;  2COB A;  1FEX A;  1B8I B;  2CU7 A;  3IH3 A;  1WGX A;  1U9O A;  2K9Q A;  2E19 A;  4I6Z A;  5EDN A;  1TWH J;  2ID6 A;  1X2N A;  2MGQ A;  3FK6 A;  5FKL A;  3MKL A;  1WH5 A;  1FJL A;  1QRY A;  1H88 C;  2M2E A;  2O9L A;  4D5C A;  2X48 A;  3IH2 A;  1ETV A;  5KAW A;  1X58 A;  3M3Y J;  1K83 J;  2HXO A;  5FKM A;  5EEA A;  3UKG A;  5KAU A;  3Q1M A;  2Y9Z A;  4JX4 A;  1Y1W J;  2L0K A;  1YRN A;  2DA4 A;  1MH3 A;  2Y30 A;  1S7E A;  2E2H J;  1UMQ A;  2P81 A;  1JUM A;  3Q0V A;  3I4M J;  2X9D A;  1ZQ3 P;  1IV6 A;  2M8G X;  2R0Q C;  2JA5 J;  4IHW A;  1ORK A;  2MSY A;  1OCT C;  2L9R A;  4XRS A;  4IHY A;  3LUR A;  2DMT A;  2LKX A;  2DA2 A;  2H1K A;  3G1M A;  4DZJ A;  1R9T J;  5C44 J;  2XB5 A;  3RQI A;  9ANT A;  2KCU A;  1QVU A;  2DMN A;  2DA1 A;  2FQ4 A;  4JYK A;  1ZR2 A;  3OIO A;  1IRZ A;  5M5Y J;  2EZH A;  4AYZ B;  3ZQI A;  2K9N A;  2WV1 A;  1ETQ A;  1LFU P;  4J19 A;  3D70 A;  3R8J A;  3HOW J;  1VFC A;  4A93 J;  1HLV A;  2YUS A;  5KAX A;  1BOW A;  2HOS A;  3GTG J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...