3Q5SA

Crystal structure of bmrr bound to acetylcholine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5sA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5sA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5sA03
3Q1MA 3IAOA 3R8KA 4R4LA 1JYHA 2ZHGA 3HH0A 1R8EA 1BOWA 3T97B 1Q05A 3B49A 3LURA 3QAOA 2JMLA 2J5UA 3GK6A 1Q06A 2HVAA 4A1MA 5KCBA 1JBGA 1Q09A 1EXIA 5KAWA 3D71A 3Q2YA 4R22B 2ZHHA 5GQQA 1Q08A 4R4EA 4AYZA 2BOWA 3D6ZA 1D5YA 2KCUA 1R8DA 5I41B 5E01A 1Q0AA 3GPVA 4R4MA 1DIPA 3Q5RA 3D70A 1Q07A 2OQQA 3Q5SA 5KAUA 3Q3DA 2DG6A 1EXJA 3G9RA 3R8JA 5D8CA 5I44A 3D6YA 2GOVA 4B0YA 2VZ4A 5KAXA 4J2NA 4WLWA 3Q5PA 3E0HA 3UCSA 5D90A 4WLSA 5KATA 3GP4A 4R24B 4AYZB 5KAVA
chains in the Genus database with same CATH superfamily
1IFPA 3I5CA 1FZCB 3GW6A 2W6BA 1NAYA 2IEFA 1JO5A 2H43A 1LTTC 1HGVA 1HTLC 5E01A 2B87B 3WUVA 4LHFA 5AW3B 3KHUA 2AXCA 3AE5C 2Z5HA 4UB6H 2RH0A 2FBWC 3AEGC 1EZVD 3S1KA 4YTPC 3LURA 3A0HH 3U1AA 5AW0B 2R32A 1N7SC 1L0LG 3GPVA 3JCUH 1RE3C 5GTIH 1IK7A 1J1EB 3JC22 1SQPE 1VQPP 1SFCC 1YHQP 3H1JE 1S5LE 2C0WA 3GP4A 3MUDA 3CCVP 3B8EB 2O3JA 1VQ5P 1SP4A 3AE3C 1Q09A 5APQA 3L73J 3SFEC 5KKZB 3IR9A 1L0LE 2B89A 1M1JC 4DJGA 3AEBC 1PV3A 2N1TD 5B66E 3VMXA 1NTKJ 1GU5A 1Y9BA 1JBGA 2M3EA 4PV1B 1UIXA 4EDFA 4W7YA 1SFCA 2IBZE 5CBNA 2WT7A 2ZT9D 4GOFA 2LKMA 1N7SA 3NTNA 3BCCD 3SWYA 5AVSB 4TLFA 3RK3E 5KAIE 2W8ZA 5KKZC 3CWBG 2YKOA 1CI6A 1SS1A 4JBZA 2GUSA 3BRVB 1ZRTE 1JY2N 1QX8A 3CCUP 2YXQB 3L37A 5C39A 1IFDA 1SQQG 2Z4EA 5APYA 4AYZA 3CC7P 1VF5D 2RN0A 1URQB 3G6EP 1KILE 1YTZI 2FYUJ 1SLQA 3Q5PA 3O6QB 1T2KD 3H1KJ 2ITAA 4EOTA 2KYVA 5KAFH 3GK6A 1T6AA 3EZ6A 5AVUB 2QEXP 5KJ7C 5CJ4A 1BE3E 1HH0A 2KUBA 1BSNA 2QG4A 4RO0A 1XTGB 1S9KD 2A45I 2O01H 3OA7A 1S2EA 1FC2C 4I7ZC 4IFFA 3L71J 3Q2YA 2MKVA 1L0LJ 4Y99C 1URQC 3KZIH 2BCCE 1M8OB 3MHVA 4L74A 2K9JB 2HODA 4BRYB 1GD2E 1NKZB 3SWKA 1K04A 1FDOA 4Z1MH 1JY3N 2M5AA 5AW5B 2HG5D 1J2JB 3W67A 1BCCD 1KMIZ 3V2NA 5KLVJ 4BWNA 2PRRA 1YTZT 3C1LA 1M1KQ 2I8DA 3CC2P 5K5GB 1G2CB 2IYPA 3FGAD 1BSHA 1R5SA 4Y99B 2KZJA 1ZW0A 2DG6A 4QMAA 4DCZA 1BGYE 4B0YA 1JY3P 1NU1K 1E5WA 4J2NA 3IFMA 1WMKA 2A06D 1VF5C 2FY8A 2K9JA 5DJUB 4ASVA 1RF1A 2BCCD 3P8MC 2OYIA 1SQXG 3C9IA 5KCBA 1GK4A 4ZKPA 1EDLA 2C0XA 2WMMA 3B5NB 3O8ZA 1LGHB 1M7LA 4GT1A 1OZHA 3HUSB 3L75G 4I2LC 1EXJA 1PGOA 4H0LD 1AVOA 3VMAA 5KAFE 4PD4I 1Q81Q 2R5BA 1PIXA 3A0HE 5KLVE 2BASA 3AECC 3RBXA 3T97A 4A7PA 4WY4D 3AEAC 2QRXA 1JMBA 2K88A 1PGQA 1PPJD 3L73D 1A02J 5APXA 1YITP 2M0BA 2YO3A 1RF1B 2QJYC 3LIDA 3MTUE 1VQMP 1VF5B 2N9YB 1OX3A 3AEDC 3IN6A 2OG0A 2RKLA 1KQGB 1HF9A 1JEKA 2Q1KA 2FXMA 2YMKA 3KQGA 1NTKD 2L91A 2JKVA 1OVVA 3D70A 2NZ2A 3HUSC 3CXHE 3D6YA 3CX5E 4H44D 4RESB 5B66H 1ZRTD 2D2CD 5CCGD 1KTMA 1NTKK 1M1JA 1JM0A 5KJ7A 2HVAA 3BCCG 4NPFX 4AYCA 4JYCA 3H1LJ 4PD4D 1KQFB 2KCUA 1Q0AA 4KHXA 1G1JA 5D8CA 3F5HA 2QJYB 2B88A 3AE2C 1YIJP 2ZXXA 4BRYA 1M56D 2HODB 5APSA 3R4YA 2WT7B 1PPJE 3H1IG 5EFWB 4R4MA 3AE9C 2Z5IA 1K73Q 1NTMJ 3F89A 1EZVI 1OMIA 3ITKA 2OYHC 3PHLA 2FYUD 3E1IA 4LLHA 1GW3A 2OYOA 4MN4C 3WU2E 3H1KD 3L72D 1YQ3C 1JY2O 3BRTB 4K3AA 3PJSK 4N3YB 3OAKA 1ZV8A 1DEEG 3WUTA 1N86A 2Q5UA 1HJ0A 5KLIB 3UIAA 4U3FG 2R44A 4W7ZA 1S4XA 3EFGA 3EZFA 3FX0A 1KQLA 1FZCC 1G1IA 3MZWB 1L0LD 2H88C 1JUNA 2IYOA 2YMYA 1NTKG 4WLSA 2E74D 2OYHA 3HH0A 2HPCB 1N8RQ 2B87A 1TU3F 1FDIA 3M0DA 3L75E 3H25A 1IJDB 4IOIH 3U1CA 1IK9A 1GDTA 3CXHD 3AEEC 1EZVG 3E0HA 3MUDC 1BCCJ 3I55P 1URQD 3CWBJ 3L4FA 5KLVD 1IFIA 1FBMA 4L75A 1RE3A 2H7HA 2ZXEB 3BCCE 2KOGA 2RMZA 5I41B 1KFNA 2WSEJ 1W2BO 5AVRB 4ASWA 2CPSA 5D90A 3M9BA 4PD4H 2N1TA 1NYHA 5CJ0A 5AVWB 2LXBA 1PP9D 2BCCJ 2OTKE 1DX7A 3D6ZA 2SPZA 1VQOP 4D6TE 1N2DC 3B4SA 3HRNA 1Y6UA 1NGMB 2YKQA 1NVOA 4PV1C 2QVAA 2J58A 3A2AA 2AEMA 2R3CA 1SQVD 2E75D 1LJ2A 2NPSD 3TDKA 1ZN5A 2A06G 2E75B 2XKMA 4TT3H 1KFMA 3RK2D 5TISE 2XZRA 3MD0A 5APVA 1JOCA 1PPJG 3H1IE 5CCGA 2E74C 4HYTB 1NJIQ 4U3FE 1NTZK 2B9BA 3FXEA 2Q3EA 1JYHA 4EI2A 2KNCB 2V7QJ 4U3FJ 2H8PD 1PM6A 1FJKA 1FDMA 4WY4A 2WITA 1SQQE 2O1KA 3H1LD 1H0TB 1LTAC 1GL2C 1YQ4C 3JSVC 4UB8E 1X79B 2YXRB 4GODA 1VQ8P 1KILD 2KB7P 3HE4B 2E5TA 2WTYA 1QLED 3A3YB 1Q08A 3GF7A 3K5BA 2QM8A 3GHGA 3VOPA 3C8VA 3RBZA 5KAIH 5GTIE 1L0NK 1NTMD 2WZ7A 3PH0A 1IO4A 4A1MA 1MKMA 5AW7B 3HD7D 1BE3J 2NPSC 3G4SP 3L72J 4W80A 1G2CA 3V5BA 1MV8A 1FE6A 3L74D 3RK2C 4WLWA 1KB9D 3L70E 2LXCB 3AE6C 1LWUB 3L72E 5CCHA 2WSFH 2R5DA 1AA0A 2PP6A 3MGNA 1QL2A 3W68A 5TISH 1NU1J 3TGUJ 2HYNA 2E42A 3EWKA 3UCSA 1IZNB 3L75D 3JCUE 4I1LA 1ZOYC 4DCKA 4PJ0E 2AEJA 3AE1C 3CPWO 2NPSB 5APUA 1RQVA 2FFDB 1QVGO 2K9YA 3M9QA 1Q7YQ 2HFED 2FKWB 1P84D 2Q7CA 1MFZA 3B5NC 3CMAP 3Q1MA 4H44C 1LWUC 1YBKA 3TYYA 2WPQA 5AVQB 1J1DC 3CWBD 1VPCA 2KS1A 1OW8A 1ZP0C 1FS0E 1SQBG 3PRJA 2KSEA 4GOEA 4C7NB 1SQBK 2IBZI 1NTZG 3TGUE 1KB9H 4CPGA 4UB8H 1W5CE 4NPDA 3IAOA 3BASA 4RKUJ 2L5GB 2MJZA 1U7JA 2QA4P 2WPVB 2IBZD 5KAWA 3L73G 2FFDC 2KZIA 1Q86Q 1ZLLA 1PP9J 1PP9G 3CI9A 1W2EA 2YKPA 1S3JA 2WSSH 5KATA 1FOSF 5KLVK 3PTZA 5E79E 4H44B 4OVNF 3R8KA 3H1HG 3U59A 1AQ5A 3V2PA 1QVFO 1E79H 1SQVJ 3AE4C 5KJ7D 4EIJA 1FZAA 3CCSP 2E76C 1AFOA 1JB0J 1ZR2A 4OH8B 3EZ2A 4N6JA 1JCDA 3OJAB 3L36A 5BVZA 2WSCJ 1LTJB 1EDKA 3TNUB 1VDFA 2OTLP 1RH5B 5CBOA 2M8RA 2KK7A 4KT0J 1GL2A 2AXTE 2QIWA 1ZXGA 3L72G 2QJPC 3QWOC 3CX5D 3CCQP 1RE4A 2IDBA 3R8JA 3H32A 1Z56A 1K05A 1MFTA 1HBWA 5I44A 3L71E 1JTHB 1L0NG 1RY3A 2E76B 4U3FD 3TF5A 2A45G 1UIIA 4NPEA 4O9BA 2JDIH 1OW6A 3II6A 2P2UA 1KILA 1LTJC 1HUCA 1NTME 1LP1B 4I6MC 1D7MA 3RL0D 2QJPB 1PL5A 1NH4A 3Q5RA 1L4AA 2OQQA 3H32B 3WMM0 5APWA 1SQXD 1JNMA 1LT9C 1LTIC 1KORA 3I56P 3CXHI 3ABVC 1HWTC 4AQRD 3TNUA 2A06E 1LTGC 1BE3D 1MZ9A 1USDA 2IX7C 1PFIA 3VMZA 1OFCX 1NTMK 3L74J 3HD7B 1OXZA 1LTSC 1VQLP 3RGUA 4WB4A 2WSFJ 2N1TC 1S5LX 3A0BH 1VL2A 3CL3D 4GDOA 4GKGA 3L71G 3BVHA 5GTHH 1GL2D 1Q07A 1N73A 4XFJA 1LTBC 1T2KC 1JY3O 3LW5J 5KLVG 1LT9A 1NU1D 1LNQA 1LT9B 3CXHH 3PP5A 3TGUD 2E5YA 3L75J 1LP1A 3HTKA 1A02F 1FJPA 3TK1A 4R4EA 2JR8A 1T3JA 1H89A 5AW9B 1GTWA 1Q82Q 3H1JG 4PJ0H 4JPZB 2Y0DA 2BEZF 3HD7C 4R4LA 2V4HA 3H6PA 3L70J 4JYBA 1BDDA 5GQQA 1H88A 3TSIA 4RJTA 4N78D 2VZ4A 1VQKP 2E75C 3G71P 1KYOD 2FFDA 3CCEP 2Q9IA 1Q05A 1PGPA 1KQSO 3VP8A 1U7MA 1SQQJ 3MP7B 4ZMDA 2K37A 3HE5A 1KILC 1LTJA 5CHXA 2E74B 2BCCG 5B5EH 3NMDA 2FYUK 3L74E 1ZMEC 1L0NE 1GK6A 2JMLA 2N9BA 1JTHA 4WVZA 2K1AA 3GF3A 1SQXK 2WSEH 2HLOA 1NTZE 1K8AQ 1LX8A 3TGUG 5GTHE 3CCRP 1QEXA 1GL2B 4C46A 2Y9ZA 2FYUE 4C7NA 1HVVA 1PGJA 1KYOH 3AE8C 2WSCH 3T97B 1OWAA 3USSA 2ZAEB 3LIEA 5AW6B 4M3LA 1RF0C 2P10A 3V4WA 3L35A 1SQQK 2P1JA 1L0ND 3HUSA 1BDCA 1P84E 1Q2NA 1VQ4P 2ZYAA 4OGQD 2V7QH 3B5NA 3B5ND 5DJTB 1U57A 3RK2B 2KNCA 3L74G 4HB1A 2PGDA 3L73E 2ZYDA 3H1ID 3H1JJ 4JQ0D 3S4RA 1YI2P 3A0BE 3CMEP 2OARA 3QAOA 1SQXJ 3P8CD 3QH9A 1SQVK 1KB9E 5TJHA 2I1JA 3Q5SA 3VMYA 1NWQA 1DEBA 1IFMA 2Y0CA 4WY4C 1M57D 1IC2A 4D6TD 5H2FE 1DH3A 1T8ZA 3LW5H 5L8RJ 4YXDC 4H13B 2R3SA 2HR3A 2BOWA 2NPSA 1RF0A 1PZQA 1DIPA 1KC8Q 4IL6E 3M0AA 1KV4A 5KAUA 1J1DB 1S5LH 1KD1Q 3CC4P 2KXPB 3V4QA 1GW4A 4OWFA 1NU1G 5CCHC 1GU4A 3H1HD 5CCGC 1SQBD 3EFFK 2A45H 1R8DA 3SFDC 2CK3H 1N73B 1FAVA 3CWBE 4DZOA 1NOHA 2KP8A 3E7KA 3NFQA 3KYQA 1VQ9P 3B49A 4ZKUA 3HD7A 3H1LG 3GG2A 3KXDA 3L70D 1BGYG 1LT1A 1NHLA 3G9RA 1URQA 2JWAA 5CMZA 2WPSA 1Y47A 2Q3IA 1Q06A 2HPCA 3FWNA 1RHZB 1KYOI 3H1LE 3WUUA 1SQQD 2QSIA 4N78E 1OW7A 3CCLP 1L4AB 1NTKE 3E1RA 5KAVA 2AEFA 1H0TA 2WPRA 1OVRA 3RL0B 3G3ZA 2KVVA 1R5LA 2OTJP 2POHA 5B5EE 3FWLA 2W83C 3M0DC 5AW1B 3V2RA 5H2FH 1RH6A 3CD6P 4H13D 3N7NA 1SQPG 4R22B 3HE5B 1SQPJ 1N7LA 4KJMA 1YYCA 5AW4B 3H1HE 4IL6H 1L4AC 5BU8B 4EYYQ 4XA4A 2Y9YA 4R24B 1NKNA 2ZVOB 2Y0EA 3VYIA 4Y28J 1IFJA 3RL0C 2W6JH 1J1EC 3M06A 2FXOA 1H8AA 3KZIE 1KYOE 2G3AA 1SVFA 2D2CB 2ZYGA 2JWDA 3MIWA 1S72P 1L0NJ 2ZJSE 1VQNP 3AE7C 1BCCG 2WQYC 4WBAA 1M1JB 3EQ2A 1CSBA 1KB9I 5APTA 1NTZD 2H89C 2UWJE 3HTKB 2FYNC 1YJWP 2N1TB 4XE5B 2W27A 2P58A 3GMAA 3H1IJ 1NO4A 3H1JD 1BOWA 2JO1A 5E79H 4C7RA 2GA1A 1EXIA 2FYUG 3M9HA 1FZBA 1EQ7A 2WWWA 4DOJA 1SQPK 1NTMG 2ZT9B 2D2CC 5AW2B 1K9MQ 1X0TA 3P8CE 3H1KE 4D6TJ 4IFDK 1KZUB 5AVYB 2AXTH 2M3BA 1L0LK 3A5TA 2O01N 3KPEA 2FYNB 3OW2O 1RQUA 4BXLA 1WRGA 2G8YA 5AVTB 1L4AD 1BGYJ 1RE4C 2OYIB 2YIUC 1QL1A 3KDPB 3IF4A 1D5YA 1OIPA 1AJYA 3H1HJ 1SQBJ 3SSUA 4JF7A 2ZT9C 4WWIA 1EZVE 3Q3DA 2XU6A 4HKZH 1MUUA 1T3UA 1KILB 2KLUA 2Q6QA 2JEEA 3AEFC 3P7KA 1LWUA 2JP3A 2ZVNB 3VP9A 3FXDA 3N4XA 5AVZB 2KS1B 3S9OA 2YNYA 5M1BA 3EZ7A 1Q90D 4I7ZB 4HJGH 1FZGA 3V2QA 2M5AB 4PV1D 2FXPA 4B86A 2OYIC 4OGQC 2KLVA 1HGZA 2J5UA 2YIUB 1BE3G 5AW8B 3SWFA 1DD3A 2W90A 4GIFA 4AUWA 2GOVA 4PD4E 2E43A 2K3RA 2FYZA 1X22A 4IFMA 2GUVA 1FZFA 2IBZG 1X8YA 2P7JA 1JCCA 3HE4A 1VQ6P 1P84I 1QGKB 1Y8AA 2QE7H 2C9LY 5BU5A 2PFXA 2CPBA 1SQXE 2C9NY 1R8EA 5CCHD 4OGQB 1EC5A 3M91A 4UB6E 2XDJA 2ZHHA 4YPCA 1CZQA 1SQPD 2WVRA 2GM4A 1VQ7P 5AVXB 4H0LC 1P84H 4U7JA 1FZEA 2IPPA 1ZR4A 1AV1A 1S1CX 3NXSA 1FOSE 4LGDE 5KTBA 2IFNA 3BCCJ 3A7OA 1EDJA 2ZHGA 1M90Q 1L2PA 1CW5A 4ZNCA 2PAJA 3VTPC 1RF1C 2NRGA 4WY4B 3BATA 2IFMA 2XV5A 1FU1A 3WU2H 1NU1E 4DT0A 1NTZJ 5KAXA 4D6TG 1EDIA 4H13C 2KIKA 3GHGC 4H0LB 1SFCD 1SQVE 3CX5I 1JY2P 1OVUA 2VRSA 1S9KE 2IZ1A 5AVVB 2YO2A 2IZ0A 1JMMA 3L70G 1GZLA 2KSJA 3VN0A 1N73C 1HJBA 3RK3B 3V6IA 1AVYA 2W6AA 1SQVG 3D71A 4HH2A 3RK3D 1SQBE 3O6QA 2O1JA 2J59M 1BCCE 1XTCC 1X9VA 2DW3A 2QJKC 4AYZB 1DD4A 4L73A 1YJNP 3EZ9A 1GMJA 3GHGB 2E76D 4IL6X 3L71D 3CX5H 2ZFCA 1IFNA 1WT6A 1BGYD 3CCJP 3CCMP 2OYHB 1PP9E 2LR2A 3R2PA 3P32A 3ZDMA 1YJ9P 4YXWH 1CI6B 2OGUA 4K35A 2XNXA 3RL0g 2O01J 2JJLA 4LC1A 1NAFA 2I1KA 3PLNA 2P67A 3RK3C 2BEQD 2QM7A 1FZCA 5KLIC 1N7SB 3B71A 1AQTA 3CLQA 4L76A 1N7SD 2KI7B 1USEA 3GLMA 1KN7A 1SFCB 2QJKB 2XNDH 3H1KG
chains in the Genus database with same CATH topology
1VF5B 3IAOA 4R4LA 3AE8C 3AEDC 3IN6A 4H0LB 2E75D 3T97B 2OG0A 4RKUJ 2IEFA 1KQGB 1RH6A 4A1MA 1HF9A 1MKMA 1K04A 1FDOA 4Z1MH 4H13D 2E75B 2WPVB 3EZFA 5KAWA 3RK3E 2P10A 2YMKA 4R22B 4TT3H 5GQQA 5KKZC 3SFDC 1R8DA 5E01A 1PL5A 3Q5RA 3D70A 2NZ2A 4LHFA 2OQQA 1RQUA 3D6YA 2VZ4A 2H88C 1KMIZ 2E75C 4H44D 1ZRTE 4WLWA 2G8YA 3AE5C 4WLSA 2E74D 5KATA 4R24B 4OGQD 4H44B 2D2CD 3R8KA 2FBWC 1KTMA 3AE6C 3AEGC 4Y28J 3HH0A 1R8EA 1KORA 4YTPC 1Q05A 2E74C 3ABVC 3B49A 3LURA 4OGQB 2YIUC 2HVAA 1TU3F 1FDIA 1U57A 3AE4C 3D71A 3FGAD 2ZHHA 2E76C 4AYZA 1D5YA 1KQFB 2KCUA 1JB0J 3O6QA 1AJYA 1Q0AA 3GPVA 1VF5D 3H25A 3EZ2A 2ZT9C 2E74B 2G3AA 1KILE 3Q3DA 2DG6A 1IK7A 4DCZA 2D2CB 5D8CA 3G9RA 4B0YA 3AEEC 4J2NA 3Q5PA 3EWKA 3E0HA 3AE2C 3UCSA 2QJKC 3GP4A 2WSCJ 4AYZB 1WMKA 1DD4A 1VF5C 1JYHA 3EZ9A 1GMJA 3AE7C 3R4YA 1ZOYC 1ZMEC 2WQYC 2E76D 4H0LC 4IL6X 3QAOA 4U7JA 2V7QJ 2JMLA 3GK6A 4KT0J 1Q06A 5KCBA 3AE3C 2WSFJ 3AEFC 3AE1C 1S5LX 1Q09A 2JP3A 1PM6A 2QIWA 1VL2A 4GDOA 1RQVA 3SFEC 3EZ6A 5I41B 2QJPC 2K9YA 2WSEJ 3AE9C 4R4MA 1S1CX 2H89C 3S9OA 2QSIA 1Q07A 2FYNC 1OW7A 3Q5SA 2IDBA 5M1BA 1EXJA 3R8JA 3EZ7A 4XFJA 1Q90D 4I7ZB 1OMIA 3LW5J 4H0LD 1K05A 5D90A 3AEBC 5I44A 3RL0g 5KAVA 3Q1MA 1PV3A 3GMAA 1PIXA 4PV1D 4H44C 2O01J 3GF3A 2ZHGA 1YQ4C 1NYHA 1BOWA 2FXPA 4OGQC 1YQ3C 2J5UA 2JO1A 3AECC 4I7ZC 1Y9BA 2BEQD 5L8RJ 1JBGA 1OW8A 1EXIA 4PV1B 1LX8A 4YXDC 3Q2YA 1UIXA 2E76B 4H13B 5KLIC 1Q08A 4R4EA 3GF7A 2BOWA 3D6ZA 3B71A 1DD3A 2KVVA 1ZP0C 2MKVA 1DIPA 3AEAC 2ZT9B 2D2CC 5KAUA 1OW6A 2GOVA 3GLMA 2QJYC 1Y6UA 1NGMB 3C8VA 2ZT9D 1HJ0A 4PV1C 5KAXA 4H13C 2BEZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1M A;  3IAO A;  3R8K A;  4R4L A;  1JYH A;  2ZHG A;  3HH0 A;  1R8E A;  1BOW A;  3T97 B;  1Q05 A;  3B49 A;  3LUR A;  3QAO A;  2JML A;  2J5U A;  3GK6 A;  1Q06 A;  2HVA A;  4A1M A;  5KCB A;  1JBG A;  1Q09 A;  1EXI A;  5KAW A;  3D71 A;  3Q2Y A;  4R22 B;  2ZHH A;  5GQQ A;  1Q08 A;  4R4E A;  4AYZ A;  2BOW A;  3D6Z A;  1D5Y A;  2KCU A;  1R8D A;  5I41 B;  5E01 A;  1Q0A A;  3GPV A;  4R4M A;  1DIP A;  3Q5R A;  3D70 A;  1Q07 A;  2OQQ A;  3Q5S A;  5KAU A;  3Q3D A;  2DG6 A;  1EXJ A;  3G9R A;  3R8J A;  5D8C A;  5I44 A;  3D6Y A;  2GOV A;  4B0Y A;  2VZ4 A;  5KAX A;  4J2N A;  4WLW A;  3Q5P A;  3E0H A;  3UCS A;  5D90 A;  4WLS A;  5KAT A;  3GP4 A;  4R24 B;  4AYZ B;  5KAV A; 
#chains in the Genus database with same CATH topology
 1IFP A;  3I5C A;  1FZC B;  3GW6 A;  2W6B A;  1NAY A;  2IEF A;  1JO5 A;  2H43 A;  1LTT C;  1HGV A;  1HTL C;  5E01 A;  2B87 B;  3WUV A;  4LHF A;  5AW3 B;  3KHU A;  2AXC A;  3AE5 C;  2Z5H A;  4UB6 H;  2RH0 A;  2FBW C;  3AEG C;  1EZV D;  3S1K A;  4YTP C;  3LUR A;  3A0H H;  3U1A A;  5AW0 B;  2R32 A;  1N7S C;  1L0L G;  3GPV A;  3JCU H;  1RE3 C;  5GTI H;  1IK7 A;  1J1E B;  3JC2 2;  1SQP E;  1VQP P;  1SFC C;  1YHQ P;  3H1J E;  1S5L E;  2C0W A;  3GP4 A;  3MUD A;  3CCV P;  3B8E B;  2O3J A;  1VQ5 P;  1SP4 A;  3AE3 C;  1Q09 A;  5APQ A;  3L73 J;  3SFE C;  5KKZ B;  3IR9 A;  1L0L E;  2B89 A;  1M1J C;  4DJG A;  3AEB C;  1PV3 A;  2N1T D;  5B66 E;  3VMX A;  1NTK J;  1GU5 A;  1Y9B A;  1JBG A;  2M3E A;  4PV1 B;  1UIX A;  4EDF A;  4W7Y A;  1SFC A;  2IBZ E;  5CBN A;  2WT7 A;  2ZT9 D;  4GOF A;  2LKM A;  1N7S A;  3NTN A;  3BCC D;  3SWY A;  5AVS B;  4TLF A;  3RK3 E;  5KAI E;  2W8Z A;  5KKZ C;  3CWB G;  2YKO A;  1CI6 A;  1SS1 A;  4JBZ A;  2GUS A;  3BRV B;  1ZRT E;  1JY2 N;  1QX8 A;  3CCU P;  2YXQ B;  3L37 A;  5C39 A;  1IFD A;  1SQQ G;  2Z4E A;  5APY A;  4AYZ A;  3CC7 P;  1VF5 D;  2RN0 A;  1URQ B;  3G6E P;  1KIL E;  1YTZ I;  2FYU J;  1SLQ A;  3Q5P A;  3O6Q B;  1T2K D;  3H1K J;  2ITA A;  4EOT A;  2KYV A;  5KAF H;  3GK6 A;  1T6A A;  3EZ6 A;  5AVU B;  2QEX P;  5KJ7 C;  5CJ4 A;  1BE3 E;  1HH0 A;  2KUB A;  1BSN A;  2QG4 A;  4RO0 A;  1XTG B;  1S9K D;  2A45 I;  2O01 H;  3OA7 A;  1S2E A;  1FC2 C;  4I7Z C;  4IFF A;  3L71 J;  3Q2Y A;  2MKV A;  1L0L J;  4Y99 C;  1URQ C;  3KZI H;  2BCC E;  1M8O B;  3MHV A;  4L74 A;  2K9J B;  2HOD A;  4BRY B;  1GD2 E;  1NKZ B;  3SWK A;  1K04 A;  1FDO A;  4Z1M H;  1JY3 N;  2M5A A;  5AW5 B;  2HG5 D;  1J2J B;  3W67 A;  1BCC D;  1KMI Z;  3V2N A;  5KLV J;  4BWN A;  2PRR A;  1YTZ T;  3C1L A;  1M1K Q;  2I8D A;  3CC2 P;  5K5G B;  1G2C B;  2IYP A;  3FGA D;  1BSH A;  1R5S A;  4Y99 B;  2KZJ A;  1ZW0 A;  2DG6 A;  4QMA A;  4DCZ A;  1BGY E;  4B0Y A;  1JY3 P;  1NU1 K;  1E5W A;  4J2N A;  3IFM A;  1WMK A;  2A06 D;  1VF5 C;  2FY8 A;  2K9J A;  5DJU B;  4ASV A;  1RF1 A;  2BCC D;  3P8M C;  2OYI A;  1SQX G;  3C9I A;  5KCB A;  1GK4 A;  4ZKP A;  1EDL A;  2C0X A;  2WMM A;  3B5N B;  3O8Z A;  1LGH B;  1M7L A;  4GT1 A;  1OZH A;  3HUS B;  3L75 G;  4I2L C;  1EXJ A;  1PGO A;  4H0L D;  1AVO A;  3VMA A;  5KAF E;  4PD4 I;  1Q81 Q;  2R5B A;  1PIX A;  3A0H E;  5KLV E;  2BAS A;  3AEC C;  3RBX A;  3T97 A;  4A7P A;  4WY4 D;  3AEA C;  2QRX A;  1JMB A;  2K88 A;  1PGQ A;  1PPJ D;  3L73 D;  1A02 J;  5APX A;  1YIT P;  2M0B A;  2YO3 A;  1RF1 B;  2QJY C;  3LID A;  3MTU E;  1VQM P;  1VF5 B;  2N9Y B;  1OX3 A;  3AED C;  3IN6 A;  2OG0 A;  2RKL A;  1KQG B;  1HF9 A;  1JEK A;  2Q1K A;  2FXM A;  2YMK A;  3KQG A;  1NTK D;  2L91 A;  2JKV A;  1OVV A;  3D70 A;  2NZ2 A;  3HUS C;  3CXH E;  3D6Y A;  3CX5 E;  4H44 D;  4RES B;  5B66 H;  1ZRT D;  2D2C D;  5CCG D;  1KTM A;  1NTK K;  1M1J A;  1JM0 A;  5KJ7 A;  2HVA A;  3BCC G;  4NPF X;  4AYC A;  4JYC A;  3H1L J;  4PD4 D;  1KQF B;  2KCU A;  1Q0A A;  4KHX A;  1G1J A;  5D8C A;  3F5H A;  2QJY B;  2B88 A;  3AE2 C;  1YIJ P;  2ZXX A;  4BRY A;  1M56 D;  2HOD B;  5APS A;  3R4Y A;  2WT7 B;  1PPJ E;  3H1I G;  5EFW B;  4R4M A;  3AE9 C;  2Z5I A;  1K73 Q;  1NTM J;  3F89 A;  1EZV I;  1OMI A;  3ITK A;  2OYH C;  3PHL A;  2FYU D;  3E1I A;  4LLH A;  1GW3 A;  2OYO A;  4MN4 C;  3WU2 E;  3H1K D;  3L72 D;  1YQ3 C;  1JY2 O;  3BRT B;  4K3A A;  3PJS K;  4N3Y B;  3OAK A;  1ZV8 A;  1DEE G;  3WUT A;  1N86 A;  2Q5U A;  1HJ0 A;  5KLI B;  3UIA A;  4U3F G;  2R44 A;  4W7Z A;  1S4X A;  3EFG A;  3EZF A;  3FX0 A;  1KQL A;  1FZC C;  1G1I A;  3MZW B;  1L0L D;  2H88 C;  1JUN A;  2IYO A;  2YMY A;  1NTK G;  4WLS A;  2E74 D;  2OYH A;  3HH0 A;  2HPC B;  1N8R Q;  2B87 A;  1TU3 F;  1FDI A;  3M0D A;  3L75 E;  3H25 A;  1IJD B;  4IOI H;  3U1C A;  1IK9 A;  1GDT A;  3CXH D;  3AEE C;  1EZV G;  3E0H A;  3MUD C;  1BCC J;  3I55 P;  1URQ D;  3CWB J;  3L4F A;  5KLV D;  1IFI A;  1FBM A;  4L75 A;  1RE3 A;  2H7H A;  2ZXE B;  3BCC E;  2KOG A;  2RMZ A;  5I41 B;  1KFN A;  2WSE J;  1W2B O;  5AVR B;  4ASW A;  2CPS A;  5D90 A;  3M9B A;  4PD4 H;  2N1T A;  1NYH A;  5CJ0 A;  5AVW B;  2LXB A;  1PP9 D;  2BCC J;  2OTK E;  1DX7 A;  3D6Z A;  2SPZ A;  1VQO P;  4D6T E;  1N2D C;  3B4S A;  3HRN A;  1Y6U A;  1NGM B;  2YKQ A;  1NVO A;  4PV1 C;  2QVA A;  2J58 A;  3A2A A;  2AEM A;  2R3C A;  1SQV D;  2E75 D;  1LJ2 A;  2NPS D;  3TDK A;  1ZN5 A;  2A06 G;  2E75 B;  2XKM A;  4TT3 H;  1KFM A;  3RK2 D;  5TIS E;  2XZR A;  3MD0 A;  5APV A;  1JOC A;  1PPJ G;  3H1I E;  5CCG A;  2E74 C;  4HYT B;  1NJI Q;  4U3F E;  1NTZ K;  2B9B A;  3FXE A;  2Q3E A;  1JYH A;  4EI2 A;  2KNC B;  2V7Q J;  4U3F J;  2H8P D;  1PM6 A;  1FJK A;  1FDM A;  4WY4 A;  2WIT A;  1SQQ E;  2O1K A;  3H1L D;  1H0T B;  1LTA C;  1GL2 C;  1YQ4 C;  3JSV C;  4UB8 E;  1X79 B;  2YXR B;  4GOD A;  1VQ8 P;  1KIL D;  2KB7 P;  3HE4 B;  2E5T A;  2WTY A;  1QLE D;  3A3Y B;  1Q08 A;  3GF7 A;  3K5B A;  2QM8 A;  3GHG A;  3VOP A;  3C8V A;  3RBZ A;  5KAI H;  5GTI E;  1L0N K;  1NTM D;  2WZ7 A;  3PH0 A;  1IO4 A;  4A1M A;  1MKM A;  5AW7 B;  3HD7 D;  1BE3 J;  2NPS C;  3G4S P;  3L72 J;  4W80 A;  1G2C A;  3V5B A;  1MV8 A;  1FE6 A;  3L74 D;  3RK2 C;  4WLW A;  1KB9 D;  3L70 E;  2LXC B;  3AE6 C;  1LWU B;  3L72 E;  5CCH A;  2WSF H;  2R5D A;  1AA0 A;  2PP6 A;  3MGN A;  1QL2 A;  3W68 A;  5TIS H;  1NU1 J;  3TGU J;  2HYN A;  2E42 A;  3EWK A;  3UCS A;  1IZN B;  3L75 D;  3JCU E;  4I1L A;  1ZOY C;  4DCK A;  4PJ0 E;  2AEJ A;  3AE1 C;  3CPW O;  2NPS B;  5APU A;  1RQV A;  2FFD B;  1QVG O;  2K9Y A;  3M9Q A;  1Q7Y Q;  2HFE D;  2FKW B;  1P84 D;  2Q7C A;  1MFZ A;  3B5N C;  3CMA P;  3Q1M A;  4H44 C;  1LWU C;  1YBK A;  3TYY A;  2WPQ A;  5AVQ B;  1J1D C;  3CWB D;  1VPC A;  2KS1 A;  1OW8 A;  1ZP0 C;  1FS0 E;  1SQB G;  3PRJ A;  2KSE A;  4GOE A;  4C7N B;  1SQB K;  2IBZ I;  1NTZ G;  3TGU E;  1KB9 H;  4CPG A;  4UB8 H;  1W5C E;  4NPD A;  3IAO A;  3BAS A;  4RKU J;  2L5G B;  2MJZ A;  1U7J A;  2QA4 P;  2WPV B;  2IBZ D;  5KAW A;  3L73 G;  2FFD C;  2KZI A;  1Q86 Q;  1ZLL A;  1PP9 J;  1PP9 G;  3CI9 A;  1W2E A;  2YKP A;  1S3J A;  2WSS H;  5KAT A;  1FOS F;  5KLV K;  3PTZ A;  5E79 E;  4H44 B;  4OVN F;  3R8K A;  3H1H G;  3U59 A;  1AQ5 A;  3V2P A;  1QVF O;  1E79 H;  1SQV J;  3AE4 C;  5KJ7 D;  4EIJ A;  1FZA A;  3CCS P;  2E76 C;  1AFO A;  1JB0 J;  1ZR2 A;  4OH8 B;  3EZ2 A;  4N6J A;  1JCD A;  3OJA B;  3L36 A;  5BVZ A;  2WSC J;  1LTJ B;  1EDK A;  3TNU B;  1VDF A;  2OTL P;  1RH5 B;  5CBO A;  2M8R A;  2KK7 A;  4KT0 J;  1GL2 A;  2AXT E;  2QIW A;  1ZXG A;  3L72 G;  2QJP C;  3QWO C;  3CX5 D;  3CCQ P;  1RE4 A;  2IDB A;  3R8J A;  3H32 A;  1Z56 A;  1K05 A;  1MFT A;  1HBW A;  5I44 A;  3L71 E;  1JTH B;  1L0N G;  1RY3 A;  2E76 B;  4U3F D;  3TF5 A;  2A45 G;  1UII A;  4NPE A;  4O9B A;  2JDI H;  1OW6 A;  3II6 A;  2P2U A;  1KIL A;  1LTJ C;  1HUC A;  1NTM E;  1LP1 B;  4I6M C;  1D7M A;  3RL0 D;  2QJP B;  1PL5 A;  1NH4 A;  3Q5R A;  1L4A A;  2OQQ A;  3H32 B;  3WMM 0;  5APW A;  1SQX D;  1JNM A;  1LT9 C;  1LTI C;  1KOR A;  3I56 P;  3CXH I;  3ABV C;  1HWT C;  4AQR D;  3TNU A;  2A06 E;  1LTG C;  1BE3 D;  1MZ9 A;  1USD A;  2IX7 C;  1PFI A;  3VMZ A;  1OFC X;  1NTM K;  3L74 J;  3HD7 B;  1OXZ A;  1LTS C;  1VQL P;  3RGU A;  4WB4 A;  2WSF J;  2N1T C;  1S5L X;  3A0B H;  1VL2 A;  3CL3 D;  4GDO A;  4GKG A;  3L71 G;  3BVH A;  5GTH H;  1GL2 D;  1Q07 A;  1N73 A;  4XFJ A;  1LTB C;  1T2K C;  1JY3 O;  3LW5 J;  5KLV G;  1LT9 A;  1NU1 D;  1LNQ A;  1LT9 B;  3CXH H;  3PP5 A;  3TGU D;  2E5Y A;  3L75 J;  1LP1 A;  3HTK A;  1A02 F;  1FJP A;  3TK1 A;  4R4E A;  2JR8 A;  1T3J A;  1H89 A;  5AW9 B;  1GTW A;  1Q82 Q;  3H1J G;  4PJ0 H;  4JPZ B;  2Y0D A;  2BEZ F;  3HD7 C;  4R4L A;  2V4H A;  3H6P A;  3L70 J;  4JYB A;  1BDD A;  5GQQ A;  1H88 A;  3TSI A;  4RJT A;  4N78 D;  2VZ4 A;  1VQK P;  2E75 C;  3G71 P;  1KYO D;  2FFD A;  3CCE P;  2Q9I A;  1Q05 A;  1PGP A;  1KQS O;  3VP8 A;  1U7M A;  1SQQ J;  3MP7 B;  4ZMD A;  2K37 A;  3HE5 A;  1KIL C;  1LTJ A;  5CHX A;  2E74 B;  2BCC G;  5B5E H;  3NMD A;  2FYU K;  3L74 E;  1ZME C;  1L0N E;  1GK6 A;  2JML A;  2N9B A;  1JTH A;  4WVZ A;  2K1A A;  3GF3 A;  1SQX K;  2WSE H;  2HLO A;  1NTZ E;  1K8A Q;  1LX8 A;  3TGU G;  5GTH E;  3CCR P;  1QEX A;  1GL2 B;  4C46 A;  2Y9Z A;  2FYU E;  4C7N A;  1HVV A;  1PGJ A;  1KYO H;  3AE8 C;  2WSC H;  3T97 B;  1OWA A;  3USS A;  2ZAE B;  3LIE A;  5AW6 B;  4M3L A;  1RF0 C;  2P10 A;  3V4W A;  3L35 A;  1SQQ K;  2P1J A;  1L0N D;  3HUS A;  1BDC A;  1P84 E;  1Q2N A;  1VQ4 P;  2ZYA A;  4OGQ D;  2V7Q H;  3B5N A;  3B5N D;  5DJT B;  1U57 A;  3RK2 B;  2KNC A;  3L74 G;  4HB1 A;  2PGD A;  3L73 E;  2ZYD A;  3H1I D;  3H1J J;  4JQ0 D;  3S4R A;  1YI2 P;  3A0B E;  3CME P;  2OAR A;  3QAO A;  1SQX J;  3P8C D;  3QH9 A;  1SQV K;  1KB9 E;  5TJH A;  2I1J A;  3Q5S A;  3VMY A;  1NWQ A;  1DEB A;  1IFM A;  2Y0C A;  4WY4 C;  1M57 D;  1IC2 A;  4D6T D;  5H2F E;  1DH3 A;  1T8Z A;  3LW5 H;  5L8R J;  4YXD C;  4H13 B;  2R3S A;  2HR3 A;  2BOW A;  2NPS A;  1RF0 A;  1PZQ A;  1DIP A;  1KC8 Q;  4IL6 E;  3M0A A;  1KV4 A;  5KAU A;  1J1D B;  1S5L H;  1KD1 Q;  3CC4 P;  2KXP B;  3V4Q A;  1GW4 A;  4OWF A;  1NU1 G;  5CCH C;  1GU4 A;  3H1H D;  5CCG C;  1SQB D;  3EFF K;  2A45 H;  1R8D A;  3SFD C;  2CK3 H;  1N73 B;  1FAV A;  3CWB E;  4DZO A;  1NOH A;  2KP8 A;  3E7K A;  3NFQ A;  3KYQ A;  1VQ9 P;  3B49 A;  4ZKU A;  3HD7 A;  3H1L G;  3GG2 A;  3KXD A;  3L70 D;  1BGY G;  1LT1 A;  1NHL A;  3G9R A;  1URQ A;  2JWA A;  5CMZ A;  2WPS A;  1Y47 A;  2Q3I A;  1Q06 A;  2HPC A;  3FWN A;  1RHZ B;  1KYO I;  3H1L E;  3WUU A;  1SQQ D;  2QSI A;  4N78 E;  1OW7 A;  3CCL P;  1L4A B;  1NTK E;  3E1R A;  5KAV A;  2AEF A;  1H0T A;  2WPR A;  1OVR A;  3RL0 B;  3G3Z A;  2KVV A;  1R5L A;  2OTJ P;  2POH A;  5B5E E;  3FWL A;  2W83 C;  3M0D C;  5AW1 B;  3V2R A;  5H2F H;  1RH6 A;  3CD6 P;  4H13 D;  3N7N A;  1SQP G;  4R22 B;  3HE5 B;  1SQP J;  1N7L A;  4KJM A;  1YYC A;  5AW4 B;  3H1H E;  4IL6 H;  1L4A C;  5BU8 B;  4EYY Q;  4XA4 A;  2Y9Y A;  4R24 B;  1NKN A;  2ZVO B;  2Y0E A;  3VYI A;  4Y28 J;  1IFJ A;  3RL0 C;  2W6J H;  1J1E C;  3M06 A;  2FXO A;  1H8A A;  3KZI E;  1KYO E;  2G3A A;  1SVF A;  2D2C B;  2ZYG A;  2JWD A;  3MIW A;  1S72 P;  1L0N J;  2ZJS E;  1VQN P;  3AE7 C;  1BCC G;  2WQY C;  4WBA A;  1M1J B;  3EQ2 A;  1CSB A;  1KB9 I;  5APT A;  1NTZ D;  2H89 C;  2UWJ E;  3HTK B;  2FYN C;  1YJW P;  2N1T B;  4XE5 B;  2W27 A;  2P58 A;  3GMA A;  3H1I J;  1NO4 A;  3H1J D;  1BOW A;  2JO1 A;  5E79 H;  4C7R A;  2GA1 A;  1EXI A;  2FYU G;  3M9H A;  1FZB A;  1EQ7 A;  2WWW A;  4DOJ A;  1SQP K;  1NTM G;  2ZT9 B;  2D2C C;  5AW2 B;  1K9M Q;  1X0T A;  3P8C E;  3H1K E;  4D6T J;  4IFD K;  1KZU B;  5AVY B;  2AXT H;  2M3B A;  1L0L K;  3A5T A;  2O01 N;  3KPE A;  2FYN B;  3OW2 O;  1RQU A;  4BXL A;  1WRG A;  2G8Y A;  5AVT B;  1L4A D;  1BGY J;  1RE4 C;  2OYI B;  2YIU C;  1QL1 A;  3KDP B;  3IF4 A;  1D5Y A;  1OIP A;  1AJY A;  3H1H J;  1SQB J;  3SSU A;  4JF7 A;  2ZT9 C;  4WWI A;  1EZV E;  3Q3D A;  2XU6 A;  4HKZ H;  1MUU A;  1T3U A;  1KIL B;  2KLU A;  2Q6Q A;  2JEE A;  3AEF C;  3P7K A;  1LWU A;  2JP3 A;  2ZVN B;  3VP9 A;  3FXD A;  3N4X A;  5AVZ B;  2KS1 B;  3S9O A;  2YNY A;  5M1B A;  3EZ7 A;  1Q90 D;  4I7Z B;  4HJG H;  1FZG A;  3V2Q A;  2M5A B;  4PV1 D;  2FXP A;  4B86 A;  2OYI C;  4OGQ C;  2KLV A;  1HGZ A;  2J5U A;  2YIU B;  1BE3 G;  5AW8 B;  3SWF A;  1DD3 A;  2W90 A;  4GIF A;  4AUW A;  2GOV A;  4PD4 E;  2E43 A;  2K3R A;  2FYZ A;  1X22 A;  4IFM A;  2GUV A;  1FZF A;  2IBZ G;  1X8Y A;  2P7J A;  1JCC A;  3HE4 A;  1VQ6 P;  1P84 I;  1QGK B;  1Y8A A;  2QE7 H;  2C9L Y;  5BU5 A;  2PFX A;  2CPB A;  1SQX E;  2C9N Y;  1R8E A;  5CCH D;  4OGQ B;  1EC5 A;  3M91 A;  4UB6 E;  2XDJ A;  2ZHH A;  4YPC A;  1CZQ A;  1SQP D;  2WVR A;  2GM4 A;  1VQ7 P;  5AVX B;  4H0L C;  1P84 H;  4U7J A;  1FZE A;  2IPP A;  1ZR4 A;  1AV1 A;  1S1C X;  3NXS A;  1FOS E;  4LGD E;  5KTB A;  2IFN A;  3BCC J;  3A7O A;  1EDJ A;  2ZHG A;  1M90 Q;  1L2P A;  1CW5 A;  4ZNC A;  2PAJ A;  3VTP C;  1RF1 C;  2NRG A;  4WY4 B;  3BAT A;  2IFM A;  2XV5 A;  1FU1 A;  3WU2 H;  1NU1 E;  4DT0 A;  1NTZ J;  5KAX A;  4D6T G;  1EDI A;  4H13 C;  2KIK A;  3GHG C;  4H0L B;  1SFC D;  1SQV E;  3CX5 I;  1JY2 P;  1OVU A;  2VRS A;  1S9K E;  2IZ1 A;  5AVV B;  2YO2 A;  2IZ0 A;  1JMM A;  3L70 G;  1GZL A;  2KSJ A;  3VN0 A;  1N73 C;  1HJB A;  3RK3 B;  3V6I A;  1AVY A;  2W6A A;  1SQV G;  3D71 A;  4HH2 A;  3RK3 D;  1SQB E;  3O6Q A;  2O1J A;  2J59 M;  1BCC E;  1XTC C;  1X9V A;  2DW3 A;  2QJK C;  4AYZ B;  1DD4 A;  4L73 A;  1YJN P;  3EZ9 A;  1GMJ A;  3GHG B;  2E76 D;  4IL6 X;  3L71 D;  3CX5 H;  2ZFC A;  1IFN A;  1WT6 A;  1BGY D;  3CCJ P;  3CCM P;  2OYH B;  1PP9 E;  2LR2 A;  3R2P A;  3P32 A;  3ZDM A;  1YJ9 P;  4YXW H;  1CI6 B;  2OGU A;  4K35 A;  2XNX A;  3RL0 g;  2O01 J;  2JJL A;  4LC1 A;  1NAF A;  2I1K A;  3PLN A;  2P67 A;  3RK3 C;  2BEQ D;  2QM7 A;  1FZC A;  5KLI C;  1N7S B;  3B71 A;  1AQT A;  3CLQ A;  4L76 A;  1N7S D;  2KI7 B;  1USE A;  3GLM A;  1KN7 A;  1SFC B;  2QJK B;  2XND H;  3H1K G; 
#chains in the Genus database with same CATH homology
 1VF5 B;  3IAO A;  4R4L A;  3AE8 C;  3AED C;  3IN6 A;  4H0L B;  2E75 D;  3T97 B;  2OG0 A;  4RKU J;  2IEF A;  1KQG B;  1RH6 A;  4A1M A;  1HF9 A;  1MKM A;  1K04 A;  1FDO A;  4Z1M H;  4H13 D;  2E75 B;  2WPV B;  3EZF A;  5KAW A;  3RK3 E;  2P10 A;  2YMK A;  4R22 B;  4TT3 H;  5GQQ A;  5KKZ C;  3SFD C;  1R8D A;  5E01 A;  1PL5 A;  3Q5R A;  3D70 A;  2NZ2 A;  4LHF A;  2OQQ A;  1RQU A;  3D6Y A;  2VZ4 A;  2H88 C;  1KMI Z;  2E75 C;  4H44 D;  1ZRT E;  4WLW A;  2G8Y A;  3AE5 C;  4WLS A;  2E74 D;  5KAT A;  4R24 B;  4OGQ D;  4H44 B;  2D2C D;  3R8K A;  2FBW C;  1KTM A;  3AE6 C;  3AEG C;  4Y28 J;  3HH0 A;  1R8E A;  1KOR A;  4YTP C;  1Q05 A;  2E74 C;  3ABV C;  3B49 A;  3LUR A;  4OGQ B;  2YIU C;  2HVA A;  1TU3 F;  1FDI A;  1U57 A;  3AE4 C;  3D71 A;  3FGA D;  2ZHH A;  2E76 C;  4AYZ A;  1D5Y A;  1KQF B;  2KCU A;  1JB0 J;  3O6Q A;  1AJY A;  1Q0A A;  3GPV A;  1VF5 D;  3H25 A;  3EZ2 A;  2ZT9 C;  2E74 B;  2G3A A;  1KIL E;  3Q3D A;  2DG6 A;  1IK7 A;  4DCZ A;  2D2C B;  5D8C A;  3G9R A;  4B0Y A;  3AEE C;  4J2N A;  3Q5P A;  3EWK A;  3E0H A;  3AE2 C;  3UCS A;  2QJK C;  3GP4 A;  2WSC J;  4AYZ B;  1WMK A;  1DD4 A;  1VF5 C;  1JYH A;  3EZ9 A;  1GMJ A;  3AE7 C;  3R4Y A;  1ZOY C;  1ZME C;  2WQY C;  2E76 D;  4H0L C;  4IL6 X;  3QAO A;  4U7J A;  2V7Q J;  2JML A;  3GK6 A;  4KT0 J;  1Q06 A;  5KCB A;  3AE3 C;  2WSF J;  3AEF C;  3AE1 C;  1S5L X;  1Q09 A;  2JP3 A;  1PM6 A;  2QIW A;  1VL2 A;  4GDO A;  1RQV A;  3SFE C;  3EZ6 A;  5I41 B;  2QJP C;  2K9Y A;  2WSE J;  3AE9 C;  4R4M A;  1S1C X;  2H89 C;  3S9O A;  2QSI A;  1Q07 A;  2FYN C;  1OW7 A;  3Q5S A;  2IDB A;  5M1B A;  1EXJ A;  3R8J A;  3EZ7 A;  4XFJ A;  1Q90 D;  4I7Z B;  1OMI A;  3LW5 J;  4H0L D;  1K05 A;  5D90 A;  3AEB C;  5I44 A;  3RL0 g;  5KAV A;  3Q1M A;  1PV3 A;  3GMA A;  1PIX A;  4PV1 D;  4H44 C;  2O01 J;  3GF3 A;  2ZHG A;  1YQ4 C;  1NYH A;  1BOW A;  2FXP A;  4OGQ C;  1YQ3 C;  2J5U A;  2JO1 A;  3AEC C;  4I7Z C;  1Y9B A;  2BEQ D;  5L8R J;  1JBG A;  1OW8 A;  1EXI A;  4PV1 B;  1LX8 A;  4YXD C;  3Q2Y A;  1UIX A;  2E76 B;  4H13 B;  5KLI C;  1Q08 A;  4R4E A;  3GF7 A;  2BOW A;  3D6Z A;  3B71 A;  1DD3 A;  2KVV A;  1ZP0 C;  2MKV A;  1DIP A;  3AEA C;  2ZT9 B;  2D2C C;  5KAU A;  1OW6 A;  2GOV A;  3GLM A;  2QJY C;  1Y6U A;  1NGM B;  3C8V A;  2ZT9 D;  1HJ0 A;  4PV1 C;  5KAX A;  4H13 C;  2BEZ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...