3Q5SA

Crystal structure of bmrr bound to acetylcholine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5sA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5sA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5sA03
5E01A 3D70A 4AYZB 5D8CA 2VZ4A 3Q1MA 4B0YA 5KAWA 1Q06A 3GP4A 1DIPA 2GOVA 3QAOA 3G9RA 3LURA 3Q3DA 5KAVA 4R22B 3R8JA 1Q08A 3IAOA 3R8KA 3Q2YA 2J5UA 5GQQA 3Q5RA 5KATA 3Q5SA 3T97B 2HVAA 5KCBA 5I41B 4R4MA 5KAUA 2JMLA 1EXIA 3HH0A 3UCSA 1R8DA 4J2NA 1R8EA 3GPVA 1Q0AA 4R4LA 4R4EA 2OQQA 4WLWA 3Q5PA 1BOWA 1Q05A 2ZHGA 1Q07A 3GK6A 4R24B 5KAXA 5I44A 1JBGA 1D5YA 4A1MA 3D71A 1Q09A 2DG6A 2ZHHA 2KCUA 3E0HA 3D6ZA 2BOWA 4AYZA 1EXJA 3B49A 1JYHA 5D90A 4WLSA 3D6YA
chains in the Genus database with same CATH superfamily
1G1JA 3EQ2A 5D8CA 3GW6A 3HE4B 5KLVE 3H1LE 3TGUJ 4HYTB 3L75J 3K5BA 2K9JB 5AVUB 4Z1MH 3VP8A 4GT1A 2FFDB 1LTIC 3AE5C 3RK2C 3L35A 3V2NA 2H7HA 1ZXGA 3D6YA 1NTMK 1P84E 2QJYC 1E79H 3GMAA 1EDIA 1KILE 2V7QH 3JSVC 1K73Q 1PGPA 3C9IA 1W2BO 4IL6E 4PV1B 1FZEA 1NKZB 4YPCA 3M0DA 4GIFA 4H44D 1SLQA 1ZRTD 4GDOA 1Q90D 1LWUA 5KATA 4Y28J 1KQLA 4WY4D 4U3FG 2WPVB 3RBXA 2A06D 4GODA 2QJPC 2DG6A 1M8OB 1YTZI 4JQ0D 2Q6QA 1G1IA 1KV4A 1NU1J 2Q3EA 3CWBG 4HB1A 1N7SD 4YXDC 1JO5A 3KZIH 3RL0C 2JMLA 1M90Q 1R8DA 2R44A 3P8CD 5CCGC 3O6QB 1LTSC 1SQBD 4ZMDA 4YXWH 5CCHC 1AV1A 1EXJA 2JDIH 1S4XA 1WT6A 3F5HA 4NPFX 4EYYQ 1M7LA 2Y0DA 2BCCE 2MJZA 3CMEP 2B89A 1LWUB 1SP4A 5AVRB 2C9NY 3M0AA 2XDJA 2ZHGA 5KAIE 3O8ZA 1M57D 1NTKE 1Q82Q 1TU3F 3T97A 3HE5B 4EI2A 1ZRTE 3CCVP 1NOHA 1NH4A 2YIUB 1NTKG 1GMJA 2L5GB 4C7RA 1MZ9A 1BOWA 2KIKA 2KVVA 3CLQA 3RK3D 3U59A 2KLVA 3R2PA 4GOFA 3H1LJ 1M1JA 4U3FE 2WPSA 1SQPD 1NWQA 3LW5J 2QSIA 5KKZC 2POHA 5E79E 1L4AC 2KZJA 3V6IA 3M9HA 4GKGA 1ZP0C 3HE4A 4A1MA 2QRXA 3AEBC 3PHLA 5K5GB 5KTBA 3JCUE 4H44B 3Q1MA 1IK9A 4DJGA 1RF1B 2CPSA 1SQVK 1NAYA 1Q81Q 4DT0A 3B71A 2ZVNB 1M1JC 1FZCC 3H1HG 4N78E 3TK1A 1NTZE 3B5NA 4L74A 2OGUA 3BVHA 3GF7A 5KLVD 3CMAP 2W6BA 2JKVA 4C7NA 1VF5D 1DX7A 1JY2P 3KHUA 1H0TA 5AVQB 2IBZI 2W90A 2Q7CA 2R5DA 3CCLP 1E5WA 4H0LC 1KYOI 1Q08A 3B4SA 1L0NK 2IZ0A 3H1KE 1NTMD 4OWFA 2QM7A 2FBWC 4H44C 5KAIH 2QIWA 2PP6A 2OG0A 3CWBE 3SWYA 3NFQA 3AEGC 3HD7A 2WMMA 2QJPB 1OIPA 1M1JB 1HVVA 1JTHA 1MFTA 3BRVB 3D71A 4H0LB 1T3UA 4B86A 1L0LD 1T2KC 1NTZD 5CJ0A 2V4HA 1BGYE 4JBZA 3KPEA 1KMIZ 2G8YA 1DIPA 3L72J 4GOEA 1BCCJ 3MUDC 1YHQP 4HKZH 4MN4C 3QWOC 1LT9B 1SQXD 4H0LD 5APSA 1KILC 1LTBC 2O01N 3JCUH 3TF5A 1Y8AA 1MUUA 2YO2A 4OH8B 4OGQC 3WU2E 2RH0A 5H2FE 5AVWB 1BDDA 1K04A 1IFDA 3OA7A 3GP4A 1HTLC 2OYIA 2PAJA 1OVRA 1HF9A 3IN6A 3I55P 2QE7H 2QEXP 3VOPA 4DCZA 2IFNA 5AVTB 3E0HA 2KS1A 5EFWB 1BCCE 2E76B 1VQPP 5AVSB 5AW2B 3H1JD 4U7JA 1L2PA 1LT1A 1AQ5A 1SQPE 5KAVA 3V2RA 1IZNB 5GQQA 1OZHA 4RO0A 1NTKJ 1LT9C 3EZFA 5AW4B 2HYNA 3VTPC 2FFDC 1SQQJ 3SFDC 1G2CA 1K8AQ 2ZHHA 2HFED 1JUNA 5C39A 1PP9D 1RHZB 3P8CE 1KQGB 3L71E 3H1LD 4BWNA 1N2DC 2XNDH 3LIDA 2XNXA 5AW5B 1GL2C 3AE7C 4I2LC 4W7ZA 2OYHC 2KP8A 5B5EH 2AEFA 4W7YA 2Y9YA 5DJTB 2J59M 3EZ2A 3NTNA 1FDMA 4AYZB 5APUA 4RJTA 1SQQG 1LJ2A 3USSA 3M0DC 2E5TA 1ZMEC 2JJLA 1GK4A 5KLIC 1BSNA 4R24B 2K88A 3HUSC 4QMAA 2IPPA 1L0ND 3NXSA 4ZKPA 3E7KA 1RQUA 5CBOA 1URQA 5AVYB 1LTTC 1L0NG 1SQXE 3Q5SA 1IC2A 2P67A 4U3FD 3A0BE 3N4XA 2PFXA 4I6MC 2IX7C 4L73A 1SQQD 1QL1A 1WMKA 3L74E 1NTMG 2JO1A 3A0HE 4DOJA 2H88C 4WBAA 2N1TA 2IZ1A 3PRJA 1N73A 2WSEJ 3TNUB 1IJDB 3G3ZA 1KC8Q 1HH0A 1KYOH 1SQVD 3L37A 3M9BA 1YJ9P 2HG5D 2E76D 2KYVA 2QJKC 1KB9D 3G4SP 3P8MC 2B9BA 1OVUA 3PJSK 2WTYA 3GK6A 2O01J 1Q86Q 1L0LE 1S5LH 1NTZJ 5H2FH 3L72E 1CI6B 1U7MA 3M06A 5KAWA 5KKZB 1JCCA 2WPRA 4IFDK 3SWKA 2GUVA 3TNUA 3TDKA 3RL0D 3UCSA 4BRYB 1Q0AA 1VF5C 2N9YB 1PZQA 1VQ7P 1OW7A 3H1KD 4K3AA 3CC4P 3CCMP 5M1BA 3S1KA 2YKOA 2E76C 4L76A 2OQQA 1RE3C 2P2UA 1J2JB 3L70D 1HUCA 3L75E 1YJNP 1Y9BA 4WY4B 4PD4E 2VZ4A 2WT7A 2I1KA 5B66E 3LURA 2K9JA 5AW0B 1KTMA 3L70G 1NGMB 3Q2YA 3AECC 4PD4D 1FOSE 2JP3A 1VQ9P 1LWUC 2WSFJ 1USDA 2A06E 1FDIA 1YYCA 2R3CA 2Y9ZA 3A7OA 4JYBA 3SFEC 4IFFA 1NU1K 2BASA 4D6TG 3FXDA 3H1JE 1S1CX 2C9LY 2B87A 3QH9A 4RESB 3C8VA 3CXHH 1YQ3C 1URQB 1ZV8A 3JC22 3EZ9A 1JTHB 2A45G 1MKMA 1JY3P 3CWBD 4WLSA 2AXCA 3FXEA 1VQ8P 3GHGC 4UB6E 3M9QA 2GM4A 4D6TJ 1P84I 4LC1A 1U7JA 4WY4C 1LGHB 2IYOA 1KILD 4WWIA 2O1KA 1BE3J 1SQQK 3A0BH 3CX5D 2E75C 2AEMA 3WUTA 2Z5IA 2GOVA 3RK3B 3O6QA 1H88A 2QM8A 3BCCJ 2ZVOB 4IL6X 4CPGA 3H1ID 1Q05A 1FBMA 2QA4P 5CCGD 4EOTA 1KILB 3HTKB 3L74D 3EZ7A 2ZAEB 3OAKA 3H1HJ 1GW4A 2ZYGA 4M3LA 4XFJA 2P7JA 5AW7B 1BGYJ 3R8KA 3A3YB 1KD1Q 1EXIA 1PPJG 5KAXA 3RK3E 2RN0A 1SQXJ 1R5SA 1A02F 3L72G 2KOGA 1EZVG 2A45I 1DD4A 1Q2NA 1P84D 2XZRA 1JNMA 3TYYA 1VQ6P 1NTZG 1NU1G 1SQXG 2OYOA 1IFIA 1KORA 3FGAD 1VF5B 2LKMA 4PJ0H 1QL2A 2HVAA 3GHGA 3AE4C 2WT7B 1EZVI 3PLNA 2C0XA 3BCCE 3A5TA 2BOWA 2OTJP 1S9KE 2NRGA 2KK7A 4KHXA 1QLED 3KXDA 3BCCD 3BCCG 1QVFO 1EQ7A 3MP7B 1RF0A 3SWFA 1YITP 1X8YA 2Q5UA 4R4LA 2WWWA 3Q5PA 1SQBE 4IFMA 2JR8A 4N6JA 1RF1A 3L73D 1OW6A 2WITA 3AEAC 1NO4A 4K35A 1L0NJ 2BEQD 2E74D 2BCCD 1SQVE 3T97B 3CCUP 1OW8A 2AXTH 3RL0g 5KLIB 3TGUG 4WB4A 4EDFA 3TGUD 3UIAA 3B5NB 1N8RQ 2H8PD 3H1KG 1FZFA 2WPQA 2XKMA 1HJBA 1EZVD 1PP9G 1J1EB 1CSBA 1SQXK 3CCJP 2FXMA 1SVFA 2M3EA 3N7NA 4AYCA 1JMBA 4HH2A 1MFZA 2M8RA 3I56P 5KLVK 2YXQB 3RBZA 2QG4A 1L4AA 2YMKA 3B5ND 1L0LK 1SQBK 1X9VA 1VQKP 1J1DB 1GL2A 3ABVC 3L74G 2LXBA 1JCDA 1NTME 1ZLLA 1K05A 4BXLA 4UB6H 1AQTA 1SFCD 5APTA 3VYIA 3CX5H 1N7SA 1Q07A 1RE4A 2YNYA 1LP1A 1XTGB 3W67A 2YMYA 2FKWB 1BCCG 1YI2P 3LIEA 4O9BA 1KFNA 2ZT9B 2K1AA 3HUSA 5I41B 1X22A 3V2PA 3VMZA 2FXOA 2KCUA 4HJGH 1RY3A 2IDBA 3CI9A 2Q1KA 1BSHA 3CXHI 1SS1A 2KZIA 1OWAA 1H89A 3CCRP 5AVZB 1KQFB 1S9KD 2B88A 1IFJA 3P7KA 1NYHA 1LTJC 3U1CA 2ZFCA 4UB8H 4LGDE 1KN7A 2YKQA 3V2QA 5CHXA 1L0LG 2NPSC 3GG2A 3H1LG 3HD7C 1EDKA 4WVZA 1SFCA 2IBZG 2PRRA 3CD6P 2IEFA 5APQA 4PD4I 3IF4A 3ITKA 4WLWA 4U3FJ 5TISE 5BU8B 1A02J 2ZXXA 3D6ZA 4RKUJ 4DCKA 3B49A 1JYHA 1OMIA 3S9OA 2L91A 4EIJA 2PGDA 3R4YA 3CC2P 2ZYAA 1FC2C 2LXCB 4J2NA 4PD4H 3AE3C 1GL2B 4H13C 1KZUB 3L75D 1VL2A 2M0BA 2Q9IA 4N3YB 2E75D 3TGUE 1VQNP 1RQVA 2YXRB 2NZ2A 1OFCX 1PGOA 3EFFK 1SFCB 1QEXA 3RK2D 1GL2D 1NTKK 3BATA 1Q09A 5CJ4A 1FJPA 1AA0A 3HD7D 3F89A 3GHGB 3H32B 3H1HD 1PV3A 3RK2B 3I5CA 1S72P 1SQQE 2VRSA 2O01H 3MHVA 1Y47A 2RKLA 2IYPA 1IK7A 4I7ZC 1NTZK 2P10A 4R4MA 3B5NC 4PV1C 1FAVA 3AE6C 2WZ7A 1QVGO 4KT0J 3RL0B 2G3AA 5KLVJ 1FZCB 5CMZA 5GTHE 2BEZF 3Q3DA 1NTKD 3CCSP 1FZAA 2WSEH 2KLUA 5CCHD 2ZXEB 4R4EA 3VP9A 5L8RJ 1EC5A 2N1TB 3WUVA 3L75G 1YIJP 2ZT9C 1JMMA 2KI7B 1PFIA 3AE2C 4DZOA 3KDPB 3L73E 1JY3N 2OTLP 2M5AB 2N1TD 2A06G 2YIUC 3S4RA 3CC7P 3AEFC 2Z4EA 2E75B 4C7NB 5CCGA 3P32A 3G9RA 5BVZA 5GTHH 2R5BA 3WU2H 3RGUA 3GPVA 5B5EE 2I8DA 3V5BA 1YTZT 1VPCA 3A0HH 5B66H 2RMZA 1SQBG 3CPWO 3HD7B 1URQD 1YJWP 2NPSB 1M56D 3V4QA 1KILA 4JYCA 1L4AB 1BCCD 1T6AA 3HTKA 1HBWA 1ZOYC 3L72D 3HH0A 3MZWB 1RF0C 1KQSO 3KQGA 3PH0A 1NU1D 2HR3A 1BGYG 2FY8A 1G2CB 3BASA 1FOSF 4XE5B 2KXPB 1RF1C 2HPCA 3AE1C 1AVYA 2HLOA 3PP5A 1N86A 2AEJA 2KS1B 4ZKUA 3M91A 3L71D 1D5YA 2WSFH 1NAFA 1YQ4C 2WQYC 1J1EC 3NMDA 4OGQD 2E42A 1NTMJ 2FYUK 2FYUJ 3D70A 1N7LA 2KNCB 2OARA 3L70E 2GA1A 3MGNA 1IFPA 1HGZA 1SQPG 3A2AA 1D7MA 2O3JA 1NJIQ 2XU6A 5E79H 1OXZA 1Q7YQ 2B87B 1GU5A 3CX5E 4BRYA 5TISH 1PPJE 4OGQB 3EFGA 2OYHB 4AUWA 2J5UA 2CK3H 2OTKE 1DEEG 1FZBA 1R8EA 1FZCA 3LW5H 1KB9H 5GTIE 1XTCC 1SQPK 1LNQA 5E01A 3IFMA 5AVVB 5TJHA 1R5LA 3HUSB 3C1LA 4WY4A 2HODA 2V7QJ 1P84H 1KFMA 5AW1B 1N7SB 4YTPC 1LP1B 5KJ7D 1L4AD 3IAOA 1PGQA 1JB0J 3L73G 2FXPA 3B8EB 1YBKA 1J1DC 5APYA 1AJYA 2BCCG 1VQ4P 3CCQP 2MKVA 3W68A 1MV8A 1PGJA 1M1KQ 4R22B 1HJ0A 5AW8B 3PTZA 1FS0E 1RE4C 1KB9I 2NPSA 2N1TC 3CXHD 4ZNCA 1SFCC 2Y0CA 1VQOP 2IBZE 2KNCA 3ZDMA 2M3BA 1W5CE 2E74B 1U57A 2SPZA 3VMYA 1KYOE 2JWAA 2KSEA 1IO4A 3H1HE 5AW6B 1Q06A 5CBNA 3H1IG 1CZQA 5DJUB 2C0WA 3IR9A 1PIXA 1JM0A 1X79B 1FU1A 2K3RA 3L36A 3FWNA 5APXA 2WSCJ 3VMAA 4IL6H 1VQMP 3WMM0 2ITAA 2J58A 2FYUD 1HGVA 1LTJB 1JOCA 1EDJA 3FX0A 3MD0A 3KZIE 2YKPA 1NKNA 1GW3A 2FYNC 2Q3IA 2OYIC 1VQLP 1SQVJ 3L71J 1FZGA 2HODB 1EZVE 4JPZB 1ZW0A 4Y99C 1JY2O 1CW5A 2K9YA 1T3JA 1H8AA 4PV1D 4ASVA 2O1JA 4KJMA 3G71P 1DEBA 2ZT9D 1QGKB 4I7ZB 2R3SA 1X0TA 1LT9A 1GK6A 1PM6A 1RH5B 3H6PA 2W6JH 3FWLA 4H13D 2W6AA 3H25A 3SSUA 3BRTB 3VMXA 2Z5HA 2WSSH 4D6TE 1BGYD 1GTWA 1VQ5P 1WRGA 1NHLA 3GF3A 1ZR4A 2A45H 2ZYDA 3AEDC 1K9MQ 3L74J 1DD3A 4H13B 1CI6A 5APWA 1QX8A 4TT3H 1HWTC 1BDCA 3E1IA 1BE3E 1AVOA 1N7SC 1GU4A 4LLHA 3II6A 1S3JA 2QJKB 2H43A 1USEA 1PP9J 1BE3D 3E1RA 1URQC 1PL5A 3G6EP 4ASWA 2XV5A 2H89C 1T8ZA 2IBZD 3WUUA 1DH3A 3GLMA 2BCCJ 4PJ0E 5KCBA 1IFNA 2WVRA 3AEEC 2JEEA 3H1JJ 5KAFH 3L73J 2KSJA 1JY2N 2D2CC 1UIXA 2FYUE 5D90A 4B0YA 4IOIH 3L70J 5AVXB 3QAOA 1FJKA 3OW2O 1LTJA 2R32A 3V4WA 1LTGC 3CL3D 4AQRD 1NVOA 1EDLA 1PPJD 3CXHE 1Y6UA 3HE5A 2E74C 3VN0A 1H0TB 2K37A 2QVAA 5AW9B 5KLVG 1LX8A 2HPCB 4NPEA 1L0NE 2W8ZA 2D2CB 3OJAB 2FFDA 1AFOA 4LHFA 5KAUA 2AXTE 2W27A 5I44A 4OVNF 2I1JA 5KAFE 1PP9E 1S5LX 2JWDA 1LTAC 4L75A 3MIWA 3H1JG 2KUBA 2M5AA 2GUSA 3EWKA 2OYHA 1SQBJ 2D2CD 3CX5I 1VDFA 1SQVG 2FYNB 3HRNA 2OYIB 2KB7P 1L0LJ 2P1JA 2N9BA 1W2EA 4W80A 5KJ7C 1OX3A 3H32A 2FYUG 1RE3A 2UWJE 1ZN5A 4N78D 1N73B 2CPBA 1GD2E 5APVA 1GZLA 3CCEP 2ZJSE 2P58A 1FE6A 4Y99B 3H1IJ 3MUDA 5AW3B 4NPDA 1JEKA 1UIIA 2YO3A 2W83C 4C46A 1ZR2A 3AE9C 5BU5A 1IFMA 2WSCH 3MTUE 5KJ7A 1JY3O 3EZ6A 4UB8E 3TSIA 1S2EA 3AE8C 1BE3G 1OVVA 4XA4A 1RH6A 1N73C 1T2KD 3RK3C 1GDTA 2IFMA 4D6TD 4TLFA 1S5LE 4I1LA 2Y0EA 2NPSD 2E5YA 3U1AA 4AYZA 3CWBJ 1KB9E 5GTIH 1Z56A 1SQPJ 2LR2A 3R8JA 3Q5RA 2FYZA 2DW3A 3KYQA 5CCHA 3H1IE 2QJYB 1JBGA 4JF7A 2E43A 4A7PA 3L71G 1NU1E 1FDOA 1KYOD 3H1KJ 3L4FA
chains in the Genus database with same CATH topology
1OMIA 3S9OA 2H89C 3FGAD 5D8CA 1VF5B 4AYZB 3ABVC 5KAWA 2BEZF 3AE1C 3R4YA 3Q3DA 3IAOA 3GF7A 3GLMA 1K05A 1JB0J 2K9YA 2HVAA 5KCBA 4PV1D 3AE4C 2FXPA 3UCSA 1ZMEC 4J2NA 4OGQC 4Z1MH 1Q0AA 3AE3C 4R4EA 1VF5C 3AEEC 5KLIC 2ZHGA 1VF5D 1Q07A 4H13C 4R24B 1D5YA 5L8RJ 1YQ4C 1VL2A 1K04A 2D2CC 2WQYC 2ZT9D 1AJYA 3AE5C 2ZT9C 2BOWA 4I7ZB 1RQUA 1TU3F 1UIXA 4OGQD 2MKVA 5D90A 3GP4A 2E75D 3D6YA 3D70A 1OW7A 2E75C 1RQVA 2QJYC 3GMAA 4B0YA 2GOVA 3QAOA 1ZRTE 4H0LC 4R22B 1KILE 1Q08A 1HJ0A 2NZ2A 3AE2C 5M1BA 1HF9A 1GMJA 2ZT9B 3O6QA 3Q5SA 5I41B 1PM6A 2E76C 3IN6A 4R4LA 4IL6X 1Y6UA 2OQQA 3AE9C 3Q5PA 2E74C 1Q05A 1BOWA 4DCZA 2KVVA 1Q09A 4H13D 3EZ6A 2E74B 2FBWC 1U57A 4H44C 2YIUC 1WMKA 3AE8C 2KCUA 3E0HA 1Y9BA 2QIWA 2OG0A 3H25A 2JO1A 3EZ7A 3AEFC 1LX8A 2E76B 4PV1B 1RH6A 2IDBA 3AEGC 4OGQB 2E75B 1OW6A 2H88C 4XFJA 4U7JA 3AEAC 2VZ4A 4H44D 1Q06A 5KAVA 3LURA 3G9RA 3LW5J 2BEQD 2QSIA 2WSEJ 1KTMA 1NGMB 4GDOA 3R8KA 3Q2YA 2D2CB 2E74D 2J5UA 5KKZC 1Q90D 5GQQA 5KATA 3AECC 4Y28J 3GF3A 3T97B 1OW8A 3RL0g 4LHFA 3EZFA 1EXIA 2JP3A 3AEDC 1R8EA 5KAUA 1KQFB 3GPVA 1PV3A 1NYHA 2WPVB 1ZP0C 4AYZA 2WSFJ 5KAXA 5I44A 1FDIA 2QJPC 4A1MA 3D71A 1DD3A 1PIXA 4H13B 3RK3E 3SFDC 4H0LB 3AEBC 2DG6A 2ZHHA 4TT3H 3SFEC 2E76D 1S5LX 2QJKC 1IK7A 5E01A 4I7ZC 1S1CX 2G3AA 3Q1MA 4H44B 1KQGB 1DD4A 2WSCJ 1KMIZ 2G8YA 1DIPA 4YXDC 3R8JA 3EWKA 3Q5RA 2D2CD 2P10A 3C8VA 1YQ3C 4R4MA 1ZOYC 2IEFA 2JMLA 2V7QJ 3AE7C 3HH0A 1R8DA 3B71A 4WLWA 4PV1C 3GK6A 1JBGA 2YMKA 3AE6C 1PL5A 2O01J 2FYNC 4H0LD 3EZ9A 3D6ZA 4YTPC 1KORA 1MKMA 4RKUJ 1EXJA 3EZ2A 1FDOA 3B49A 4KT0J 1JYHA 4WLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E01 A;  3D70 A;  4AYZ B;  5D8C A;  2VZ4 A;  3Q1M A;  4B0Y A;  5KAW A;  1Q06 A;  3GP4 A;  1DIP A;  2GOV A;  3QAO A;  3G9R A;  3LUR A;  3Q3D A;  5KAV A;  4R22 B;  3R8J A;  1Q08 A;  3IAO A;  3R8K A;  3Q2Y A;  2J5U A;  5GQQ A;  3Q5R A;  5KAT A;  3Q5S A;  3T97 B;  2HVA A;  5KCB A;  5I41 B;  4R4M A;  5KAU A;  2JML A;  1EXI A;  3HH0 A;  3UCS A;  1R8D A;  4J2N A;  1R8E A;  3GPV A;  1Q0A A;  4R4L A;  4R4E A;  2OQQ A;  4WLW A;  3Q5P A;  1BOW A;  1Q05 A;  2ZHG A;  1Q07 A;  3GK6 A;  4R24 B;  5KAX A;  5I44 A;  1JBG A;  1D5Y A;  4A1M A;  3D71 A;  1Q09 A;  2DG6 A;  2ZHH A;  2KCU A;  3E0H A;  3D6Z A;  2BOW A;  4AYZ A;  1EXJ A;  3B49 A;  1JYH A;  5D90 A;  4WLS A;  3D6Y A; 
#chains in the Genus database with same CATH topology
 1G1J A;  3EQ2 A;  5D8C A;  3GW6 A;  3HE4 B;  5KLV E;  3H1L E;  3TGU J;  4HYT B;  3L75 J;  3K5B A;  2K9J B;  5AVU B;  4Z1M H;  3VP8 A;  4GT1 A;  2FFD B;  1LTI C;  3AE5 C;  3RK2 C;  3L35 A;  3V2N A;  2H7H A;  1ZXG A;  3D6Y A;  1NTM K;  1P84 E;  2QJY C;  1E79 H;  3GMA A;  1EDI A;  1KIL E;  2V7Q H;  3JSV C;  1K73 Q;  1PGP A;  3C9I A;  1W2B O;  4IL6 E;  4PV1 B;  1FZE A;  1NKZ B;  4YPC A;  3M0D A;  4GIF A;  4H44 D;  1SLQ A;  1ZRT D;  4GDO A;  1Q90 D;  1LWU A;  5KAT A;  4Y28 J;  1KQL A;  4WY4 D;  4U3F G;  2WPV B;  3RBX A;  2A06 D;  4GOD A;  2QJP C;  2DG6 A;  1M8O B;  1YTZ I;  4JQ0 D;  2Q6Q A;  1G1I A;  1KV4 A;  1NU1 J;  2Q3E A;  3CWB G;  4HB1 A;  1N7S D;  4YXD C;  1JO5 A;  3KZI H;  3RL0 C;  2JML A;  1M90 Q;  1R8D A;  2R44 A;  3P8C D;  5CCG C;  3O6Q B;  1LTS C;  1SQB D;  4ZMD A;  4YXW H;  5CCH C;  1AV1 A;  1EXJ A;  2JDI H;  1S4X A;  1WT6 A;  3F5H A;  4NPF X;  4EYY Q;  1M7L A;  2Y0D A;  2BCC E;  2MJZ A;  3CME P;  2B89 A;  1LWU B;  1SP4 A;  5AVR B;  2C9N Y;  3M0A A;  2XDJ A;  2ZHG A;  5KAI E;  3O8Z A;  1M57 D;  1NTK E;  1Q82 Q;  1TU3 F;  3T97 A;  3HE5 B;  4EI2 A;  1ZRT E;  3CCV P;  1NOH A;  1NH4 A;  2YIU B;  1NTK G;  1GMJ A;  2L5G B;  4C7R A;  1MZ9 A;  1BOW A;  2KIK A;  2KVV A;  3CLQ A;  3RK3 D;  3U59 A;  2KLV A;  3R2P A;  4GOF A;  3H1L J;  1M1J A;  4U3F E;  2WPS A;  1SQP D;  1NWQ A;  3LW5 J;  2QSI A;  5KKZ C;  2POH A;  5E79 E;  1L4A C;  2KZJ A;  3V6I A;  3M9H A;  4GKG A;  1ZP0 C;  3HE4 A;  4A1M A;  2QRX A;  3AEB C;  3PHL A;  5K5G B;  5KTB A;  3JCU E;  4H44 B;  3Q1M A;  1IK9 A;  4DJG A;  1RF1 B;  2CPS A;  1SQV K;  1NAY A;  1Q81 Q;  4DT0 A;  3B71 A;  2ZVN B;  1M1J C;  1FZC C;  3H1H G;  4N78 E;  3TK1 A;  1NTZ E;  3B5N A;  4L74 A;  2OGU A;  3BVH A;  3GF7 A;  5KLV D;  3CMA P;  2W6B A;  2JKV A;  4C7N A;  1VF5 D;  1DX7 A;  1JY2 P;  3KHU A;  1H0T A;  5AVQ B;  2IBZ I;  2W90 A;  2Q7C A;  2R5D A;  3CCL P;  1E5W A;  4H0L C;  1KYO I;  1Q08 A;  3B4S A;  1L0N K;  2IZ0 A;  3H1K E;  1NTM D;  4OWF A;  2QM7 A;  2FBW C;  4H44 C;  5KAI H;  2QIW A;  2PP6 A;  2OG0 A;  3CWB E;  3SWY A;  3NFQ A;  3AEG C;  3HD7 A;  2WMM A;  2QJP B;  1OIP A;  1M1J B;  1HVV A;  1JTH A;  1MFT A;  3BRV B;  3D71 A;  4H0L B;  1T3U A;  4B86 A;  1L0L D;  1T2K C;  1NTZ D;  5CJ0 A;  2V4H A;  1BGY E;  4JBZ A;  3KPE A;  1KMI Z;  2G8Y A;  1DIP A;  3L72 J;  4GOE A;  1BCC J;  3MUD C;  1YHQ P;  4HKZ H;  4MN4 C;  3QWO C;  1LT9 B;  1SQX D;  4H0L D;  5APS A;  1KIL C;  1LTB C;  2O01 N;  3JCU H;  3TF5 A;  1Y8A A;  1MUU A;  2YO2 A;  4OH8 B;  4OGQ C;  3WU2 E;  2RH0 A;  5H2F E;  5AVW B;  1BDD A;  1K04 A;  1IFD A;  3OA7 A;  3GP4 A;  1HTL C;  2OYI A;  2PAJ A;  1OVR A;  1HF9 A;  3IN6 A;  3I55 P;  2QE7 H;  2QEX P;  3VOP A;  4DCZ A;  2IFN A;  5AVT B;  3E0H A;  2KS1 A;  5EFW B;  1BCC E;  2E76 B;  1VQP P;  5AVS B;  5AW2 B;  3H1J D;  4U7J A;  1L2P A;  1LT1 A;  1AQ5 A;  1SQP E;  5KAV A;  3V2R A;  1IZN B;  5GQQ A;  1OZH A;  4RO0 A;  1NTK J;  1LT9 C;  3EZF A;  5AW4 B;  2HYN A;  3VTP C;  2FFD C;  1SQQ J;  3SFD C;  1G2C A;  1K8A Q;  2ZHH A;  2HFE D;  1JUN A;  5C39 A;  1PP9 D;  1RHZ B;  3P8C E;  1KQG B;  3L71 E;  3H1L D;  4BWN A;  1N2D C;  2XND H;  3LID A;  2XNX A;  5AW5 B;  1GL2 C;  3AE7 C;  4I2L C;  4W7Z A;  2OYH C;  2KP8 A;  5B5E H;  2AEF A;  4W7Y A;  2Y9Y A;  5DJT B;  2J59 M;  3EZ2 A;  3NTN A;  1FDM A;  4AYZ B;  5APU A;  4RJT A;  1SQQ G;  1LJ2 A;  3USS A;  3M0D C;  2E5T A;  1ZME C;  2JJL A;  1GK4 A;  5KLI C;  1BSN A;  4R24 B;  2K88 A;  3HUS C;  4QMA A;  2IPP A;  1L0N D;  3NXS A;  4ZKP A;  3E7K A;  1RQU A;  5CBO A;  1URQ A;  5AVY B;  1LTT C;  1L0N G;  1SQX E;  3Q5S A;  1IC2 A;  2P67 A;  4U3F D;  3A0B E;  3N4X A;  2PFX A;  4I6M C;  2IX7 C;  4L73 A;  1SQQ D;  1QL1 A;  1WMK A;  3L74 E;  1NTM G;  2JO1 A;  3A0H E;  4DOJ A;  2H88 C;  4WBA A;  2N1T A;  2IZ1 A;  3PRJ A;  1N73 A;  2WSE J;  3TNU B;  1IJD B;  3G3Z A;  1KC8 Q;  1HH0 A;  1KYO H;  1SQV D;  3L37 A;  3M9B A;  1YJ9 P;  2HG5 D;  2E76 D;  2KYV A;  2QJK C;  1KB9 D;  3G4S P;  3P8M C;  2B9B A;  1OVU A;  3PJS K;  2WTY A;  3GK6 A;  2O01 J;  1Q86 Q;  1L0L E;  1S5L H;  1NTZ J;  5H2F H;  3L72 E;  1CI6 B;  1U7M A;  3M06 A;  5KAW A;  5KKZ B;  1JCC A;  2WPR A;  4IFD K;  3SWK A;  2GUV A;  3TNU A;  3TDK A;  3RL0 D;  3UCS A;  4BRY B;  1Q0A A;  1VF5 C;  2N9Y B;  1PZQ A;  1VQ7 P;  1OW7 A;  3H1K D;  4K3A A;  3CC4 P;  3CCM P;  5M1B A;  3S1K A;  2YKO A;  2E76 C;  4L76 A;  2OQQ A;  1RE3 C;  2P2U A;  1J2J B;  3L70 D;  1HUC A;  3L75 E;  1YJN P;  1Y9B A;  4WY4 B;  4PD4 E;  2VZ4 A;  2WT7 A;  2I1K A;  5B66 E;  3LUR A;  2K9J A;  5AW0 B;  1KTM A;  3L70 G;  1NGM B;  3Q2Y A;  3AEC C;  4PD4 D;  1FOS E;  2JP3 A;  1VQ9 P;  1LWU C;  2WSF J;  1USD A;  2A06 E;  1FDI A;  1YYC A;  2R3C A;  2Y9Z A;  3A7O A;  4JYB A;  3SFE C;  4IFF A;  1NU1 K;  2BAS A;  4D6T G;  3FXD A;  3H1J E;  1S1C X;  2C9L Y;  2B87 A;  3QH9 A;  4RES B;  3C8V A;  3CXH H;  1YQ3 C;  1URQ B;  1ZV8 A;  3JC2 2;  3EZ9 A;  1JTH B;  2A45 G;  1MKM A;  1JY3 P;  3CWB D;  4WLS A;  2AXC A;  3FXE A;  1VQ8 P;  3GHG C;  4UB6 E;  3M9Q A;  2GM4 A;  4D6T J;  1P84 I;  4LC1 A;  1U7J A;  4WY4 C;  1LGH B;  2IYO A;  1KIL D;  4WWI A;  2O1K A;  1BE3 J;  1SQQ K;  3A0B H;  3CX5 D;  2E75 C;  2AEM A;  3WUT A;  2Z5I A;  2GOV A;  3RK3 B;  3O6Q A;  1H88 A;  2QM8 A;  3BCC J;  2ZVO B;  4IL6 X;  4CPG A;  3H1I D;  1Q05 A;  1FBM A;  2QA4 P;  5CCG D;  4EOT A;  1KIL B;  3HTK B;  3L74 D;  3EZ7 A;  2ZAE B;  3OAK A;  3H1H J;  1GW4 A;  2ZYG A;  4M3L A;  4XFJ A;  2P7J A;  5AW7 B;  1BGY J;  3R8K A;  3A3Y B;  1KD1 Q;  1EXI A;  1PPJ G;  5KAX A;  3RK3 E;  2RN0 A;  1SQX J;  1R5S A;  1A02 F;  3L72 G;  2KOG A;  1EZV G;  2A45 I;  1DD4 A;  1Q2N A;  1P84 D;  2XZR A;  1JNM A;  3TYY A;  1VQ6 P;  1NTZ G;  1NU1 G;  1SQX G;  2OYO A;  1IFI A;  1KOR A;  3FGA D;  1VF5 B;  2LKM A;  4PJ0 H;  1QL2 A;  2HVA A;  3GHG A;  3AE4 C;  2WT7 B;  1EZV I;  3PLN A;  2C0X A;  3BCC E;  3A5T A;  2BOW A;  2OTJ P;  1S9K E;  2NRG A;  2KK7 A;  4KHX A;  1QLE D;  3KXD A;  3BCC D;  3BCC G;  1QVF O;  1EQ7 A;  3MP7 B;  1RF0 A;  3SWF A;  1YIT P;  1X8Y A;  2Q5U A;  4R4L A;  2WWW A;  3Q5P A;  1SQB E;  4IFM A;  2JR8 A;  4N6J A;  1RF1 A;  3L73 D;  1OW6 A;  2WIT A;  3AEA C;  1NO4 A;  4K35 A;  1L0N J;  2BEQ D;  2E74 D;  2BCC D;  1SQV E;  3T97 B;  3CCU P;  1OW8 A;  2AXT H;  3RL0 g;  5KLI B;  3TGU G;  4WB4 A;  4EDF A;  3TGU D;  3UIA A;  3B5N B;  1N8R Q;  2H8P D;  3H1K G;  1FZF A;  2WPQ A;  2XKM A;  1HJB A;  1EZV D;  1PP9 G;  1J1E B;  1CSB A;  1SQX K;  3CCJ P;  2FXM A;  1SVF A;  2M3E A;  3N7N A;  4AYC A;  1JMB A;  4HH2 A;  1MFZ A;  2M8R A;  3I56 P;  5KLV K;  2YXQ B;  3RBZ A;  2QG4 A;  1L4A A;  2YMK A;  3B5N D;  1L0L K;  1SQB K;  1X9V A;  1VQK P;  1J1D B;  1GL2 A;  3ABV C;  3L74 G;  2LXB A;  1JCD A;  1NTM E;  1ZLL A;  1K05 A;  4BXL A;  4UB6 H;  1AQT A;  1SFC D;  5APT A;  3VYI A;  3CX5 H;  1N7S A;  1Q07 A;  1RE4 A;  2YNY A;  1LP1 A;  1XTG B;  3W67 A;  2YMY A;  2FKW B;  1BCC G;  1YI2 P;  3LIE A;  4O9B A;  1KFN A;  2ZT9 B;  2K1A A;  3HUS A;  5I41 B;  1X22 A;  3V2P A;  3VMZ A;  2FXO A;  2KCU A;  4HJG H;  1RY3 A;  2IDB A;  3CI9 A;  2Q1K A;  1BSH A;  3CXH I;  1SS1 A;  2KZI A;  1OWA A;  1H89 A;  3CCR P;  5AVZ B;  1KQF B;  1S9K D;  2B88 A;  1IFJ A;  3P7K A;  1NYH A;  1LTJ C;  3U1C A;  2ZFC A;  4UB8 H;  4LGD E;  1KN7 A;  2YKQ A;  3V2Q A;  5CHX A;  1L0L G;  2NPS C;  3GG2 A;  3H1L G;  3HD7 C;  1EDK A;  4WVZ A;  1SFC A;  2IBZ G;  2PRR A;  3CD6 P;  2IEF A;  5APQ A;  4PD4 I;  3IF4 A;  3ITK A;  4WLW A;  4U3F J;  5TIS E;  5BU8 B;  1A02 J;  2ZXX A;  3D6Z A;  4RKU J;  4DCK A;  3B49 A;  1JYH A;  1OMI A;  3S9O A;  2L91 A;  4EIJ A;  2PGD A;  3R4Y A;  3CC2 P;  2ZYA A;  1FC2 C;  2LXC B;  4J2N A;  4PD4 H;  3AE3 C;  1GL2 B;  4H13 C;  1KZU B;  3L75 D;  1VL2 A;  2M0B A;  2Q9I A;  4N3Y B;  2E75 D;  3TGU E;  1VQN P;  1RQV A;  2YXR B;  2NZ2 A;  1OFC X;  1PGO A;  3EFF K;  1SFC B;  1QEX A;  3RK2 D;  1GL2 D;  1NTK K;  3BAT A;  1Q09 A;  5CJ4 A;  1FJP A;  1AA0 A;  3HD7 D;  3F89 A;  3GHG B;  3H32 B;  3H1H D;  1PV3 A;  3RK2 B;  3I5C A;  1S72 P;  1SQQ E;  2VRS A;  2O01 H;  3MHV A;  1Y47 A;  2RKL A;  2IYP A;  1IK7 A;  4I7Z C;  1NTZ K;  2P10 A;  4R4M A;  3B5N C;  4PV1 C;  1FAV A;  3AE6 C;  2WZ7 A;  1QVG O;  4KT0 J;  3RL0 B;  2G3A A;  5KLV J;  1FZC B;  5CMZ A;  5GTH E;  2BEZ F;  3Q3D A;  1NTK D;  3CCS P;  1FZA A;  2WSE H;  2KLU A;  5CCH D;  2ZXE B;  4R4E A;  3VP9 A;  5L8R J;  1EC5 A;  2N1T B;  3WUV A;  3L75 G;  1YIJ P;  2ZT9 C;  1JMM A;  2KI7 B;  1PFI A;  3AE2 C;  4DZO A;  3KDP B;  3L73 E;  1JY3 N;  2OTL P;  2M5A B;  2N1T D;  2A06 G;  2YIU C;  3S4R A;  3CC7 P;  3AEF C;  2Z4E A;  2E75 B;  4C7N B;  5CCG A;  3P32 A;  3G9R A;  5BVZ A;  5GTH H;  2R5B A;  3WU2 H;  3RGU A;  3GPV A;  5B5E E;  2I8D A;  3V5B A;  1YTZ T;  1VPC A;  3A0H H;  5B66 H;  2RMZ A;  1SQB G;  3CPW O;  3HD7 B;  1URQ D;  1YJW P;  2NPS B;  1M56 D;  3V4Q A;  1KIL A;  4JYC A;  1L4A B;  1BCC D;  1T6A A;  3HTK A;  1HBW A;  1ZOY C;  3L72 D;  3HH0 A;  3MZW B;  1RF0 C;  1KQS O;  3KQG A;  3PH0 A;  1NU1 D;  2HR3 A;  1BGY G;  2FY8 A;  1G2C B;  3BAS A;  1FOS F;  4XE5 B;  2KXP B;  1RF1 C;  2HPC A;  3AE1 C;  1AVY A;  2HLO A;  3PP5 A;  1N86 A;  2AEJ A;  2KS1 B;  4ZKU A;  3M91 A;  3L71 D;  1D5Y A;  2WSF H;  1NAF A;  1YQ4 C;  2WQY C;  1J1E C;  3NMD A;  4OGQ D;  2E42 A;  1NTM J;  2FYU K;  2FYU J;  3D70 A;  1N7L A;  2KNC B;  2OAR A;  3L70 E;  2GA1 A;  3MGN A;  1IFP A;  1HGZ A;  1SQP G;  3A2A A;  1D7M A;  2O3J A;  1NJI Q;  2XU6 A;  5E79 H;  1OXZ A;  1Q7Y Q;  2B87 B;  1GU5 A;  3CX5 E;  4BRY A;  5TIS H;  1PPJ E;  4OGQ B;  3EFG A;  2OYH B;  4AUW A;  2J5U A;  2CK3 H;  2OTK E;  1DEE G;  1FZB A;  1R8E A;  1FZC A;  3LW5 H;  1KB9 H;  5GTI E;  1XTC C;  1SQP K;  1LNQ A;  5E01 A;  3IFM A;  5AVV B;  5TJH A;  1R5L A;  3HUS B;  3C1L A;  4WY4 A;  2HOD A;  2V7Q J;  1P84 H;  1KFM A;  5AW1 B;  1N7S B;  4YTP C;  1LP1 B;  5KJ7 D;  1L4A D;  3IAO A;  1PGQ A;  1JB0 J;  3L73 G;  2FXP A;  3B8E B;  1YBK A;  1J1D C;  5APY A;  1AJY A;  2BCC G;  1VQ4 P;  3CCQ P;  2MKV A;  3W68 A;  1MV8 A;  1PGJ A;  1M1K Q;  4R22 B;  1HJ0 A;  5AW8 B;  3PTZ A;  1FS0 E;  1RE4 C;  1KB9 I;  2NPS A;  2N1T C;  3CXH D;  4ZNC A;  1SFC C;  2Y0C A;  1VQO P;  2IBZ E;  2KNC A;  3ZDM A;  2M3B A;  1W5C E;  2E74 B;  1U57 A;  2SPZ A;  3VMY A;  1KYO E;  2JWA A;  2KSE A;  1IO4 A;  3H1H E;  5AW6 B;  1Q06 A;  5CBN A;  3H1I G;  1CZQ A;  5DJU B;  2C0W A;  3IR9 A;  1PIX A;  1JM0 A;  1X79 B;  1FU1 A;  2K3R A;  3L36 A;  3FWN A;  5APX A;  2WSC J;  3VMA A;  4IL6 H;  1VQM P;  3WMM 0;  2ITA A;  2J58 A;  2FYU D;  1HGV A;  1LTJ B;  1JOC A;  1EDJ A;  3FX0 A;  3MD0 A;  3KZI E;  2YKP A;  1NKN A;  1GW3 A;  2FYN C;  2Q3I A;  2OYI C;  1VQL P;  1SQV J;  3L71 J;  1FZG A;  2HOD B;  1EZV E;  4JPZ B;  1ZW0 A;  4Y99 C;  1JY2 O;  1CW5 A;  2K9Y A;  1T3J A;  1H8A A;  4PV1 D;  4ASV A;  2O1J A;  4KJM A;  3G71 P;  1DEB A;  2ZT9 D;  1QGK B;  4I7Z B;  2R3S A;  1X0T A;  1LT9 A;  1GK6 A;  1PM6 A;  1RH5 B;  3H6P A;  2W6J H;  3FWL A;  4H13 D;  2W6A A;  3H25 A;  3SSU A;  3BRT B;  3VMX A;  2Z5H A;  2WSS H;  4D6T E;  1BGY D;  1GTW A;  1VQ5 P;  1WRG A;  1NHL A;  3GF3 A;  1ZR4 A;  2A45 H;  2ZYD A;  3AED C;  1K9M Q;  3L74 J;  1DD3 A;  4H13 B;  1CI6 A;  5APW A;  1QX8 A;  4TT3 H;  1HWT C;  1BDC A;  3E1I A;  1BE3 E;  1AVO A;  1N7S C;  1GU4 A;  4LLH A;  3II6 A;  1S3J A;  2QJK B;  2H43 A;  1USE A;  1PP9 J;  1BE3 D;  3E1R A;  1URQ C;  1PL5 A;  3G6E P;  4ASW A;  2XV5 A;  2H89 C;  1T8Z A;  2IBZ D;  3WUU A;  1DH3 A;  3GLM A;  2BCC J;  4PJ0 E;  5KCB A;  1IFN A;  2WVR A;  3AEE C;  2JEE A;  3H1J J;  5KAF H;  3L73 J;  2KSJ A;  1JY2 N;  2D2C C;  1UIX A;  2FYU E;  5D90 A;  4B0Y A;  4IOI H;  3L70 J;  5AVX B;  3QAO A;  1FJK A;  3OW2 O;  1LTJ A;  2R32 A;  3V4W A;  1LTG C;  3CL3 D;  4AQR D;  1NVO A;  1EDL A;  1PPJ D;  3CXH E;  1Y6U A;  3HE5 A;  2E74 C;  3VN0 A;  1H0T B;  2K37 A;  2QVA A;  5AW9 B;  5KLV G;  1LX8 A;  2HPC B;  4NPE A;  1L0N E;  2W8Z A;  2D2C B;  3OJA B;  2FFD A;  1AFO A;  4LHF A;  5KAU A;  2AXT E;  2W27 A;  5I44 A;  4OVN F;  2I1J A;  5KAF E;  1PP9 E;  1S5L X;  2JWD A;  1LTA C;  4L75 A;  3MIW A;  3H1J G;  2KUB A;  2M5A A;  2GUS A;  3EWK A;  2OYH A;  1SQB J;  2D2C D;  3CX5 I;  1VDF A;  1SQV G;  2FYN B;  3HRN A;  2OYI B;  2KB7 P;  1L0L J;  2P1J A;  2N9B A;  1W2E A;  4W80 A;  5KJ7 C;  1OX3 A;  3H32 A;  2FYU G;  1RE3 A;  2UWJ E;  1ZN5 A;  4N78 D;  1N73 B;  2CPB A;  1GD2 E;  5APV A;  1GZL A;  3CCE P;  2ZJS E;  2P58 A;  1FE6 A;  4Y99 B;  3H1I J;  3MUD A;  5AW3 B;  4NPD A;  1JEK A;  1UII A;  2YO3 A;  2W83 C;  4C46 A;  1ZR2 A;  3AE9 C;  5BU5 A;  1IFM A;  2WSC H;  3MTU E;  5KJ7 A;  1JY3 O;  3EZ6 A;  4UB8 E;  3TSI A;  1S2E A;  3AE8 C;  1BE3 G;  1OVV A;  4XA4 A;  1RH6 A;  1N73 C;  1T2K D;  3RK3 C;  1GDT A;  2IFM A;  4D6T D;  4TLF A;  1S5L E;  4I1L A;  2Y0E A;  2NPS D;  2E5Y A;  3U1A A;  4AYZ A;  3CWB J;  1KB9 E;  5GTI H;  1Z56 A;  1SQP J;  2LR2 A;  3R8J A;  3Q5R A;  2FYZ A;  2DW3 A;  3KYQ A;  5CCH A;  3H1I E;  2QJY B;  1JBG A;  4JF7 A;  2E43 A;  4A7P A;  3L71 G;  1NU1 E;  1FDO A;  1KYO D;  3H1K J;  3L4F A; 
#chains in the Genus database with same CATH homology
 1OMI A;  3S9O A;  2H89 C;  3FGA D;  5D8C A;  1VF5 B;  4AYZ B;  3ABV C;  5KAW A;  2BEZ F;  3AE1 C;  3R4Y A;  3Q3D A;  3IAO A;  3GF7 A;  3GLM A;  1K05 A;  1JB0 J;  2K9Y A;  2HVA A;  5KCB A;  4PV1 D;  3AE4 C;  2FXP A;  3UCS A;  1ZME C;  4J2N A;  4OGQ C;  4Z1M H;  1Q0A A;  3AE3 C;  4R4E A;  1VF5 C;  3AEE C;  5KLI C;  2ZHG A;  1VF5 D;  1Q07 A;  4H13 C;  4R24 B;  1D5Y A;  5L8R J;  1YQ4 C;  1VL2 A;  1K04 A;  2D2C C;  2WQY C;  2ZT9 D;  1AJY A;  3AE5 C;  2ZT9 C;  2BOW A;  4I7Z B;  1RQU A;  1TU3 F;  1UIX A;  4OGQ D;  2MKV A;  5D90 A;  3GP4 A;  2E75 D;  3D6Y A;  3D70 A;  1OW7 A;  2E75 C;  1RQV A;  2QJY C;  3GMA A;  4B0Y A;  2GOV A;  3QAO A;  1ZRT E;  4H0L C;  4R22 B;  1KIL E;  1Q08 A;  1HJ0 A;  2NZ2 A;  3AE2 C;  5M1B A;  1HF9 A;  1GMJ A;  2ZT9 B;  3O6Q A;  3Q5S A;  5I41 B;  1PM6 A;  2E76 C;  3IN6 A;  4R4L A;  4IL6 X;  1Y6U A;  2OQQ A;  3AE9 C;  3Q5P A;  2E74 C;  1Q05 A;  1BOW A;  4DCZ A;  2KVV A;  1Q09 A;  4H13 D;  3EZ6 A;  2E74 B;  2FBW C;  1U57 A;  4H44 C;  2YIU C;  1WMK A;  3AE8 C;  2KCU A;  3E0H A;  1Y9B A;  2QIW A;  2OG0 A;  3H25 A;  2JO1 A;  3EZ7 A;  3AEF C;  1LX8 A;  2E76 B;  4PV1 B;  1RH6 A;  2IDB A;  3AEG C;  4OGQ B;  2E75 B;  1OW6 A;  2H88 C;  4XFJ A;  4U7J A;  3AEA C;  2VZ4 A;  4H44 D;  1Q06 A;  5KAV A;  3LUR A;  3G9R A;  3LW5 J;  2BEQ D;  2QSI A;  2WSE J;  1KTM A;  1NGM B;  4GDO A;  3R8K A;  3Q2Y A;  2D2C B;  2E74 D;  2J5U A;  5KKZ C;  1Q90 D;  5GQQ A;  5KAT A;  3AEC C;  4Y28 J;  3GF3 A;  3T97 B;  1OW8 A;  3RL0 g;  4LHF A;  3EZF A;  1EXI A;  2JP3 A;  3AED C;  1R8E A;  5KAU A;  1KQF B;  3GPV A;  1PV3 A;  1NYH A;  2WPV B;  1ZP0 C;  4AYZ A;  2WSF J;  5KAX A;  5I44 A;  1FDI A;  2QJP C;  4A1M A;  3D71 A;  1DD3 A;  1PIX A;  4H13 B;  3RK3 E;  3SFD C;  4H0L B;  3AEB C;  2DG6 A;  2ZHH A;  4TT3 H;  3SFE C;  2E76 D;  1S5L X;  2QJK C;  1IK7 A;  5E01 A;  4I7Z C;  1S1C X;  2G3A A;  3Q1M A;  4H44 B;  1KQG B;  1DD4 A;  2WSC J;  1KMI Z;  2G8Y A;  1DIP A;  4YXD C;  3R8J A;  3EWK A;  3Q5R A;  2D2C D;  2P10 A;  3C8V A;  1YQ3 C;  4R4M A;  1ZOY C;  2IEF A;  2JML A;  2V7Q J;  3AE7 C;  3HH0 A;  1R8D A;  3B71 A;  4WLW A;  4PV1 C;  3GK6 A;  1JBG A;  2YMK A;  3AE6 C;  1PL5 A;  2O01 J;  2FYN C;  4H0L D;  3EZ9 A;  3D6Z A;  4YTP C;  1KOR A;  1MKM A;  4RKU J;  1EXJ A;  3EZ2 A;  1FDO A;  3B49 A;  4KT0 J;  1JYH A;  4WLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...