3Q5SA

Crystal structure of bmrr bound to acetylcholine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5sA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5sA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5sA03
1JYHA 5I44A 2J5UA 1Q09A 5KAVA 1R8DA 2DG6A 2BOWA 3QAOA 1EXJA 1Q0AA 3Q1MA 1D5YA 4R4MA 3LURA 1Q07A 3G9RA 2GOVA 4AYZB 2ZHHA 3IAOA 2VZ4A 2KCUA 3T97B 1EXIA 3Q5PA 4R22B 1JBGA 1Q06A 1Q05A 4WLWA 1R8EA 3D70A 2HVAA 5KCBA 3Q3DA 1DIPA 4B0YA 3GK6A 3Q5RA 2JMLA 5D90A 3D6YA 4R4LA 4J2NA 1BOWA 3E0HA 2ZHGA 3R8JA 4A1MA 3B49A 3HH0A 4WLSA 3D71A 3Q2YA 5E01A 5KATA 4R4EA 2OQQA 5KAWA 3R8KA 3GP4A 3UCSA 5I41B 5D8CA 4AYZA 4R24B 3Q5SA 3D6ZA 5KAXA 1Q08A 3GPVA 5KAUA 5GQQA
chains in the Genus database with same CATH superfamily
2H8PD 5APTA 1Q86Q 2KLVA 2KCUA 1LX8A 3Q5PA 1GD2E 1PPJD 1SQQE 2IBZD 1S3JA 1KN7A 1GL2D 1OVUA 3MGNA 3B5NA 3A2AA 2IYPA 5APYA 1EZVE 3A5TA 1GK6A 2Z4EA 3NTNA 4I2LC 3L35A 4BWNA 4R4EA 3S9OA 1LP1A 2GUSA 2I1KA 1J1DB 1HVVA 1SQVK 1X8YA 1NTZJ 1NO4A 2A45I 1H89A 3A0BE 3AE1C 1PP9D 1LTJC 1HF9A 3G6EP 1BE3D 2KYVA 3V2NA 3L73G 3PP5A 2D2CC 1YQ4C 2WQYC 3RK3D 2A45G 3D6YA 3R8KA 4XE5B 3L74J 1YTZT 2KSEA 1EDJA 4YPCA 4I6MC 2E75C 3R4YA 3H1HE 4CPGA 2FYUJ 1N73C 4WY4C 3H1ID 1RE4A 3HE4B 2OYHA 1RF0A 1SQPJ 1M56D 1QLED 3HE5A 3WUUA 5D8CA 5TJHA 3VOPA 3VYIA 1BCCE 2WVRA 1OVVA 3GF7A 1KYOI 1Q2NA 1LTJB 3A3YB 3QWOC 2W6BA 2QM8A 3SWFA 4YXDC 1IFJA 4RO0A 1DIPA 2D2CB 3H1IJ 2B89A 1M7LA 1IFDA 4EYYQ 5APXA 1OW7A 2KZIA 1JM0A 4AYCA 3C1LA 2AEMA 4PV1D 3AE4C 2E75B 2YNYA 3MIWA 1KILC 4PV1C 2B9BA 1N73B 4WY4B 3L71G 3CWBJ 1NWQA 1YBKA 3M9HA 4ZKPA 3AE2C 4IL6H 1KD1Q 3P8MC 3MUDA 2DG6A 5CCGA 1D5YA 2H88C 4W7YA 4AYZB 1KB9E 1VQOP 1URQD 1AJYA 1KFMA 3BATA 1SVFA 2XZRA 3OA7A 1AQ5A 3AE5C 3A0BH 3L72G 4H13D 3EFFK 1BE3G 3H1LD 1AA0A 3VP8A 1JY2P 4H13C 1FAVA 5KAIE 3VTPC 2HVAA 1KILB 4PV1B 5KLVD 3R8JA 2N9BA 2B87A 2KXPB 1L2PA 4HYTB 2RMZA 1ZR2A 4GKGA 3GF3A 1IFNA 1NTMG 5CCHC 1KQFB 2AXTE 2K9YA 1JB0J 1FZFA 3USSA 3H1LJ 1NVOA 1PL5A 2FKWB 3IFMA 4WWIA 3WMM0 2ZAEB 1WRGA 2FFDA 1SQQD 1DX7A 3EZ2A 2OARA 1JY2O 3G9RA 5M1BA 3TSIA 3RK2D 4D6TG 2LKMA 4H13B 1NKZB 5AW7B 5AVQB 3Q5SA 1NAYA 2E74D 2E74C 3CL3D 1T2KD 3HTKA 2Q7CA 1JY3N 3B5ND 3L70J 5BU8B 3CXHI 1BGYD 2QJKC 1SQQJ 2FXOA 4L74A 1NTKG 2KI7B 4ZKUA 1PM6A 4WLSA 1LTBC 1HGVA 1L0NG 1JCCA 1YI2P 2ZT9D 4K35A 2KSJA 1CZQA 1M8OB 4RJTA 1HBWA 2B88A 3T97B 1GZLA 4OVNF 1KB9H 1GK4A 4DZOA 1VL2A 1H0TB 1KYOE 1VQLP 3D71A 5EFWB 3CC2P 3KQGA 1LT1A 3AECC 2O1KA 2HG5D 3EZ6A 4OH8B 3CC4P 1GMJA 5I44A 1BGYJ 2MJZA 3CCEP 2E74B 3KYQA 3H1HD 5AW3B 3IF4A 3O8ZA 1S5LX 2QJKB 5KAXA 2HPCA 2YXRB 3FXEA 4ASVA 4N78D 1S1CX 1BCCD 2ZT9B 1G1IA 1IZNB 1LP1B 1SQBK 2WWWA 2WTYA 2HLOA 2AXTH 3EQ2A 1RE4C 3L72E 1RF0C 1RH6A 3GP4A 1EZVI 2I1JA 1R8DA 4H0LC 4BXLA 2IFNA 4Y28J 2C9NY 2M0BA 2IEFA 1ZOYC 5CJ4A 2A45H 1LJ2A 1FDMA 1PZQA 1EZVG 2WSEH 5GTIH 3V6IA 1OW8A 5DJUB 2WPQA 1NHLA 4AUWA 1KB9D 1NTZK 2P58A 2BCCJ 1Y6UA 5C39A 2E5TA 1VDFA 1Y47A 1OX3A 2HR3A 1JYHA 4D6TE 4R4MA 1EDKA 2DW3A 2JKVA 2GA1A 1USEA 3HE5B 1QEXA 4H0LB 2JP3A 3MUDC 5CCGC 4A1MA 3IR9A 3VMZA 1VQ8P 3E0HA 3H1JJ 5KATA 1KYOH 1M90Q 3K5BA 3TGUE 2FXPA 1MFTA 4C7NA 3LIDA 2R3SA 3V4QA 1NTKE 3IAOA 1VQKP 1FC2C 1URQA 3SWYA 1FBMA 5GTHH 1OW6A 3CXHE 1JUNA 2YKOA 1LTTC 3KXDA 1ZW0A 2K9JA 2YKQA 5L8RJ 4R22B 1DEBA 1L4AA 1S9KE 2Q5UA 3CCJP 5KAWA 4U3FJ 5BVZA 4JPZB 2ZJSE 1SQXG 2IZ0A 3II6A 1LTSC 2YMYA 1U7JA 1JMMA 2FFDC 1SQVE 3JCUE 1JMBA 4LGDE 4ZMDA 1MUUA 1YITP 1FDOA 3L73J 1X22A 1PFIA 3GPVA 1AVOA 3KZIE 2QM7A 2IPPA 2ZYAA 1KV4A 3MP7B 3QH9A 1KORA 2B87B 1Q06A 2NRGA 1OMIA 1SQBJ 1X79B 4PJ0E 1QL1A 3CCVP 1ZXGA 1KYOD 1GL2C 5AVTB 3RBZA 1H8AA 1QVGO 1LT9A 1RQVA 1Z56A 1ZP0C 1ZR4A 3L71D 1J2JB 2KNCB 2FFDB 3V2QA 4EOTA 2O01N 1FZCA 1PGOA 2WZ7A 2E76D 3P7KA 2K3RA 2M5AA 1Q0AA 2Q1KA 1Q07A 3NXSA 1OIPA 1J1EC 1MV8A 1N7SA 1KMIZ 3H6PA 3BCCE 4H44D 1ZLLA 5AW8B 4H44C 3SFEC 3HTKB 2IZ1A 1NU1G 1IFPA 3L71J 4QMAA 3L72D 3AEBC 3CXHH 5KLVK 1GL2B 4ZNCA 2RH0A 1CI6B 3F89A 1W5CE 3HUSA 2M3EA 1QX8A 2O1JA 1AFOA 2R44A 2OYOA 3UIAA 1FZGA 1S72P 3RK3C 5TISH 2K88A 2YO3A 3H25A 2JEEA 3M06A 2P1JA 3GHGA 1NYHA 1EQ7A 2NPSA 5CBNA 1NTMD 3G3ZA 3BASA 3TDKA 1KC8Q 1SQQK 2K1AA 1YJ9P 3V2PA 1AQTA 1PP9J 1J1EB 2OG0A 3JCUH 1BE3J 1FOSF 3TK1A 2ZYDA 4H44B 1WMKA 3GMAA 1T3UA 3KZIH 2O01H 3VMXA 2UWJE 4D6TD 3C9IA 1JCDA 2HPCB 3WUVA 4WVZA 1SQXE 2E5YA 3HRNA 3H1KE 5AVYB 1NOHA 1NTMJ 5KTBA 2WPRA 3RK3B 2J5UA 4OGQD 2CPSA 3EZ7A 3PH0A 2Y0CA 3OAKA 3TGUD 3M9QA 2VZ4A 1TU3F 4NPEA 4YTPC 3EWKA 4WLWA 1HWTC 2QG4A 2P2UA 2ZYGA 2C0WA 1NTKD 1IK9A 4Y99C 2LXCB 2ZFCA 2ZXEB 2JJLA 1ZRTE 1L0ND 2P67A 4IFMA 3CCRP 2FBWC 2FXMA 4UB6E 3CXHD 2G8YA 2ITAA 1Y9BA 1OWAA 1FS0E 4C7RA 3VMAA 2ZVOB 1URQC 2WPSA 1BDDA 1IK7A 5KAVA 1FZAA 3L74G 1FU1A 1E5WA 4JF7A 1K04A 3CX5I 3S1KA 1KFNA 1K8AQ 4JQ0D 2FYUG 1L0NJ 3D70A 3JC22 3FWNA 1X9VA 1SQPG 1L4AD 2WSSH 5CHXA 2PRRA 1PGQA 2OGUA 4Y99B 1L4AC 3M0DA 3RL0D 3E7KA 2BASA 2FY8A 3AE8C 2RKLA 5AW2B 3H32A 3HD7D 1NU1E 3GK6A 1FE6A 4C7NB 2YMKA 3W67A 5KJ7A 2N1TD 1Q08A 1JNMA 1A02J 1URQB 3OJAB 1CW5A 3QAOA 4GODA 2QJPC 5KLVJ 2Y9ZA 5KAFE 3CI9A 3SFDC 3IN6A 4UB8E 2M8RA 2PGDA 1EDIA 3RK2C 2GM4A 4LC1A 2QRXA 3CCMP 2OQQA 1EZVD 3CWBG 2K9JB 4DT0A 1QVFO 3B4SA 1HJ0A 3LW5H 1N7LA 2W6JH 4I1LA 2O01J 3I55P 3AEEC 4EIJA 4AQRD 2R5BA 1L0LG 4BRYA 3TGUG 1L4AB 1SS1A 4O9BA 3VMYA 2QVAA 2WSCH 1T2KC 1K9MQ 2WPVB 3B5NC 3M91A 5KLIC 3L36A 4KHXA 1HH0A 1Q82Q 3KHUA 3WU2E 3MD0A 3BCCD 3CLQA 1M57D 5KKZC 5AVXB 3BRTB 2WSFH 5AW4B 1GU4A 1VF5D 1FZCC 3L75G 1S2EA 2ZT9C 2J59M 4NPFX 4UB6H 2QJPB 1T3JA 3L4FA 2WT7B 1VQ4P 2K37A 2LXBA 3Q3DA 2V7QH 1N7SD 3U1CA 4I7ZC 3RK2B 3CMEP 1SFCD 1YTZI 1HTLC 1ZV8A 1DH3A 1MFZA 2Y9YA 5KAIH 1NTZE 3B5NB 3CCSP 3HUSC 5KLIB 1JEKA 1SQVG 5CMZA 2Q6QA 5E79E 3Q1MA 5KKZB 3PHLA 2AEFA 1KQSO 1BSHA 1FZCB 2NPSD 2IX7C 3GHGC 1ZN5A 3V2RA 1S5LE 2M5AB 1H88A 2XNXA 3L74E 2OTKE 2OYHC 5APWA 4L73A 1KQGB 4TT3H 4I7ZB 2GUVA 1SQXD 3AEAC 2FYUE 3H1HJ 2IYOA 1SQPE 1EXIA 1FZEA 3RBXA 3L70G 4UB8H 1N73A 4WY4A 3CX5E 3VP9A 1AVYA 2WITA 1BCCJ 3HUSB 2KS1A 3A0HE 2E42A 2JWAA 1Q7YQ 5AVRB 2CPBA 2Y0EA 2KVVA 1SQXJ 1EC5A 3GHGB 3BCCG 3D6ZA 3WU2H 2CK3H 2OYHB 2E43A 3U1AA 4WBAA 3JSVC 3W68A 1IFIA 2GOVA 2POHA 4K3AA 5AW5B 4LHFA 3EZFA 1DD4A 3CWBE 3SSUA 1R8EA 2IDBA 1HJBA 2XNDH 2C0XA 1L0LE 2WSFJ 2L5GB 5KAUA 4HKZH 4DOJA 1VQ9P 3PTZA 4XFJA 3SWKA 5APSA 4OWFA 2V7QJ 1AV1A 3C8VA 1GU5A 1LNQA 2JMLA 3EFGA 5AW0B 1KILE 1RHZB 1N8RQ 1GW3A 3L75E 2ZXXA 1NJIQ 2W6AA 1NU1D 4IFFA 2RN0A 3B8EB 3GLMA 2VRSA 4XA4A 5E79H 3OW2O 1P84I 2N9YB 1IJDB 2ZVNB 3M0AA 4IFDK 3M9BA 2L91A 1NTMK 1G2CA 4ASWA 1S5LH 4R24B 3AE6C 1QL2A 1OXZA 5KJ7D 3H1KG 3RGUA 3ABVC 5KJ7C 5APUA 3HD7A 3PRJA 2QE7H 1NAFA 1NU1J 3Q5RA 2NZ2A 1S4XA 1USDA 2Z5HA 2N1TA 3H1LE 3EZ9A 3MZWB 4YXWH 3CX5H 1X0TA 1YQ3C 1U7MA 2XV5A 1ZMEC 2KUBA 2FYNC 2BEZF 3A0HH 1RF1A 1XTGB 2WSEJ 4EDFA 1M1KQ 1Q09A 3H1JG 3H32B 1NTKK 4GOFA 4JYBA 3L70E 2HFED 4EI2A 1L0NK 2JR8A 4IL6X 1R5SA 2Y0DA 5B66E 2KP8A 4RESB 1NTZD 2E76C 4GT1A 2H43A 3PJSK 2A06G 2XKMA 1VQ6P 1YYCA 2FYNB 4N3YB 1BOWA 4IL6E 4L76A 3G71P 4BRYB 2PP6A 1UIXA 1SFCA 1BGYE 4GIFA 2SPZA 4PD4I 3L74D 1JTHA 2HODA 4U3FG 1VQPP 2ZHHA 2Q3IA 3L37A 1CSBA 1MZ9A 2YXQB 2FYUD 1GDTA 1G1JA 4J2NA 4R4LA 3TYYA 1SQPD 2O3JA 3KDPB 3N7NA 4B86A 3V5BA 1FZBA 3CX5D 1JY2N 2D2CD 2E76B 1DEEG 2YIUC 4RKUJ 2R5DA 1QGKB 3L72J 2E75D 2HYNA 1SQBG 1JO5A 4WY4D 1U57A 3E1IA 5K5GB 5AVZB 5H2FE 2W90A 1M1JA 3N4XA 3VN0A 2IBZI 4N78E 1BSNA 4PJ0H 3CWBD 3TNUA 3AE3C 1P84E 3BVHA 4L75A 3I5CA 1EXJA 1L0LD 4OGQC 2JDIH 2P7JA 3O6QA 3RL0g 1PPJG 3CCLP 1VQMP 1FDIA 2IBZG 3AEDC 2BCCE 2YIUB 1K05A 3B71A 3MTUE 1NH4A 2QJYC 1KTMA 5B66H 1NTZG 3GW6A 4D6TJ 1KILD 3L75D 2PFXA 5APVA 3AEGC 1LWUA 1Q05A 3G4SP 1LTAC 1RE3A 3HH0A 3H1JE 4DJGA 1L0LJ 2OTLP 4KT0J 2KS1B 3TGUJ 4A7PA 5CBOA 1S9KD 4N6JA 1W2EA 3CCUP 1NTKJ 4IOIH 3WUTA 3PLNA 4OGQB 1RY3A 3LIEA 4TLFA 2ZHGA 1LTIC 3L75J 3UCSA 2QSIA 2QA4P 1PP9G 1SQVD 4NPDA 2A06E 2BOWA 1D7MA 2QJYB 1BDCA 2OYIA 3RL0C 2BEQD 4B0YA 1SQXK 5D90A 5AW1B 2KIKA 4DCZA 3HD7C 1VQ7P 1MKMA 1VQNP 4U3FE 1YJNP 1PV3A 1KQLA 1VQ5P 5CCHD 2Q9IA 2N1TC 3H1IG 1XTCC 2OTJP 4HH2A 5H2FH 2FYZA 1SQVJ 1FOSE 3F5HA 4PD4E 3L70D 3AEFC 4JYCA 3P32A 1LGHB 1YJWP 2W27A 3L73E 2KNCA 1SLQA 2J58A 1RF1C 4HJGH 1FJKA 2JWDA 4C46A 1P84H 3P8CE 4W80A 1NKNA 1NGMB 1OVRA 1JBGA 1G2CB 3RL0B 1IO4A 1SQBE 5GTIE 3GG2A 1LT9C 5DJTB 3B49A 1UIIA 4WB4A 2WMMA 3CCQP 3HD7B 3TF5A 3BRVB 1VF5C 2N1TB 4U7JA 3U59A 1GL2A 1SP4A 1CI6A 1LTGC 4GOEA 2LR2A 1N7SC 1FJPA 1Q90D 1HUCA 5AW6B 1GTWA 3CC7P 1PPJE 1RF1B 2IBZE 2R3CA 4LLHA 1K73Q 1SFCC 5B5EE 3BCCJ 1NU1K 3AE7C 2PAJA 1E79H 3HE4A 3AE9C 3FX0A 1LT9B 2P10A 3E1RA 3L71E 1DD3A 3H1LG 1Q81Q 3FXDA 2XDJA 2H89C 3V4WA 3S4RA 5AVUB 5KCBA 1LTJA 5GTHE 1VF5B 5KLVG 1WT6A 3MHVA 4DCKA 2NPSC 3CPWO 4HB1A 2Q3EA 1N86A 1PGJA 1YHQP 3NMDA 1N7SB 3H1KD 2KZJA 3LURA 2IFMA 1A02F 1P84D 5APQA 5KAFH 1PP9E 3ITKA 1SFCB 4Z1MH 1BE3E 4MN4C 4PD4H 2XU6A 1JTHB 1SQQG 2HODB 2V4HA 2C9LY 1KZUB 1M1JC 1N2DC 4H0LD 2BCCD 5AVSB 4M3LA 2Z5IA 1R5LA 3RK3E 5BU5A 3A7OA 1ZRTD 1JY3P 4KJMA 2JO1A 2KB7P 3NFQA 4AYZA 1RQUA 3LW5J 3H1KJ 5CJ0A 1NTME 3H1IE 5I41B 2W8ZA 2NPSB 1T8ZA 2AXCA 3H1JD 2R32A 2WSCJ 2YKPA 1BGYG 3CD6P 2YO2A 1T6AA 1LWUC 3FWLA 1KILA 1RE3C 1IC2A 1M1JB 1OZHA 1JY3O 5CCGD 2A06D 3TNUB 5B5EH 3I56P 3ZDMA 2M3BA 2H7HA 5AVVB 2I8DA 2FYUK 3O6QB 2QEXP 1OFCX 1RH5B 1SQPK 4U3FD 2W83C 1GW4A 1YIJP 3H1HG 4W7ZA 1PIXA 1L0NE 2KOGA 2MKVA 3M0DC 1Y8AA 2OYIC 5E01A 2QIWA 2G3AA 4PD4D 1LWUB 2AEJA 1JOCA 3L73D 4JBZA 1BCCG 3P8CD 3KPEA 5TISE 1VPCA 3R2PA 3CMAP 5CCHA 1SQBD 5GQQA 2KLUA 4GDOA 1W2BO 2BCCG 1PGPA 5AW9B 5KLVE 1EDLA 2KK7A 1IFMA 3T97A 3FGAD 2WT7A 3Q2YA 1L0LK 1HGZA 1KB9I 5AVWB 1J1DC 2OYIB 1H0TA
chains in the Genus database with same CATH topology
2ZT9D 2E75C 1DD3A 2E76C 3AEBC 3GLMA 3AEAC 3AEEC 3R4YA 4H13D 3AE5C 1EXJA 2FBWC 4OGQC 4H13C 2G8YA 2H89C 2KCUA 1LX8A 3T97B 1EXIA 3Q5PA 3O6QA 3RL0g 2WPVB 1Y9BA 1FDIA 2HVAA 5KCBA 1VF5B 3AEDC 1VL2A 5KLIC 4PV1B 1BOWA 3R8JA 3AEFC 3D71A 1Y6UA 1K05A 1FDOA 3B71A 3AECC 5D8CA 1UIXA 4R24B 3AE6C 3GPVA 3H25A 1IK7A 3EZ6A 2QJYC 4TT3H 5KKZC 1JYHA 1GMJA 5I44A 1KTMA 4I7ZB 5KAVA 3GF3A 1VF5D 3GF7A 1NYHA 1K04A 4R4MA 2ZT9C 3ABVC 3LURA 2ZHHA 1KQFB 2E74B 1NGMB 3AEGC 1KORA 1JBGA 1Q06A 1PIXA 1Q05A 4H0LB 4YXDC 3D70A 2JP3A 2MKVA 1OMIA 3Q3DA 1JB0J 2K9YA 1DIPA 2KVVA 3Q5RA 4A1MA 2NZ2A 4R4LA 4J2NA 2D2CB 4Z1MH 3E0HA 3B49A 2OG0A 3HH0A 1S5LX 4I7ZC 5E01A 1PL5A 3EZ9A 4R4EA 2QIWA 5KATA 3S9OA 2G3AA 4KT0J 4H44B 5KAXA 3D6ZA 1WMKA 2FXPA 3EZ2A 3GMAA 1OW7A 4H0LD 1RQVA 1YQ3C 3RK3E 4PV1D 1S1CX 2D2CD 3AE4C 3G9RA 5M1BA 1ZMEC 2GOVA 2E75B 1ZP0C 3IAOA 1VF5C 2E76B 2FYNC 4U7JA 4PV1C 2ZT9B 2BEZF 4LHFA 3EZFA 1DD4A 2JO1A 2YIUC 3AE8C 4H13B 4OGQB 4RKUJ 1R8EA 2WSEJ 3GK6A 4AYZA 2IDBA 2ZHGA 1RQUA 3LW5J 1RH6A 3GP4A 3UCSA 5I41B 2E75D 2QSIA 2WSFJ 2YMKA 2E76D 1OW6A 3Q5SA 3AE1C 1Q08A 2E74D 1Q90D 5KAUA 3AE2C 5GQQA 2J5UA 4OGQD 1Q09A 3EZ7A 4GDOA 1U57A 1R8DA 2E74C 1HF9A 4XFJA 2DG6A 2BOWA 3QAOA 2QJPC 1D5YA 1Q0AA 3Q1MA 1Q07A 2H88C 4H0LC 5L8RJ 4AYZB 2WSCJ 4Y28J 2VZ4A 3SFDC 2IEFA 1TU3F 1ZOYC 4R22B 2D2CC 2V7QJ 1KMIZ 3IN6A 2BEQD 4H44D 2QJKC 1YQ4C 3C8VA 3EWKA 4WLWA 3AE7C 4YTPC 2WQYC 1AJYA 4B0YA 2P10A 2JMLA 5D90A 3D6YA 4H44C 4DCZA 1PM6A 4WLSA 3FGAD 3Q2YA 3SFEC 1KILE 2OQQA 5KAWA 3R8KA 3AE9C 4IL6X 1OW8A 1HJ0A 1MKMA 1KQGB 1ZRTE 3AE3C 1PV3A 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYH A;  5I44 A;  2J5U A;  1Q09 A;  5KAV A;  1R8D A;  2DG6 A;  2BOW A;  3QAO A;  1EXJ A;  1Q0A A;  3Q1M A;  1D5Y A;  4R4M A;  3LUR A;  1Q07 A;  3G9R A;  2GOV A;  4AYZ B;  2ZHH A;  3IAO A;  2VZ4 A;  2KCU A;  3T97 B;  1EXI A;  3Q5P A;  4R22 B;  1JBG A;  1Q06 A;  1Q05 A;  4WLW A;  1R8E A;  3D70 A;  2HVA A;  5KCB A;  3Q3D A;  1DIP A;  4B0Y A;  3GK6 A;  3Q5R A;  2JML A;  5D90 A;  3D6Y A;  4R4L A;  4J2N A;  1BOW A;  3E0H A;  2ZHG A;  3R8J A;  4A1M A;  3B49 A;  3HH0 A;  4WLS A;  3D71 A;  3Q2Y A;  5E01 A;  5KAT A;  4R4E A;  2OQQ A;  5KAW A;  3R8K A;  3GP4 A;  3UCS A;  5I41 B;  5D8C A;  4AYZ A;  4R24 B;  3Q5S A;  3D6Z A;  5KAX A;  1Q08 A;  3GPV A;  5KAU A;  5GQQ A; 
#chains in the Genus database with same CATH topology
 2H8P D;  5APT A;  1Q86 Q;  2KLV A;  2KCU A;  1LX8 A;  3Q5P A;  1GD2 E;  1PPJ D;  1SQQ E;  2IBZ D;  1S3J A;  1KN7 A;  1GL2 D;  1OVU A;  3MGN A;  3B5N A;  3A2A A;  2IYP A;  5APY A;  1EZV E;  3A5T A;  1GK6 A;  2Z4E A;  3NTN A;  4I2L C;  3L35 A;  4BWN A;  4R4E A;  3S9O A;  1LP1 A;  2GUS A;  2I1K A;  1J1D B;  1HVV A;  1SQV K;  1X8Y A;  1NTZ J;  1NO4 A;  2A45 I;  1H89 A;  3A0B E;  3AE1 C;  1PP9 D;  1LTJ C;  1HF9 A;  3G6E P;  1BE3 D;  2KYV A;  3V2N A;  3L73 G;  3PP5 A;  2D2C C;  1YQ4 C;  2WQY C;  3RK3 D;  2A45 G;  3D6Y A;  3R8K A;  4XE5 B;  3L74 J;  1YTZ T;  2KSE A;  1EDJ A;  4YPC A;  4I6M C;  2E75 C;  3R4Y A;  3H1H E;  4CPG A;  2FYU J;  1N73 C;  4WY4 C;  3H1I D;  1RE4 A;  3HE4 B;  2OYH A;  1RF0 A;  1SQP J;  1M56 D;  1QLE D;  3HE5 A;  3WUU A;  5D8C A;  5TJH A;  3VOP A;  3VYI A;  1BCC E;  2WVR A;  1OVV A;  3GF7 A;  1KYO I;  1Q2N A;  1LTJ B;  3A3Y B;  3QWO C;  2W6B A;  2QM8 A;  3SWF A;  4YXD C;  1IFJ A;  4RO0 A;  1DIP A;  2D2C B;  3H1I J;  2B89 A;  1M7L A;  1IFD A;  4EYY Q;  5APX A;  1OW7 A;  2KZI A;  1JM0 A;  4AYC A;  3C1L A;  2AEM A;  4PV1 D;  3AE4 C;  2E75 B;  2YNY A;  3MIW A;  1KIL C;  4PV1 C;  2B9B A;  1N73 B;  4WY4 B;  3L71 G;  3CWB J;  1NWQ A;  1YBK A;  3M9H A;  4ZKP A;  3AE2 C;  4IL6 H;  1KD1 Q;  3P8M C;  3MUD A;  2DG6 A;  5CCG A;  1D5Y A;  2H88 C;  4W7Y A;  4AYZ B;  1KB9 E;  1VQO P;  1URQ D;  1AJY A;  1KFM A;  3BAT A;  1SVF A;  2XZR A;  3OA7 A;  1AQ5 A;  3AE5 C;  3A0B H;  3L72 G;  4H13 D;  3EFF K;  1BE3 G;  3H1L D;  1AA0 A;  3VP8 A;  1JY2 P;  4H13 C;  1FAV A;  5KAI E;  3VTP C;  2HVA A;  1KIL B;  4PV1 B;  5KLV D;  3R8J A;  2N9B A;  2B87 A;  2KXP B;  1L2P A;  4HYT B;  2RMZ A;  1ZR2 A;  4GKG A;  3GF3 A;  1IFN A;  1NTM G;  5CCH C;  1KQF B;  2AXT E;  2K9Y A;  1JB0 J;  1FZF A;  3USS A;  3H1L J;  1NVO A;  1PL5 A;  2FKW B;  3IFM A;  4WWI A;  3WMM 0;  2ZAE B;  1WRG A;  2FFD A;  1SQQ D;  1DX7 A;  3EZ2 A;  2OAR A;  1JY2 O;  3G9R A;  5M1B A;  3TSI A;  3RK2 D;  4D6T G;  2LKM A;  4H13 B;  1NKZ B;  5AW7 B;  5AVQ B;  3Q5S A;  1NAY A;  2E74 D;  2E74 C;  3CL3 D;  1T2K D;  3HTK A;  2Q7C A;  1JY3 N;  3B5N D;  3L70 J;  5BU8 B;  3CXH I;  1BGY D;  2QJK C;  1SQQ J;  2FXO A;  4L74 A;  1NTK G;  2KI7 B;  4ZKU A;  1PM6 A;  4WLS A;  1LTB C;  1HGV A;  1L0N G;  1JCC A;  1YI2 P;  2ZT9 D;  4K35 A;  2KSJ A;  1CZQ A;  1M8O B;  4RJT A;  1HBW A;  2B88 A;  3T97 B;  1GZL A;  4OVN F;  1KB9 H;  1GK4 A;  4DZO A;  1VL2 A;  1H0T B;  1KYO E;  1VQL P;  3D71 A;  5EFW B;  3CC2 P;  3KQG A;  1LT1 A;  3AEC C;  2O1K A;  2HG5 D;  3EZ6 A;  4OH8 B;  3CC4 P;  1GMJ A;  5I44 A;  1BGY J;  2MJZ A;  3CCE P;  2E74 B;  3KYQ A;  3H1H D;  5AW3 B;  3IF4 A;  3O8Z A;  1S5L X;  2QJK B;  5KAX A;  2HPC A;  2YXR B;  3FXE A;  4ASV A;  4N78 D;  1S1C X;  1BCC D;  2ZT9 B;  1G1I A;  1IZN B;  1LP1 B;  1SQB K;  2WWW A;  2WTY A;  2HLO A;  2AXT H;  3EQ2 A;  1RE4 C;  3L72 E;  1RF0 C;  1RH6 A;  3GP4 A;  1EZV I;  2I1J A;  1R8D A;  4H0L C;  4BXL A;  2IFN A;  4Y28 J;  2C9N Y;  2M0B A;  2IEF A;  1ZOY C;  5CJ4 A;  2A45 H;  1LJ2 A;  1FDM A;  1PZQ A;  1EZV G;  2WSE H;  5GTI H;  3V6I A;  1OW8 A;  5DJU B;  2WPQ A;  1NHL A;  4AUW A;  1KB9 D;  1NTZ K;  2P58 A;  2BCC J;  1Y6U A;  5C39 A;  2E5T A;  1VDF A;  1Y47 A;  1OX3 A;  2HR3 A;  1JYH A;  4D6T E;  4R4M A;  1EDK A;  2DW3 A;  2JKV A;  2GA1 A;  1USE A;  3HE5 B;  1QEX A;  4H0L B;  2JP3 A;  3MUD C;  5CCG C;  4A1M A;  3IR9 A;  3VMZ A;  1VQ8 P;  3E0H A;  3H1J J;  5KAT A;  1KYO H;  1M90 Q;  3K5B A;  3TGU E;  2FXP A;  1MFT A;  4C7N A;  3LID A;  2R3S A;  3V4Q A;  1NTK E;  3IAO A;  1VQK P;  1FC2 C;  1URQ A;  3SWY A;  1FBM A;  5GTH H;  1OW6 A;  3CXH E;  1JUN A;  2YKO A;  1LTT C;  3KXD A;  1ZW0 A;  2K9J A;  2YKQ A;  5L8R J;  4R22 B;  1DEB A;  1L4A A;  1S9K E;  2Q5U A;  3CCJ P;  5KAW A;  4U3F J;  5BVZ A;  4JPZ B;  2ZJS E;  1SQX G;  2IZ0 A;  3II6 A;  1LTS C;  2YMY A;  1U7J A;  1JMM A;  2FFD C;  1SQV E;  3JCU E;  1JMB A;  4LGD E;  4ZMD A;  1MUU A;  1YIT P;  1FDO A;  3L73 J;  1X22 A;  1PFI A;  3GPV A;  1AVO A;  3KZI E;  2QM7 A;  2IPP A;  2ZYA A;  1KV4 A;  3MP7 B;  3QH9 A;  1KOR A;  2B87 B;  1Q06 A;  2NRG A;  1OMI A;  1SQB J;  1X79 B;  4PJ0 E;  1QL1 A;  3CCV P;  1ZXG A;  1KYO D;  1GL2 C;  5AVT B;  3RBZ A;  1H8A A;  1QVG O;  1LT9 A;  1RQV A;  1Z56 A;  1ZP0 C;  1ZR4 A;  3L71 D;  1J2J B;  2KNC B;  2FFD B;  3V2Q A;  4EOT A;  2O01 N;  1FZC A;  1PGO A;  2WZ7 A;  2E76 D;  3P7K A;  2K3R A;  2M5A A;  1Q0A A;  2Q1K A;  1Q07 A;  3NXS A;  1OIP A;  1J1E C;  1MV8 A;  1N7S A;  1KMI Z;  3H6P A;  3BCC E;  4H44 D;  1ZLL A;  5AW8 B;  4H44 C;  3SFE C;  3HTK B;  2IZ1 A;  1NU1 G;  1IFP A;  3L71 J;  4QMA A;  3L72 D;  3AEB C;  3CXH H;  5KLV K;  1GL2 B;  4ZNC A;  2RH0 A;  1CI6 B;  3F89 A;  1W5C E;  3HUS A;  2M3E A;  1QX8 A;  2O1J A;  1AFO A;  2R44 A;  2OYO A;  3UIA A;  1FZG A;  1S72 P;  3RK3 C;  5TIS H;  2K88 A;  2YO3 A;  3H25 A;  2JEE A;  3M06 A;  2P1J A;  3GHG A;  1NYH A;  1EQ7 A;  2NPS A;  5CBN A;  1NTM D;  3G3Z A;  3BAS A;  3TDK A;  1KC8 Q;  1SQQ K;  2K1A A;  1YJ9 P;  3V2P A;  1AQT A;  1PP9 J;  1J1E B;  2OG0 A;  3JCU H;  1BE3 J;  1FOS F;  3TK1 A;  2ZYD A;  4H44 B;  1WMK A;  3GMA A;  1T3U A;  3KZI H;  2O01 H;  3VMX A;  2UWJ E;  4D6T D;  3C9I A;  1JCD A;  2HPC B;  3WUV A;  4WVZ A;  1SQX E;  2E5Y A;  3HRN A;  3H1K E;  5AVY B;  1NOH A;  1NTM J;  5KTB A;  2WPR A;  3RK3 B;  2J5U A;  4OGQ D;  2CPS A;  3EZ7 A;  3PH0 A;  2Y0C A;  3OAK A;  3TGU D;  3M9Q A;  2VZ4 A;  1TU3 F;  4NPE A;  4YTP C;  3EWK A;  4WLW A;  1HWT C;  2QG4 A;  2P2U A;  2ZYG A;  2C0W A;  1NTK D;  1IK9 A;  4Y99 C;  2LXC B;  2ZFC A;  2ZXE B;  2JJL A;  1ZRT E;  1L0N D;  2P67 A;  4IFM A;  3CCR P;  2FBW C;  2FXM A;  4UB6 E;  3CXH D;  2G8Y A;  2ITA A;  1Y9B A;  1OWA A;  1FS0 E;  4C7R A;  3VMA A;  2ZVO B;  1URQ C;  2WPS A;  1BDD A;  1IK7 A;  5KAV A;  1FZA A;  3L74 G;  1FU1 A;  1E5W A;  4JF7 A;  1K04 A;  3CX5 I;  3S1K A;  1KFN A;  1K8A Q;  4JQ0 D;  2FYU G;  1L0N J;  3D70 A;  3JC2 2;  3FWN A;  1X9V A;  1SQP G;  1L4A D;  2WSS H;  5CHX A;  2PRR A;  1PGQ A;  2OGU A;  4Y99 B;  1L4A C;  3M0D A;  3RL0 D;  3E7K A;  2BAS A;  2FY8 A;  3AE8 C;  2RKL A;  5AW2 B;  3H32 A;  3HD7 D;  1NU1 E;  3GK6 A;  1FE6 A;  4C7N B;  2YMK A;  3W67 A;  5KJ7 A;  2N1T D;  1Q08 A;  1JNM A;  1A02 J;  1URQ B;  3OJA B;  1CW5 A;  3QAO A;  4GOD A;  2QJP C;  5KLV J;  2Y9Z A;  5KAF E;  3CI9 A;  3SFD C;  3IN6 A;  4UB8 E;  2M8R A;  2PGD A;  1EDI A;  3RK2 C;  2GM4 A;  4LC1 A;  2QRX A;  3CCM P;  2OQQ A;  1EZV D;  3CWB G;  2K9J B;  4DT0 A;  1QVF O;  3B4S A;  1HJ0 A;  3LW5 H;  1N7L A;  2W6J H;  4I1L A;  2O01 J;  3I55 P;  3AEE C;  4EIJ A;  4AQR D;  2R5B A;  1L0L G;  4BRY A;  3TGU G;  1L4A B;  1SS1 A;  4O9B A;  3VMY A;  2QVA A;  2WSC H;  1T2K C;  1K9M Q;  2WPV B;  3B5N C;  3M91 A;  5KLI C;  3L36 A;  4KHX A;  1HH0 A;  1Q82 Q;  3KHU A;  3WU2 E;  3MD0 A;  3BCC D;  3CLQ A;  1M57 D;  5KKZ C;  5AVX B;  3BRT B;  2WSF H;  5AW4 B;  1GU4 A;  1VF5 D;  1FZC C;  3L75 G;  1S2E A;  2ZT9 C;  2J59 M;  4NPF X;  4UB6 H;  2QJP B;  1T3J A;  3L4F A;  2WT7 B;  1VQ4 P;  2K37 A;  2LXB A;  3Q3D A;  2V7Q H;  1N7S D;  3U1C A;  4I7Z C;  3RK2 B;  3CME P;  1SFC D;  1YTZ I;  1HTL C;  1ZV8 A;  1DH3 A;  1MFZ A;  2Y9Y A;  5KAI H;  1NTZ E;  3B5N B;  3CCS P;  3HUS C;  5KLI B;  1JEK A;  1SQV G;  5CMZ A;  2Q6Q A;  5E79 E;  3Q1M A;  5KKZ B;  3PHL A;  2AEF A;  1KQS O;  1BSH A;  1FZC B;  2NPS D;  2IX7 C;  3GHG C;  1ZN5 A;  3V2R A;  1S5L E;  2M5A B;  1H88 A;  2XNX A;  3L74 E;  2OTK E;  2OYH C;  5APW A;  4L73 A;  1KQG B;  4TT3 H;  4I7Z B;  2GUV A;  1SQX D;  3AEA C;  2FYU E;  3H1H J;  2IYO A;  1SQP E;  1EXI A;  1FZE A;  3RBX A;  3L70 G;  4UB8 H;  1N73 A;  4WY4 A;  3CX5 E;  3VP9 A;  1AVY A;  2WIT A;  1BCC J;  3HUS B;  2KS1 A;  3A0H E;  2E42 A;  2JWA A;  1Q7Y Q;  5AVR B;  2CPB A;  2Y0E A;  2KVV A;  1SQX J;  1EC5 A;  3GHG B;  3BCC G;  3D6Z A;  3WU2 H;  2CK3 H;  2OYH B;  2E43 A;  3U1A A;  4WBA A;  3JSV C;  3W68 A;  1IFI A;  2GOV A;  2POH A;  4K3A A;  5AW5 B;  4LHF A;  3EZF A;  1DD4 A;  3CWB E;  3SSU A;  1R8E A;  2IDB A;  1HJB A;  2XND H;  2C0X A;  1L0L E;  2WSF J;  2L5G B;  5KAU A;  4HKZ H;  4DOJ A;  1VQ9 P;  3PTZ A;  4XFJ A;  3SWK A;  5APS A;  4OWF A;  2V7Q J;  1AV1 A;  3C8V A;  1GU5 A;  1LNQ A;  2JML A;  3EFG A;  5AW0 B;  1KIL E;  1RHZ B;  1N8R Q;  1GW3 A;  3L75 E;  2ZXX A;  1NJI Q;  2W6A A;  1NU1 D;  4IFF A;  2RN0 A;  3B8E B;  3GLM A;  2VRS A;  4XA4 A;  5E79 H;  3OW2 O;  1P84 I;  2N9Y B;  1IJD B;  2ZVN B;  3M0A A;  4IFD K;  3M9B A;  2L91 A;  1NTM K;  1G2C A;  4ASW A;  1S5L H;  4R24 B;  3AE6 C;  1QL2 A;  1OXZ A;  5KJ7 D;  3H1K G;  3RGU A;  3ABV C;  5KJ7 C;  5APU A;  3HD7 A;  3PRJ A;  2QE7 H;  1NAF A;  1NU1 J;  3Q5R A;  2NZ2 A;  1S4X A;  1USD A;  2Z5H A;  2N1T A;  3H1L E;  3EZ9 A;  3MZW B;  4YXW H;  3CX5 H;  1X0T A;  1YQ3 C;  1U7M A;  2XV5 A;  1ZME C;  2KUB A;  2FYN C;  2BEZ F;  3A0H H;  1RF1 A;  1XTG B;  2WSE J;  4EDF A;  1M1K Q;  1Q09 A;  3H1J G;  3H32 B;  1NTK K;  4GOF A;  4JYB A;  3L70 E;  2HFE D;  4EI2 A;  1L0N K;  2JR8 A;  4IL6 X;  1R5S A;  2Y0D A;  5B66 E;  2KP8 A;  4RES B;  1NTZ D;  2E76 C;  4GT1 A;  2H43 A;  3PJS K;  2A06 G;  2XKM A;  1VQ6 P;  1YYC A;  2FYN B;  4N3Y B;  1BOW A;  4IL6 E;  4L76 A;  3G71 P;  4BRY B;  2PP6 A;  1UIX A;  1SFC A;  1BGY E;  4GIF A;  2SPZ A;  4PD4 I;  3L74 D;  1JTH A;  2HOD A;  4U3F G;  1VQP P;  2ZHH A;  2Q3I A;  3L37 A;  1CSB A;  1MZ9 A;  2YXQ B;  2FYU D;  1GDT A;  1G1J A;  4J2N A;  4R4L A;  3TYY A;  1SQP D;  2O3J A;  3KDP B;  3N7N A;  4B86 A;  3V5B A;  1FZB A;  3CX5 D;  1JY2 N;  2D2C D;  2E76 B;  1DEE G;  2YIU C;  4RKU J;  2R5D A;  1QGK B;  3L72 J;  2E75 D;  2HYN A;  1SQB G;  1JO5 A;  4WY4 D;  1U57 A;  3E1I A;  5K5G B;  5AVZ B;  5H2F E;  2W90 A;  1M1J A;  3N4X A;  3VN0 A;  2IBZ I;  4N78 E;  1BSN A;  4PJ0 H;  3CWB D;  3TNU A;  3AE3 C;  1P84 E;  3BVH A;  4L75 A;  3I5C A;  1EXJ A;  1L0L D;  4OGQ C;  2JDI H;  2P7J A;  3O6Q A;  3RL0 g;  1PPJ G;  3CCL P;  1VQM P;  1FDI A;  2IBZ G;  3AED C;  2BCC E;  2YIU B;  1K05 A;  3B71 A;  3MTU E;  1NH4 A;  2QJY C;  1KTM A;  5B66 H;  1NTZ G;  3GW6 A;  4D6T J;  1KIL D;  3L75 D;  2PFX A;  5APV A;  3AEG C;  1LWU A;  1Q05 A;  3G4S P;  1LTA C;  1RE3 A;  3HH0 A;  3H1J E;  4DJG A;  1L0L J;  2OTL P;  4KT0 J;  2KS1 B;  3TGU J;  4A7P A;  5CBO A;  1S9K D;  4N6J A;  1W2E A;  3CCU P;  1NTK J;  4IOI H;  3WUT A;  3PLN A;  4OGQ B;  1RY3 A;  3LIE A;  4TLF A;  2ZHG A;  1LTI C;  3L75 J;  3UCS A;  2QSI A;  2QA4 P;  1PP9 G;  1SQV D;  4NPD A;  2A06 E;  2BOW A;  1D7M A;  2QJY B;  1BDC A;  2OYI A;  3RL0 C;  2BEQ D;  4B0Y A;  1SQX K;  5D90 A;  5AW1 B;  2KIK A;  4DCZ A;  3HD7 C;  1VQ7 P;  1MKM A;  1VQN P;  4U3F E;  1YJN P;  1PV3 A;  1KQL A;  1VQ5 P;  5CCH D;  2Q9I A;  2N1T C;  3H1I G;  1XTC C;  2OTJ P;  4HH2 A;  5H2F H;  2FYZ A;  1SQV J;  1FOS E;  3F5H A;  4PD4 E;  3L70 D;  3AEF C;  4JYC A;  3P32 A;  1LGH B;  1YJW P;  2W27 A;  3L73 E;  2KNC A;  1SLQ A;  2J58 A;  1RF1 C;  4HJG H;  1FJK A;  2JWD A;  4C46 A;  1P84 H;  3P8C E;  4W80 A;  1NKN A;  1NGM B;  1OVR A;  1JBG A;  1G2C B;  3RL0 B;  1IO4 A;  1SQB E;  5GTI E;  3GG2 A;  1LT9 C;  5DJT B;  3B49 A;  1UII A;  4WB4 A;  2WMM A;  3CCQ P;  3HD7 B;  3TF5 A;  3BRV B;  1VF5 C;  2N1T B;  4U7J A;  3U59 A;  1GL2 A;  1SP4 A;  1CI6 A;  1LTG C;  4GOE A;  2LR2 A;  1N7S C;  1FJP A;  1Q90 D;  1HUC A;  5AW6 B;  1GTW A;  3CC7 P;  1PPJ E;  1RF1 B;  2IBZ E;  2R3C A;  4LLH A;  1K73 Q;  1SFC C;  5B5E E;  3BCC J;  1NU1 K;  3AE7 C;  2PAJ A;  1E79 H;  3HE4 A;  3AE9 C;  3FX0 A;  1LT9 B;  2P10 A;  3E1R A;  3L71 E;  1DD3 A;  3H1L G;  1Q81 Q;  3FXD A;  2XDJ A;  2H89 C;  3V4W A;  3S4R A;  5AVU B;  5KCB A;  1LTJ A;  5GTH E;  1VF5 B;  5KLV G;  1WT6 A;  3MHV A;  4DCK A;  2NPS C;  3CPW O;  4HB1 A;  2Q3E A;  1N86 A;  1PGJ A;  1YHQ P;  3NMD A;  1N7S B;  3H1K D;  2KZJ A;  3LUR A;  2IFM A;  1A02 F;  1P84 D;  5APQ A;  5KAF H;  1PP9 E;  3ITK A;  1SFC B;  4Z1M H;  1BE3 E;  4MN4 C;  4PD4 H;  2XU6 A;  1JTH B;  1SQQ G;  2HOD B;  2V4H A;  2C9L Y;  1KZU B;  1M1J C;  1N2D C;  4H0L D;  2BCC D;  5AVS B;  4M3L A;  2Z5I A;  1R5L A;  3RK3 E;  5BU5 A;  3A7O A;  1ZRT D;  1JY3 P;  4KJM A;  2JO1 A;  2KB7 P;  3NFQ A;  4AYZ A;  1RQU A;  3LW5 J;  3H1K J;  5CJ0 A;  1NTM E;  3H1I E;  5I41 B;  2W8Z A;  2NPS B;  1T8Z A;  2AXC A;  3H1J D;  2R32 A;  2WSC J;  2YKP A;  1BGY G;  3CD6 P;  2YO2 A;  1T6A A;  1LWU C;  3FWL A;  1KIL A;  1RE3 C;  1IC2 A;  1M1J B;  1OZH A;  1JY3 O;  5CCG D;  2A06 D;  3TNU B;  5B5E H;  3I56 P;  3ZDM A;  2M3B A;  2H7H A;  5AVV B;  2I8D A;  2FYU K;  3O6Q B;  2QEX P;  1OFC X;  1RH5 B;  1SQP K;  4U3F D;  2W83 C;  1GW4 A;  1YIJ P;  3H1H G;  4W7Z A;  1PIX A;  1L0N E;  2KOG A;  2MKV A;  3M0D C;  1Y8A A;  2OYI C;  5E01 A;  2QIW A;  2G3A A;  4PD4 D;  1LWU B;  2AEJ A;  1JOC A;  3L73 D;  4JBZ A;  1BCC G;  3P8C D;  3KPE A;  5TIS E;  1VPC A;  3R2P A;  3CMA P;  5CCH A;  1SQB D;  5GQQ A;  2KLU A;  4GDO A;  1W2B O;  2BCC G;  1PGP A;  5AW9 B;  5KLV E;  1EDL A;  2KK7 A;  1IFM A;  3T97 A;  3FGA D;  2WT7 A;  3Q2Y A;  1L0L K;  1HGZ A;  1KB9 I;  5AVW B;  1J1D C;  2OYI B;  1H0T A; 
#chains in the Genus database with same CATH homology
 2ZT9 D;  2E75 C;  1DD3 A;  2E76 C;  3AEB C;  3GLM A;  3AEA C;  3AEE C;  3R4Y A;  4H13 D;  3AE5 C;  1EXJ A;  2FBW C;  4OGQ C;  4H13 C;  2G8Y A;  2H89 C;  2KCU A;  1LX8 A;  3T97 B;  1EXI A;  3Q5P A;  3O6Q A;  3RL0 g;  2WPV B;  1Y9B A;  1FDI A;  2HVA A;  5KCB A;  1VF5 B;  3AED C;  1VL2 A;  5KLI C;  4PV1 B;  1BOW A;  3R8J A;  3AEF C;  3D71 A;  1Y6U A;  1K05 A;  1FDO A;  3B71 A;  3AEC C;  5D8C A;  1UIX A;  4R24 B;  3AE6 C;  3GPV A;  3H25 A;  1IK7 A;  3EZ6 A;  2QJY C;  4TT3 H;  5KKZ C;  1JYH A;  1GMJ A;  5I44 A;  1KTM A;  4I7Z B;  5KAV A;  3GF3 A;  1VF5 D;  3GF7 A;  1NYH A;  1K04 A;  4R4M A;  2ZT9 C;  3ABV C;  3LUR A;  2ZHH A;  1KQF B;  2E74 B;  1NGM B;  3AEG C;  1KOR A;  1JBG A;  1Q06 A;  1PIX A;  1Q05 A;  4H0L B;  4YXD C;  3D70 A;  2JP3 A;  2MKV A;  1OMI A;  3Q3D A;  1JB0 J;  2K9Y A;  1DIP A;  2KVV A;  3Q5R A;  4A1M A;  2NZ2 A;  4R4L A;  4J2N A;  2D2C B;  4Z1M H;  3E0H A;  3B49 A;  2OG0 A;  3HH0 A;  1S5L X;  4I7Z C;  5E01 A;  1PL5 A;  3EZ9 A;  4R4E A;  2QIW A;  5KAT A;  3S9O A;  2G3A A;  4KT0 J;  4H44 B;  5KAX A;  3D6Z A;  1WMK A;  2FXP A;  3EZ2 A;  3GMA A;  1OW7 A;  4H0L D;  1RQV A;  1YQ3 C;  3RK3 E;  4PV1 D;  1S1C X;  2D2C D;  3AE4 C;  3G9R A;  5M1B A;  1ZME C;  2GOV A;  2E75 B;  1ZP0 C;  3IAO A;  1VF5 C;  2E76 B;  2FYN C;  4U7J A;  4PV1 C;  2ZT9 B;  2BEZ F;  4LHF A;  3EZF A;  1DD4 A;  2JO1 A;  2YIU C;  3AE8 C;  4H13 B;  4OGQ B;  4RKU J;  1R8E A;  2WSE J;  3GK6 A;  4AYZ A;  2IDB A;  2ZHG A;  1RQU A;  3LW5 J;  1RH6 A;  3GP4 A;  3UCS A;  5I41 B;  2E75 D;  2QSI A;  2WSF J;  2YMK A;  2E76 D;  1OW6 A;  3Q5S A;  3AE1 C;  1Q08 A;  2E74 D;  1Q90 D;  5KAU A;  3AE2 C;  5GQQ A;  2J5U A;  4OGQ D;  1Q09 A;  3EZ7 A;  4GDO A;  1U57 A;  1R8D A;  2E74 C;  1HF9 A;  4XFJ A;  2DG6 A;  2BOW A;  3QAO A;  2QJP C;  1D5Y A;  1Q0A A;  3Q1M A;  1Q07 A;  2H88 C;  4H0L C;  5L8R J;  4AYZ B;  2WSC J;  4Y28 J;  2VZ4 A;  3SFD C;  2IEF A;  1TU3 F;  1ZOY C;  4R22 B;  2D2C C;  2V7Q J;  1KMI Z;  3IN6 A;  2BEQ D;  4H44 D;  2QJK C;  1YQ4 C;  3C8V A;  3EWK A;  4WLW A;  3AE7 C;  4YTP C;  2WQY C;  1AJY A;  4B0Y A;  2P10 A;  2JML A;  5D90 A;  3D6Y A;  4H44 C;  4DCZ A;  1PM6 A;  4WLS A;  3FGA D;  3Q2Y A;  3SFE C;  1KIL E;  2OQQ A;  5KAW A;  3R8K A;  3AE9 C;  4IL6 X;  1OW8 A;  1HJ0 A;  1MKM A;  1KQG B;  1ZRT E;  3AE3 C;  1PV3 A;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...