3Q5SA

Crystal structure of bmrr bound to acetylcholine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5sA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5sA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5sA03
2GOVA 3R8JA 1Q09A 1Q05A 2BOWA 3Q5RA 5GQQA 3R8KA 4AYZB 1EXIA 5E01A 1JYHA 5KAVA 3D6ZA 3Q3DA 3T97B 5KCBA 3E0HA 4AYZA 4R4EA 4B0YA 1D5YA 1Q08A 3LURA 4WLSA 3Q5PA 2J5UA 4R4MA 1DIPA 3HH0A 5KAWA 2DG6A 3GPVA 5I41B 1JBGA 1Q06A 3IAOA 5D8CA 3Q2YA 3D6YA 5KATA 5KAUA 1Q07A 3QAOA 4R24B 2ZHGA 3Q5SA 1EXJA 4WLWA 3D70A 4A1MA 1BOWA 3D71A 2JMLA 2ZHHA 4J2NA 4R22B 1R8DA 5I44A 5D90A 3Q1MA 1Q0AA 5KAXA 3GP4A 2OQQA 1R8EA 2HVAA 4R4LA 2KCUA 3G9RA 3UCSA 3B49A 2VZ4A 3GK6A
chains in the Genus database with same CATH superfamily
2ZAEB 5KKZC 1VDFA 3BATA 1OZHA 3E0HA 1R5SA 2ZT9C 5AVUB 1FOSE 1KC8Q 1CSBA 2IBZI 1MFTA 3U1CA 1S1CX 3GG2A 3M9BA 1KTMA 3CXHH 1LGHB 2R44A 3JC22 1SFCC 3MZWB 4LGDE 3VYIA 3H1HE 3RK3D 2UWJE 3QWOC 1BDDA 3GHGA 3U59A 3HE4A 2PFXA 4H13B 1K05A 1Q07A 1SQBJ 1RY3A 3AE7C 1SVFA 5KAIE 4J2NA 1QX8A 2WPSA 2KSEA 4Y28J 4AQRD 2HPCB 2A06D 1FJPA 1FZFA 4IL6H 1KYOI 2LKMA 1AFOA 1A02F 1NTZG 3VMZA 2GA1A 2OG0A 2OARA 3V2NA 2KK7A 3D71A 2JMLA 2P2UA 3H1IE 4L74A 2P10A 1KORA 5KLIB 5L8RJ 1YQ4C 1RF1B 1J1DC 1N8RQ 2ZVNB 2O3JA 1SQQJ 1Y6UA 2B89A 2FFDC 3OJAB 4A1MA 3RL0C 1SQVG 1L4AC 4AYCA 2K9YA 3HTKB 3RK3E 3S9OA 1FBMA 5C39A 3R8JA 3UIAA 3AE2C 2FYUJ 1U57A 4EDFA 2ZXEB 3MIWA 3EZ6A 3KYQA 3CCQP 3GPVA 1NU1G 4ZMDA 3Q5SA 2KUBA 1Y47A 1QL1A 3L35A 1JCCA 3TGUD 3Q5RA 3L72D 3M0DC 1NAFA 1RF0A 4LLHA 2E43A 2J59M 3CCUP 1DIPA 3HE5A 5TJHA 1T2KD 1QGKB 2WQYC 1S72P 3B5ND 5CCGC 1PPJG 1Q82Q 1UIXA 1N73A 2RH0A 1JO5A 2Q9IA 2DW3A 2W6BA 1JY3O 1L0ND 1LNQA 3A0BE 1EZVD 1AVOA 5AVXB 4WBAA 3RGUA 1LWUA 5AW1B 3L71D 2BEQD 4A7PA 2VRSA 5APTA 5AW2B 1YI2P 3EWKA 3A3YB 3Q3DA 4C7NA 4B86A 5KLIC 1JBGA 1RF1C 3L74G 2H89C 4N6JA 4JF7A 2M3EA 3L72E 3B5NA 3NTNA 2FYZA 1DEBA 3K5BA 2BCCD 3AEGC 3CX5E 1JEKA 1ZR2A 2IYOA 2Q7CA 3HH0A 3A0HE 2HR3A 1T6AA 2Y0DA 1GU5A 2IEFA 2L5GB 2D2CD 3CX5I 1T3JA 5AW7B 1L0LJ 4ASWA 2H7HA 5AW3B 1LTTC 1L0NE 1EZVE 3GW6A 2KZIA 4DCZA 2KP8A 2OYHB 1QVFO 3L71E 1KYOH 3CC2P 1NTKG 1DEEG 1PGPA 1GL2D 1E79H 1USDA 1RH5B 1CI6B 4JYBA 2WT7B 1LP1A 5KAWA 5AW0B 3HD7D 4YXWH 2E76D 3EZ9A 2QJYC 3CXHD 1OW6A 3M0AA 4ZKUA 4L75A 3H1LG 1IC2A 4M3LA 4AYZB 2K9JA 2ZYGA 4PJ0H 2NZ2A 1K8AQ 1SS1A 1L0NK 3M9QA 1EDLA 1YJNP 1IFJA 4YXDC 3Q2YA 2IX7C 4GOEA 5CJ0A 5GTIE 1OX3A 1M7LA 1W5CE 1ZV8A 4UB6E 1SQBG 2KSJA 2I1KA 5CCHC 3HD7A 3WU2E 1VQ9P 1SP4A 2Q3EA 3H1KE 1EXIA 2OTLP 2JJLA 3TDKA 3CXHE 3QAOA 2KB7P 1FAVA 2KS1B 2MJZA 3IN6A 2OYHC 3D6ZA 3LIDA 4WWIA 1G1JA 1SQQG 3TGUJ 1BE3D 2QIWA 5I41B 3L72J 4HJGH 3A0BH 1M1JC 1H89A 4PD4I 3SWFA 4IL6E 5CBNA 3I56P 1GD2E 1VQ8P 4JQ0D 2KLVA 3AE9C 3PHLA 3TF5A 1W2EA 1D5YA 2P7JA 3BRVB 1RQUA 1NTMD 2JO1A 4PV1B 1FZCB 4IFMA 3H1JG 1L0NJ 1JCDA 2K37A 1LTSC 2PP6A 5AVVB 2WSFJ 5AW9B 1M8OB 2P67A 4H44B 3WUTA 5KAXA 2NPSB 2KNCA 2O01J 2KIKA 2WSCJ 1ZN5A 3FWNA 5KAVA 3L71J 1N7SA 3CWBD 1URQD 3P8MC 1T3UA 2QE7H 2YO3A 1LTAC 3CX5H 5APSA 3A5TA 1HGZA 5KJ7C 5CBOA 2I1JA 2KI7B 3OAKA 3M91A 2R32A 3AE8C 2L91A 2XU6A 5H2FH 1S4XA 2R5BA 4JBZA 1BE3E 2JWAA 3H25A 2Y0EA 2BCCJ 3U1AA 4D6TD 1NKZB 1YIJP 1BCCE 4GODA 5AVTB 1SQXD 3L70D 2HLOA 3HUSA 4WY4A 2IBZD 5BU5A 1NTME 3N7NA 3KDPB 2HODA 3P32A 2LR2A 5AW8B 1KMIZ 3VMYA 2KXPB 5D8CA 3CI9A 4Z1MH 2QEXP 2E74B 3WUUA 5AVYB 1Q2NA 3CWBE 3CPWO 3S1KA 1PGQA 1RE3C 1IFIA 1JMMA 3IF4A 2RMZA 3H1HD 1G1IA 1HTLC 1LT1A 3G3ZA 2QM8A 3RK2D 1R5LA 1KYOD 3L36A 1L0LG 5APYA 1VQNP 1KILC 2FKWB 3CCMP 2K1AA 3ITKA 2CPBA 4BXLA 4PV1C 1FC2C 1FZCC 1JY3P 3RK3B 1VQ7P 1H0TA 1SQPK 4EOTA 5GTIH 1S5LE 2NPSC 1LT9A 1NTMK 3CLQA 1X22A 4R24B 5EFWB 1XTCC 4UB6H 5AVQB 1CZQA 2BASA 2IBZE 3H1ID 3WU2H 4XA4A 1ZRTD 1Y9BA 1M90Q 3L73D 1ZR4A 1AJYA 3MTUE 3T97A 1NVOA 2IPPA 2R3SA 1YHQP 3PTZA 1U7MA 4JPZB 2M5AB 4TLFA 4XFJA 1JB0J 3CL3D 3G4SP 2N9BA 4LHFA 2A06G 2YO2A 1KFNA 3HE5B 1GU4A 1LTJA 4PD4H 2FXOA 1KYOE 1PL5A 1AVYA 1A02J 1ZW0A 2W90A 1N73B 1WMKA 1R8EA 1VF5D 1SQXK 4DOJA 3FXDA 3R8KA 3GLMA 1NHLA 2E74C 2Q6QA 5KATA 1PGJA 1HBWA 3F5HA 4ASVA 1GK4A 1BE3J 3CCVP 2POHA 1ZRTE 4PJ0E 1IK7A 3L73E 2XKMA 2E42A 2HYNA 3I55P 1QEXA 4C7NB 4TT3H 2YXRB 1OFCX 3AEEC 2ITAA 1JY3N 3V2RA 3A7OA 1SQPJ 1VQ5P 1NTMJ 3RK3C 4W80A 4N78E 2WSSH 4C46A 4W7YA 2OGUA 3PLNA 2AEJA 2FFDA 3TGUG 3KPEA 2FY8A 3L72G 4MN4C 3V2QA 4XE5B 3P8CE 3IAOA 1VQLP 1IFMA 1HJ0A 4BRYA 2M3BA 2WSEH 5AW4B 1S9KD 3NXSA 4NPFX 1Q08A 2XNDH 3LW5J 3CX5D 4KJMA 3GMAA 3TSIA 1L0NG 2HFED 3M0DA 4IL6X 4D6TJ 3GF7A 1OVVA 1LP1B 1FZGA 4H13C 4U3FD 1NU1D 1SQXJ 3L70J 5CCGA 1N73C 2QM7A 2K3RA 2WTYA 1IFDA 1PP9G 1H8AA 4OWFA 2D2CB 1NO4A 2K9JB 3L75G 1NTZE 1Y8AA 2V4HA 1JOCA 2QA4P 2C9LY 2BCCG 4B0YA 1FS0E 3C9IA 4OGQD 1JUNA 1GTWA 1S5LH 1JNMA 2B88A 3H1HJ 1KB9I 1FOSF 4DT0A 2P1JA 2WWWA 2IZ0A 1NKNA 1S9KE 1T2KC 1RHZB 1GL2B 2FXPA 2JDIH 2IFMA 5GTHH 1BGYG 1D7MA 3KXDA 3NMDA 2E76B 1OIPA 2J58A 5H2FE 2R5DA 2C0XA 1FDOA 2OQQA 2Y9YA 4U3FE 1NU1E 4K3AA 3O6QA 3H1IJ 3CCSP 3L73J 5KLVD 3CCJP 3D70A 3GF3A 3WUVA 1BSHA 1K9MQ 4CPGA 1G2CB 2OTKE 2ZYAA 2VZ4A 2XNXA 1RE4C 3R4YA 3W67A 1KD1Q 2AXTH 1JYHA 3M9HA 3H1KD 2J5UA 1PPJE 3JSVC 1K04A 1LTBC 1EDJA 1OWAA 1ZOYC 3IFMA 5AVSB 3G9RA 1Z56A 5AW5B 4RKUJ 1S5LX 1NU1K 2D2CC 4L73A 4PD4D 1J1EB 3D6YA 1DD4A 2AEFA 4DJGA 2AEMA 1FZAA 1Q81Q 2Y9ZA 2W6JH 1EDKA 1JMBA 3V5BA 2BOWA 1SLQA 1YJ9P 3L74E 3CCEP 5KLVE 3LURA 3PP5A 5K5GB 3M06A 2E75D 1GL2C 1IFNA 3H1LD 5CCHA 2E76C 4UB8E 1M56D 2RKLA 2OYIA 1XTGB 3FGAD 1JY2P 3H32A 1BE3G 1GW3A 5DJTB 1N2DC 1IFPA 1KQFB 2YXQB 2PAJA 3JCUE 3MUDA 1Q05A 1N7SD 2HODB 2M8RA 4PD4E 1SQBD 1HGVA 2JEEA 1URQB 1USEA 1SQPG 2B87B 5KLVK 1NTMG 2N1TD 3S4RA 1BCCD 1VL2A 2FYUG 1M1JA 4R4EA 1KB9H 1NWQA 5BVZA 1JTHB 4HYTB 4U3FJ 1NU1J 3H1LE 2CK3H 2Q5UA 1QLED 4WY4D 3F89A 3VMAA 2XZRA 3VP8A 1FDMA 1J1EC 1YBKA 3BASA 3I5CA 2ZVOB 3EFGA 2XDJA 1OVRA 1GK6A 4D6TG 1MFZA 2V7QJ 5APVA 2YMYA 2N1TA 3LIEA 4GOFA 1SQBE 1SQXG 3L70G 3VMXA 2A45G 1S2EA 3T97B 5KCBA 1AQ5A 4QMAA 1MUUA 3H1JD 2O1KA 1HUCA 3O8ZA 1PV3A 3RK2B 1BOWA 3KZIE 1GDTA 1HWTC 1JY2N 2WPVB 3PRJA 1GW4A 2JKVA 3SFDC 2JP3A 1LTJB 3GHGB 1KILD 4H0LD 3HE4B 1AV1A 2CPSA 3H1HG 3II6A 2H8PD 1VQ6P 1AA0A 5KLVJ 3G6EP 1URQC 1U7JA 3E1IA 2HG5D 1S3JA 3OA7A 1SQBK 2I8DA 1P84I 1Q06A 3TNUA 5AW6B 1YYCA 1VQKP 3H1KJ 2YKQA 3V4QA 2KYVA 1T8ZA 1IO4A 1KQGB 2ZT9D 1IJDB 5KAFE 2QG4A 1JM0A 2Z4EA 3UCSA 3H1IG 3H1JE 3RBXA 2OYOA 1SFCD 3KQGA 1FU1A 5CHXA 4H44C 1X9VA 2O1JA 1KILA 3V4WA 1FDIA 4L76A 1FZCA 1JY2O 1PM6A 2W6AA 3BCCD 1KQLA 1VF5B 3SSUA 2W83C 1KILE 1KQSO 5GTHE 1Q86Q 4NPDA 1E5WA 1LTIC 1VQ4P 1L0LD 4UB8H 4EI2A 2E74D 4BRYB 1KN7A 2QJKB 1KV4A 4DZOA 4N78D 3H1LJ 5B66E 3RK2C 4KT0J 3JCUH 3B4SA 2WZ7A 2A45I 1N7LA 1Q7YQ 1SFCA 5TISH 1IK9A 3P8CD 3EZFA 1LTJC 3GHGC 1VPCA 3G71P 3QH9A 2AXTE 3TYYA 3AE5C 3RL0D 1KFMA 1YTZT 1L4AD 3MP7B 2XV5A 3CMAP 1LTGC 4HKZH 5B5EE 2QJPB 1LWUB 3BCCE 2YKPA 1R8DA 2KLUA 4C7RA 2Q1KA 3AECC 1HVVA 1BCCJ 1OW8A 1L0LE 1TU3F 2M0BA 2WSEJ 1QL2A 5KAUA 3E1RA 4EYYQ 2G8YA 3AEBC 1Q0AA 3B5NB 3FX0A 1EQ7A 3RBZA 3VP9A 5CCGD 2K88A 1NTZD 2PRRA 1KB9D 1KZUB 2WPRA 1L4AA 3ZDMA 3VN0A 1GMJA 2WPQA 4H13D 1VF5C 3AE4C 3L37A 1K73Q 3CWBJ 3V2PA 1YTZI 1DD3A 4OVNF 2QRXA 3KZIH 2MKVA 3O6QB 4I7ZB 2G3AA 1X8YA 1GZLA 3AEAC 2O01N 4NPEA 2SPZA 5BU8B 4R4MA 4U3FG 1BSNA 2QJKC 3AEDC 4OGQB 1EZVG 1SQVD 1L0LK 1OMIA 3OW2O 3V6IA 1RF0C 3H1JJ 2A06E 5CJ4A 2M5AA 1OW7A 3N4XA 1P84H 3L71G 1VQPP 3BVHA 1FZBA 4GDOA 1CW5A 2FBWC 5APWA 1MV8A 3SFEC 2QJYB 1KB9E 2ZFCA 5KAFH 2HPCA 3CC4P 2QJPC 1LWUC 5AVWB 1M1KQ 2ZYDA 2H88C 4RO0A 5E79H 4BWNA 1PPJD 4WLWA 1AQTA 5D90A 2IDBA 2LXBA 2IZ1A 3LW5H 2GM4A 1RF1A 2C9NY 2C0WA 3CCLP 2YKOA 1SQVE 3B5NC 2DG6A 1PP9D 3HD7B 2H43A 3L75D 5KLVG 3TGUE 1MKMA 2HVAA 3PH0A 5APXA 2A45H 2ZJSE 2YIUB 5GQQA 1OXZA 3HTKA 1HF9A 2NRGA 3BCCJ 3C1LA 1NTZK 3EFFK 2OYIB 3H32B 3L74D 5B66H 3H1KG 1DH3A 1NGMB 2KZJA 1YJWP 4I7ZC 5I44A 1M57D 1NJIQ 2KCUA 3CC7P 4I1LA 4OGQC 1BGYD 2JWDA 4ZKPA 3Q5PA 2YMKA 1VQMP 1BDCA 1RE4A 3TK1A 1SQVK 2E75B 3L4FA 3CMEP 1EZVI 1YQ3C 3WMM0 5B5EH 3BRTB 5KAIH 5CCHD 1M1JB 4IFFA 5AVZB 1YITP 3MD0A 5APUA 1PP9E 1L2PA 1QVGO 3L75E 4GT1A 3SWKA 3B71A 2E5TA 2N9YB 2FXMA 1PZQA 2KNCB 2Y0CA 2BCCE 1NTKD 2QVAA 1N86A 1N7SB 5E01A 4I6MC 4K35A 4RJTA 4WB4A 4YTPC 2RN0A 1NAYA 1ZP0C 4IFDK 2ZHGA 4Y99B 2N1TB 4JYCA 3NFQA 2IFNA 1ZXGA 4ZNCA 1BGYE 2BEZF 3GK6A 3HD7C 3CCRP 3B8EB 1PGOA 1GL2A 4WLSA 3H6PA 1HJBA 3CD6P 2IYPA 4N3YB 2KOGA 1NTZJ 1HH0A 2YIUC 3EZ7A 1WT6A 3MGNA 2OYIC 3HUSB 4WY4B 4DCKA 1NH4A 1Q09A 1BCCG 1W2BO 2P58A 2ZXXA 3EQ2A 5TISE 3VOPA 1VQOP 3MUDC 1WRGA 5CMZA 2OYHA 1NTKE 2E5YA 1SQVJ 5KJ7D 1G2CA 3CXHI 2QSIA 3AEFC 3FWLA 3RL0g 2E75C 3TNUB 4GKGA 4AUWA 2FYNB 1IZNB 2PGDA 3CWBG 1CI6A 2WT7A 3PJSK 2GUVA 3A2AA 3HRNA 3AE1C 4GIFA 1PIXA 4WVZA 2WVRA 2WMMA 3ABVC 1FE6A 4LC1A 1P84D 1X0TA 2GOVA 1H0TB 3W68A 1SQQD 1SQPD 4HB1A 4AYZA 2B9BA 4IOIH 1KILB 4H0LB 1LT9B 2JR8A 4RESB 1Q90D 1EXJA 1N7SC 2ZHHA 1ZMEC 3Q1MA 2FYUD 1EDIA 1NTKK 2Z5IA 5KJ7A 4U7JA 4Y99C 2N1TC 1MZ9A 2IBZG 2YNYA 2W8ZA 5KKZB 3A0HH 2ZT9B 1PP9J 4EIJA 4R4LA 2W27A 2Z5HA 2Q3IA 3L75J 3R2PA 5AVRB 1NOHA 4KHXA 5M1BA 1LX8A 3AE3C 1SFCB 5KTBA 3E7KA 2WSFH 1RQVA 4PV1D 3HUSC 4WY4C 5APQA 2O01H 2WSCH 3L74J 4H44D 1NYHA 1P84E 2NPSD 1SQQE 1SQPE 3SWYA 2KS1A 3KHUA 1FJKA 3USSA 2V7QH 1URQA 2OTJP 1BGYJ 2AXCA 2B87A 2KVVA 3C8VA 2FYUE 4R22B 4O9BA 1RE3A 2FYNC 3IR9A 1FZEA 2R3CA 3P7KA 3FXEA 3BCCG 4OH8B 1ZLLA 1PFIA 1DX7A 1UIIA 5E79E 3L73G 3VTPC 1J1DB 1JTHA 2GUSA 1X79B 4HH2A 3GP4A 4H0LC 2WITA 1J2JB 1LT9C 1EC5A 3B49A 5DJUB 2NPSA 2FFDB 4YPCA 3RL0B 1SQQK 4D6TE 1NTKJ 1L4AB 1OVUA 4I2LC 3AE6C 2LXCB 4W7ZA 1LJ2A 1H88A 1SQXE 3L70E 1RH6A 3EZ2A 3MHVA 2FYUK
chains in the Genus database with same CATH topology
4PV1C 3R8JA 1Q09A 3AE5C 3AEGC 4OGQC 3AE2C 1S5LX 4RKUJ 5KKZC 4TT3H 5KAVA 3E0HA 4R4EA 1U57A 1LX8A 3AE3C 5M1BA 4B0YA 2ZT9C 2D2CC 3Q5PA 3AEEC 3HH0A 3EZ6A 1RQVA 2YMKA 4PV1D 3GPVA 1Q06A 4OGQD 3D6YA 1DD4A 1S1CX 4R24B 3Q5SA 4GDOA 2IEFA 1KTMA 1KQGB 2D2CD 2E75B 2ZT9D 1R8DA 3AE8C 4H44D 1NYHA 1YQ3C 2FBWC 3SFEC 3UCSA 3Q5RA 2BOWA 1Y9BA 3AECC 1EXIA 2QSIA 3AEFC 3RL0g 1OW8A 2FXPA 2QJPC 1AJYA 3H25A 2E75C 3LURA 1DIPA 4DCZA 4H44C 1TU3F 3IAOA 2H88C 2WSEJ 4H13B 1K05A 1Q07A 3QAOA 5KAUA 2KVVA 1FDIA 2E76B 4WLWA 3B71A 2WQYC 3C8VA 2E75D 3AE7C 2V7QJ 3AE1C 1PM6A 4J2NA 4R22B 1HJ0A 2G8YA 5D90A 3AEBC 4XFJA 1Q0AA 2IDBA 1PIXA 4Y28J 1JB0J 1UIXA 3ABVC 2FYNC 1VF5B 1FDOA 2OQQA 3IN6A 2GOVA 1KILE 5E01A 4LHFA 3D6ZA 3T97B 2E76C 3O6QA 5KCBA 4AYZA 4YTPC 4H0LB 1Q08A 3LW5J 5KAWA 3GMAA 2QIWA 2DG6A 5I41B 1KMIZ 1PV3A 2OG0A 1GMJA 1Q90D 5D8CA 1ZP0C 3FGAD 4H13D 1VF5C 1PL5A 3AE4C 2ZHGA 3D70A 2E76D 1EXJA 3GF3A 3EZ9A 2QJYC 1BOWA 1OW6A 3D71A 2JMLA 2ZHHA 2E74D 4Z1MH 4IL6X 1ZMEC 2P10A 3Q1MA 2E74B 1MKMA 1KORA 1KQFB 3GP4A 1WMKA 2WPVB 1DD3A 2BEQD 1R8EA 4H0LC 2HVAA 3GF7A 5L8RJ 1YQ4C 1VF5D 2MKVA 3B49A 2BEZF 3SFDC 2VZ4A 3GK6A 3R4YA 4I7ZB 2G3AA 1Q05A 3R8KA 4AYZB 5GQQA 3EWKA 1HF9A 2NZ2A 3AE9C 2JP3A 1JYHA 3GLMA 3Q3DA 4U7JA 4H13C 3AEAC 4H0LD 1D5YA 3AE6C 4KT0J 4WLSA 2E74C 2J5UA 4R4MA 1RQUA 5KLIC 2JO1A 4YXDC 1JBGA 1K04A 2QJKC 4PV1B 1NGMB 1Y6UA 3AEDC 3Q2YA 4OGQB 5KATA 2H89C 1OMIA 2YIUC 4I7ZC 3EZ7A 4A1MA 2WSFJ 3EZFA 2ZT9B 2D2CB 5I44A 4H44B 1ZOYC 5KAXA 1RH6A 1ZRTE 3EZ2A 2K9YA 4R4LA 2KCUA 1OW7A 1VL2A 1IK7A 2O01J 3RK3E 3S9OA 3G9RA 2WSCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOV A;  3R8J A;  1Q09 A;  1Q05 A;  2BOW A;  3Q5R A;  5GQQ A;  3R8K A;  4AYZ B;  1EXI A;  5E01 A;  1JYH A;  5KAV A;  3D6Z A;  3Q3D A;  3T97 B;  5KCB A;  3E0H A;  4AYZ A;  4R4E A;  4B0Y A;  1D5Y A;  1Q08 A;  3LUR A;  4WLS A;  3Q5P A;  2J5U A;  4R4M A;  1DIP A;  3HH0 A;  5KAW A;  2DG6 A;  3GPV A;  5I41 B;  1JBG A;  1Q06 A;  3IAO A;  5D8C A;  3Q2Y A;  3D6Y A;  5KAT A;  5KAU A;  1Q07 A;  3QAO A;  4R24 B;  2ZHG A;  3Q5S A;  1EXJ A;  4WLW A;  3D70 A;  4A1M A;  1BOW A;  3D71 A;  2JML A;  2ZHH A;  4J2N A;  4R22 B;  1R8D A;  5I44 A;  5D90 A;  3Q1M A;  1Q0A A;  5KAX A;  3GP4 A;  2OQQ A;  1R8E A;  2HVA A;  4R4L A;  2KCU A;  3G9R A;  3UCS A;  3B49 A;  2VZ4 A;  3GK6 A; 
#chains in the Genus database with same CATH topology
 2ZAE B;  5KKZ C;  1VDF A;  3BAT A;  1OZH A;  3E0H A;  1R5S A;  2ZT9 C;  5AVU B;  1FOS E;  1KC8 Q;  1CSB A;  2IBZ I;  1MFT A;  3U1C A;  1S1C X;  3GG2 A;  3M9B A;  1KTM A;  3CXH H;  1LGH B;  2R44 A;  3JC2 2;  1SFC C;  3MZW B;  4LGD E;  3VYI A;  3H1H E;  3RK3 D;  2UWJ E;  3QWO C;  1BDD A;  3GHG A;  3U59 A;  3HE4 A;  2PFX A;  4H13 B;  1K05 A;  1Q07 A;  1SQB J;  1RY3 A;  3AE7 C;  1SVF A;  5KAI E;  4J2N A;  1QX8 A;  2WPS A;  2KSE A;  4Y28 J;  4AQR D;  2HPC B;  2A06 D;  1FJP A;  1FZF A;  4IL6 H;  1KYO I;  2LKM A;  1AFO A;  1A02 F;  1NTZ G;  3VMZ A;  2GA1 A;  2OG0 A;  2OAR A;  3V2N A;  2KK7 A;  3D71 A;  2JML A;  2P2U A;  3H1I E;  4L74 A;  2P10 A;  1KOR A;  5KLI B;  5L8R J;  1YQ4 C;  1RF1 B;  1J1D C;  1N8R Q;  2ZVN B;  2O3J A;  1SQQ J;  1Y6U A;  2B89 A;  2FFD C;  3OJA B;  4A1M A;  3RL0 C;  1SQV G;  1L4A C;  4AYC A;  2K9Y A;  3HTK B;  3RK3 E;  3S9O A;  1FBM A;  5C39 A;  3R8J A;  3UIA A;  3AE2 C;  2FYU J;  1U57 A;  4EDF A;  2ZXE B;  3MIW A;  3EZ6 A;  3KYQ A;  3CCQ P;  3GPV A;  1NU1 G;  4ZMD A;  3Q5S A;  2KUB A;  1Y47 A;  1QL1 A;  3L35 A;  1JCC A;  3TGU D;  3Q5R A;  3L72 D;  3M0D C;  1NAF A;  1RF0 A;  4LLH A;  2E43 A;  2J59 M;  3CCU P;  1DIP A;  3HE5 A;  5TJH A;  1T2K D;  1QGK B;  2WQY C;  1S72 P;  3B5N D;  5CCG C;  1PPJ G;  1Q82 Q;  1UIX A;  1N73 A;  2RH0 A;  1JO5 A;  2Q9I A;  2DW3 A;  2W6B A;  1JY3 O;  1L0N D;  1LNQ A;  3A0B E;  1EZV D;  1AVO A;  5AVX B;  4WBA A;  3RGU A;  1LWU A;  5AW1 B;  3L71 D;  2BEQ D;  4A7P A;  2VRS A;  5APT A;  5AW2 B;  1YI2 P;  3EWK A;  3A3Y B;  3Q3D A;  4C7N A;  4B86 A;  5KLI C;  1JBG A;  1RF1 C;  3L74 G;  2H89 C;  4N6J A;  4JF7 A;  2M3E A;  3L72 E;  3B5N A;  3NTN A;  2FYZ A;  1DEB A;  3K5B A;  2BCC D;  3AEG C;  3CX5 E;  1JEK A;  1ZR2 A;  2IYO A;  2Q7C A;  3HH0 A;  3A0H E;  2HR3 A;  1T6A A;  2Y0D A;  1GU5 A;  2IEF A;  2L5G B;  2D2C D;  3CX5 I;  1T3J A;  5AW7 B;  1L0L J;  4ASW A;  2H7H A;  5AW3 B;  1LTT C;  1L0N E;  1EZV E;  3GW6 A;  2KZI A;  4DCZ A;  2KP8 A;  2OYH B;  1QVF O;  3L71 E;  1KYO H;  3CC2 P;  1NTK G;  1DEE G;  1PGP A;  1GL2 D;  1E79 H;  1USD A;  1RH5 B;  1CI6 B;  4JYB A;  2WT7 B;  1LP1 A;  5KAW A;  5AW0 B;  3HD7 D;  4YXW H;  2E76 D;  3EZ9 A;  2QJY C;  3CXH D;  1OW6 A;  3M0A A;  4ZKU A;  4L75 A;  3H1L G;  1IC2 A;  4M3L A;  4AYZ B;  2K9J A;  2ZYG A;  4PJ0 H;  2NZ2 A;  1K8A Q;  1SS1 A;  1L0N K;  3M9Q A;  1EDL A;  1YJN P;  1IFJ A;  4YXD C;  3Q2Y A;  2IX7 C;  4GOE A;  5CJ0 A;  5GTI E;  1OX3 A;  1M7L A;  1W5C E;  1ZV8 A;  4UB6 E;  1SQB G;  2KSJ A;  2I1K A;  5CCH C;  3HD7 A;  3WU2 E;  1VQ9 P;  1SP4 A;  2Q3E A;  3H1K E;  1EXI A;  2OTL P;  2JJL A;  3TDK A;  3CXH E;  3QAO A;  2KB7 P;  1FAV A;  2KS1 B;  2MJZ A;  3IN6 A;  2OYH C;  3D6Z A;  3LID A;  4WWI A;  1G1J A;  1SQQ G;  3TGU J;  1BE3 D;  2QIW A;  5I41 B;  3L72 J;  4HJG H;  3A0B H;  1M1J C;  1H89 A;  4PD4 I;  3SWF A;  4IL6 E;  5CBN A;  3I56 P;  1GD2 E;  1VQ8 P;  4JQ0 D;  2KLV A;  3AE9 C;  3PHL A;  3TF5 A;  1W2E A;  1D5Y A;  2P7J A;  3BRV B;  1RQU A;  1NTM D;  2JO1 A;  4PV1 B;  1FZC B;  4IFM A;  3H1J G;  1L0N J;  1JCD A;  2K37 A;  1LTS C;  2PP6 A;  5AVV B;  2WSF J;  5AW9 B;  1M8O B;  2P67 A;  4H44 B;  3WUT A;  5KAX A;  2NPS B;  2KNC A;  2O01 J;  2KIK A;  2WSC J;  1ZN5 A;  3FWN A;  5KAV A;  3L71 J;  1N7S A;  3CWB D;  1URQ D;  3P8M C;  1T3U A;  2QE7 H;  2YO3 A;  1LTA C;  3CX5 H;  5APS A;  3A5T A;  1HGZ A;  5KJ7 C;  5CBO A;  2I1J A;  2KI7 B;  3OAK A;  3M91 A;  2R32 A;  3AE8 C;  2L91 A;  2XU6 A;  5H2F H;  1S4X A;  2R5B A;  4JBZ A;  1BE3 E;  2JWA A;  3H25 A;  2Y0E A;  2BCC J;  3U1A A;  4D6T D;  1NKZ B;  1YIJ P;  1BCC E;  4GOD A;  5AVT B;  1SQX D;  3L70 D;  2HLO A;  3HUS A;  4WY4 A;  2IBZ D;  5BU5 A;  1NTM E;  3N7N A;  3KDP B;  2HOD A;  3P32 A;  2LR2 A;  5AW8 B;  1KMI Z;  3VMY A;  2KXP B;  5D8C A;  3CI9 A;  4Z1M H;  2QEX P;  2E74 B;  3WUU A;  5AVY B;  1Q2N A;  3CWB E;  3CPW O;  3S1K A;  1PGQ A;  1RE3 C;  1IFI A;  1JMM A;  3IF4 A;  2RMZ A;  3H1H D;  1G1I A;  1HTL C;  1LT1 A;  3G3Z A;  2QM8 A;  3RK2 D;  1R5L A;  1KYO D;  3L36 A;  1L0L G;  5APY A;  1VQN P;  1KIL C;  2FKW B;  3CCM P;  2K1A A;  3ITK A;  2CPB A;  4BXL A;  4PV1 C;  1FC2 C;  1FZC C;  1JY3 P;  3RK3 B;  1VQ7 P;  1H0T A;  1SQP K;  4EOT A;  5GTI H;  1S5L E;  2NPS C;  1LT9 A;  1NTM K;  3CLQ A;  1X22 A;  4R24 B;  5EFW B;  1XTC C;  4UB6 H;  5AVQ B;  1CZQ A;  2BAS A;  2IBZ E;  3H1I D;  3WU2 H;  4XA4 A;  1ZRT D;  1Y9B A;  1M90 Q;  3L73 D;  1ZR4 A;  1AJY A;  3MTU E;  3T97 A;  1NVO A;  2IPP A;  2R3S A;  1YHQ P;  3PTZ A;  1U7M A;  4JPZ B;  2M5A B;  4TLF A;  4XFJ A;  1JB0 J;  3CL3 D;  3G4S P;  2N9B A;  4LHF A;  2A06 G;  2YO2 A;  1KFN A;  3HE5 B;  1GU4 A;  1LTJ A;  4PD4 H;  2FXO A;  1KYO E;  1PL5 A;  1AVY A;  1A02 J;  1ZW0 A;  2W90 A;  1N73 B;  1WMK A;  1R8E A;  1VF5 D;  1SQX K;  4DOJ A;  3FXD A;  3R8K A;  3GLM A;  1NHL A;  2E74 C;  2Q6Q A;  5KAT A;  1PGJ A;  1HBW A;  3F5H A;  4ASV A;  1GK4 A;  1BE3 J;  3CCV P;  2POH A;  1ZRT E;  4PJ0 E;  1IK7 A;  3L73 E;  2XKM A;  2E42 A;  2HYN A;  3I55 P;  1QEX A;  4C7N B;  4TT3 H;  2YXR B;  1OFC X;  3AEE C;  2ITA A;  1JY3 N;  3V2R A;  3A7O A;  1SQP J;  1VQ5 P;  1NTM J;  3RK3 C;  4W80 A;  4N78 E;  2WSS H;  4C46 A;  4W7Y A;  2OGU A;  3PLN A;  2AEJ A;  2FFD A;  3TGU G;  3KPE A;  2FY8 A;  3L72 G;  4MN4 C;  3V2Q A;  4XE5 B;  3P8C E;  3IAO A;  1VQL P;  1IFM A;  1HJ0 A;  4BRY A;  2M3B A;  2WSE H;  5AW4 B;  1S9K D;  3NXS A;  4NPF X;  1Q08 A;  2XND H;  3LW5 J;  3CX5 D;  4KJM A;  3GMA A;  3TSI A;  1L0N G;  2HFE D;  3M0D A;  4IL6 X;  4D6T J;  3GF7 A;  1OVV A;  1LP1 B;  1FZG A;  4H13 C;  4U3F D;  1NU1 D;  1SQX J;  3L70 J;  5CCG A;  1N73 C;  2QM7 A;  2K3R A;  2WTY A;  1IFD A;  1PP9 G;  1H8A A;  4OWF A;  2D2C B;  1NO4 A;  2K9J B;  3L75 G;  1NTZ E;  1Y8A A;  2V4H A;  1JOC A;  2QA4 P;  2C9L Y;  2BCC G;  4B0Y A;  1FS0 E;  3C9I A;  4OGQ D;  1JUN A;  1GTW A;  1S5L H;  1JNM A;  2B88 A;  3H1H J;  1KB9 I;  1FOS F;  4DT0 A;  2P1J A;  2WWW A;  2IZ0 A;  1NKN A;  1S9K E;  1T2K C;  1RHZ B;  1GL2 B;  2FXP A;  2JDI H;  2IFM A;  5GTH H;  1BGY G;  1D7M A;  3KXD A;  3NMD A;  2E76 B;  1OIP A;  2J58 A;  5H2F E;  2R5D A;  2C0X A;  1FDO A;  2OQQ A;  2Y9Y A;  4U3F E;  1NU1 E;  4K3A A;  3O6Q A;  3H1I J;  3CCS P;  3L73 J;  5KLV D;  3CCJ P;  3D70 A;  3GF3 A;  3WUV A;  1BSH A;  1K9M Q;  4CPG A;  1G2C B;  2OTK E;  2ZYA A;  2VZ4 A;  2XNX A;  1RE4 C;  3R4Y A;  3W67 A;  1KD1 Q;  2AXT H;  1JYH A;  3M9H A;  3H1K D;  2J5U A;  1PPJ E;  3JSV C;  1K04 A;  1LTB C;  1EDJ A;  1OWA A;  1ZOY C;  3IFM A;  5AVS B;  3G9R A;  1Z56 A;  5AW5 B;  4RKU J;  1S5L X;  1NU1 K;  2D2C C;  4L73 A;  4PD4 D;  1J1E B;  3D6Y A;  1DD4 A;  2AEF A;  4DJG A;  2AEM A;  1FZA A;  1Q81 Q;  2Y9Z A;  2W6J H;  1EDK A;  1JMB A;  3V5B A;  2BOW A;  1SLQ A;  1YJ9 P;  3L74 E;  3CCE P;  5KLV E;  3LUR A;  3PP5 A;  5K5G B;  3M06 A;  2E75 D;  1GL2 C;  1IFN A;  3H1L D;  5CCH A;  2E76 C;  4UB8 E;  1M56 D;  2RKL A;  2OYI A;  1XTG B;  3FGA D;  1JY2 P;  3H32 A;  1BE3 G;  1GW3 A;  5DJT B;  1N2D C;  1IFP A;  1KQF B;  2YXQ B;  2PAJ A;  3JCU E;  3MUD A;  1Q05 A;  1N7S D;  2HOD B;  2M8R A;  4PD4 E;  1SQB D;  1HGV A;  2JEE A;  1URQ B;  1USE A;  1SQP G;  2B87 B;  5KLV K;  1NTM G;  2N1T D;  3S4R A;  1BCC D;  1VL2 A;  2FYU G;  1M1J A;  4R4E A;  1KB9 H;  1NWQ A;  5BVZ A;  1JTH B;  4HYT B;  4U3F J;  1NU1 J;  3H1L E;  2CK3 H;  2Q5U A;  1QLE D;  4WY4 D;  3F89 A;  3VMA A;  2XZR A;  3VP8 A;  1FDM A;  1J1E C;  1YBK A;  3BAS A;  3I5C A;  2ZVO B;  3EFG A;  2XDJ A;  1OVR A;  1GK6 A;  4D6T G;  1MFZ A;  2V7Q J;  5APV A;  2YMY A;  2N1T A;  3LIE A;  4GOF A;  1SQB E;  1SQX G;  3L70 G;  3VMX A;  2A45 G;  1S2E A;  3T97 B;  5KCB A;  1AQ5 A;  4QMA A;  1MUU A;  3H1J D;  2O1K A;  1HUC A;  3O8Z A;  1PV3 A;  3RK2 B;  1BOW A;  3KZI E;  1GDT A;  1HWT C;  1JY2 N;  2WPV B;  3PRJ A;  1GW4 A;  2JKV A;  3SFD C;  2JP3 A;  1LTJ B;  3GHG B;  1KIL D;  4H0L D;  3HE4 B;  1AV1 A;  2CPS A;  3H1H G;  3II6 A;  2H8P D;  1VQ6 P;  1AA0 A;  5KLV J;  3G6E P;  1URQ C;  1U7J A;  3E1I A;  2HG5 D;  1S3J A;  3OA7 A;  1SQB K;  2I8D A;  1P84 I;  1Q06 A;  3TNU A;  5AW6 B;  1YYC A;  1VQK P;  3H1K J;  2YKQ A;  3V4Q A;  2KYV A;  1T8Z A;  1IO4 A;  1KQG B;  2ZT9 D;  1IJD B;  5KAF E;  2QG4 A;  1JM0 A;  2Z4E A;  3UCS A;  3H1I G;  3H1J E;  3RBX A;  2OYO A;  1SFC D;  3KQG A;  1FU1 A;  5CHX A;  4H44 C;  1X9V A;  2O1J A;  1KIL A;  3V4W A;  1FDI A;  4L76 A;  1FZC A;  1JY2 O;  1PM6 A;  2W6A A;  3BCC D;  1KQL A;  1VF5 B;  3SSU A;  2W83 C;  1KIL E;  1KQS O;  5GTH E;  1Q86 Q;  4NPD A;  1E5W A;  1LTI C;  1VQ4 P;  1L0L D;  4UB8 H;  4EI2 A;  2E74 D;  4BRY B;  1KN7 A;  2QJK B;  1KV4 A;  4DZO A;  4N78 D;  3H1L J;  5B66 E;  3RK2 C;  4KT0 J;  3JCU H;  3B4S A;  2WZ7 A;  2A45 I;  1N7L A;  1Q7Y Q;  1SFC A;  5TIS H;  1IK9 A;  3P8C D;  3EZF A;  1LTJ C;  3GHG C;  1VPC A;  3G71 P;  3QH9 A;  2AXT E;  3TYY A;  3AE5 C;  3RL0 D;  1KFM A;  1YTZ T;  1L4A D;  3MP7 B;  2XV5 A;  3CMA P;  1LTG C;  4HKZ H;  5B5E E;  2QJP B;  1LWU B;  3BCC E;  2YKP A;  1R8D A;  2KLU A;  4C7R A;  2Q1K A;  3AEC C;  1HVV A;  1BCC J;  1OW8 A;  1L0L E;  1TU3 F;  2M0B A;  2WSE J;  1QL2 A;  5KAU A;  3E1R A;  4EYY Q;  2G8Y A;  3AEB C;  1Q0A A;  3B5N B;  3FX0 A;  1EQ7 A;  3RBZ A;  3VP9 A;  5CCG D;  2K88 A;  1NTZ D;  2PRR A;  1KB9 D;  1KZU B;  2WPR A;  1L4A A;  3ZDM A;  3VN0 A;  1GMJ A;  2WPQ A;  4H13 D;  1VF5 C;  3AE4 C;  3L37 A;  1K73 Q;  3CWB J;  3V2P A;  1YTZ I;  1DD3 A;  4OVN F;  2QRX A;  3KZI H;  2MKV A;  3O6Q B;  4I7Z B;  2G3A A;  1X8Y A;  1GZL A;  3AEA C;  2O01 N;  4NPE A;  2SPZ A;  5BU8 B;  4R4M A;  4U3F G;  1BSN A;  2QJK C;  3AED C;  4OGQ B;  1EZV G;  1SQV D;  1L0L K;  1OMI A;  3OW2 O;  3V6I A;  1RF0 C;  3H1J J;  2A06 E;  5CJ4 A;  2M5A A;  1OW7 A;  3N4X A;  1P84 H;  3L71 G;  1VQP P;  3BVH A;  1FZB A;  4GDO A;  1CW5 A;  2FBW C;  5APW A;  1MV8 A;  3SFE C;  2QJY B;  1KB9 E;  2ZFC A;  5KAF H;  2HPC A;  3CC4 P;  2QJP C;  1LWU C;  5AVW B;  1M1K Q;  2ZYD A;  2H88 C;  4RO0 A;  5E79 H;  4BWN A;  1PPJ D;  4WLW A;  1AQT A;  5D90 A;  2IDB A;  2LXB A;  2IZ1 A;  3LW5 H;  2GM4 A;  1RF1 A;  2C9N Y;  2C0W A;  3CCL P;  2YKO A;  1SQV E;  3B5N C;  2DG6 A;  1PP9 D;  3HD7 B;  2H43 A;  3L75 D;  5KLV G;  3TGU E;  1MKM A;  2HVA A;  3PH0 A;  5APX A;  2A45 H;  2ZJS E;  2YIU B;  5GQQ A;  1OXZ A;  3HTK A;  1HF9 A;  2NRG A;  3BCC J;  3C1L A;  1NTZ K;  3EFF K;  2OYI B;  3H32 B;  3L74 D;  5B66 H;  3H1K G;  1DH3 A;  1NGM B;  2KZJ A;  1YJW P;  4I7Z C;  5I44 A;  1M57 D;  1NJI Q;  2KCU A;  3CC7 P;  4I1L A;  4OGQ C;  1BGY D;  2JWD A;  4ZKP A;  3Q5P A;  2YMK A;  1VQM P;  1BDC A;  1RE4 A;  3TK1 A;  1SQV K;  2E75 B;  3L4F A;  3CME P;  1EZV I;  1YQ3 C;  3WMM 0;  5B5E H;  3BRT B;  5KAI H;  5CCH D;  1M1J B;  4IFF A;  5AVZ B;  1YIT P;  3MD0 A;  5APU A;  1PP9 E;  1L2P A;  1QVG O;  3L75 E;  4GT1 A;  3SWK A;  3B71 A;  2E5T A;  2N9Y B;  2FXM A;  1PZQ A;  2KNC B;  2Y0C A;  2BCC E;  1NTK D;  2QVA A;  1N86 A;  1N7S B;  5E01 A;  4I6M C;  4K35 A;  4RJT A;  4WB4 A;  4YTP C;  2RN0 A;  1NAY A;  1ZP0 C;  4IFD K;  2ZHG A;  4Y99 B;  2N1T B;  4JYC A;  3NFQ A;  2IFN A;  1ZXG A;  4ZNC A;  1BGY E;  2BEZ F;  3GK6 A;  3HD7 C;  3CCR P;  3B8E B;  1PGO A;  1GL2 A;  4WLS A;  3H6P A;  1HJB A;  3CD6 P;  2IYP A;  4N3Y B;  2KOG A;  1NTZ J;  1HH0 A;  2YIU C;  3EZ7 A;  1WT6 A;  3MGN A;  2OYI C;  3HUS B;  4WY4 B;  4DCK A;  1NH4 A;  1Q09 A;  1BCC G;  1W2B O;  2P58 A;  2ZXX A;  3EQ2 A;  5TIS E;  3VOP A;  1VQO P;  3MUD C;  1WRG A;  5CMZ A;  2OYH A;  1NTK E;  2E5Y A;  1SQV J;  5KJ7 D;  1G2C A;  3CXH I;  2QSI A;  3AEF C;  3FWL A;  3RL0 g;  2E75 C;  3TNU B;  4GKG A;  4AUW A;  2FYN B;  1IZN B;  2PGD A;  3CWB G;  1CI6 A;  2WT7 A;  3PJS K;  2GUV A;  3A2A A;  3HRN A;  3AE1 C;  4GIF A;  1PIX A;  4WVZ A;  2WVR A;  2WMM A;  3ABV C;  1FE6 A;  4LC1 A;  1P84 D;  1X0T A;  2GOV A;  1H0T B;  3W68 A;  1SQQ D;  1SQP D;  4HB1 A;  4AYZ A;  2B9B A;  4IOI H;  1KIL B;  4H0L B;  1LT9 B;  2JR8 A;  4RES B;  1Q90 D;  1EXJ A;  1N7S C;  2ZHH A;  1ZME C;  3Q1M A;  2FYU D;  1EDI A;  1NTK K;  2Z5I A;  5KJ7 A;  4U7J A;  4Y99 C;  2N1T C;  1MZ9 A;  2IBZ G;  2YNY A;  2W8Z A;  5KKZ B;  3A0H H;  2ZT9 B;  1PP9 J;  4EIJ A;  4R4L A;  2W27 A;  2Z5H A;  2Q3I A;  3L75 J;  3R2P A;  5AVR B;  1NOH A;  4KHX A;  5M1B A;  1LX8 A;  3AE3 C;  1SFC B;  5KTB A;  3E7K A;  2WSF H;  1RQV A;  4PV1 D;  3HUS C;  4WY4 C;  5APQ A;  2O01 H;  2WSC H;  3L74 J;  4H44 D;  1NYH A;  1P84 E;  2NPS D;  1SQQ E;  1SQP E;  3SWY A;  2KS1 A;  3KHU A;  1FJK A;  3USS A;  2V7Q H;  1URQ A;  2OTJ P;  1BGY J;  2AXC A;  2B87 A;  2KVV A;  3C8V A;  2FYU E;  4R22 B;  4O9B A;  1RE3 A;  2FYN C;  3IR9 A;  1FZE A;  2R3C A;  3P7K A;  3FXE A;  3BCC G;  4OH8 B;  1ZLL A;  1PFI A;  1DX7 A;  1UII A;  5E79 E;  3L73 G;  3VTP C;  1J1D B;  1JTH A;  2GUS A;  1X79 B;  4HH2 A;  3GP4 A;  4H0L C;  2WIT A;  1J2J B;  1LT9 C;  1EC5 A;  3B49 A;  5DJU B;  2NPS A;  2FFD B;  4YPC A;  3RL0 B;  1SQQ K;  4D6T E;  1NTK J;  1L4A B;  1OVU A;  4I2L C;  3AE6 C;  2LXC B;  4W7Z A;  1LJ2 A;  1H88 A;  1SQX E;  3L70 E;  1RH6 A;  3EZ2 A;  3MHV A;  2FYU K; 
#chains in the Genus database with same CATH homology
 4PV1 C;  3R8J A;  1Q09 A;  3AE5 C;  3AEG C;  4OGQ C;  3AE2 C;  1S5L X;  4RKU J;  5KKZ C;  4TT3 H;  5KAV A;  3E0H A;  4R4E A;  1U57 A;  1LX8 A;  3AE3 C;  5M1B A;  4B0Y A;  2ZT9 C;  2D2C C;  3Q5P A;  3AEE C;  3HH0 A;  3EZ6 A;  1RQV A;  2YMK A;  4PV1 D;  3GPV A;  1Q06 A;  4OGQ D;  3D6Y A;  1DD4 A;  1S1C X;  4R24 B;  3Q5S A;  4GDO A;  2IEF A;  1KTM A;  1KQG B;  2D2C D;  2E75 B;  2ZT9 D;  1R8D A;  3AE8 C;  4H44 D;  1NYH A;  1YQ3 C;  2FBW C;  3SFE C;  3UCS A;  3Q5R A;  2BOW A;  1Y9B A;  3AEC C;  1EXI A;  2QSI A;  3AEF C;  3RL0 g;  1OW8 A;  2FXP A;  2QJP C;  1AJY A;  3H25 A;  2E75 C;  3LUR A;  1DIP A;  4DCZ A;  4H44 C;  1TU3 F;  3IAO A;  2H88 C;  2WSE J;  4H13 B;  1K05 A;  1Q07 A;  3QAO A;  5KAU A;  2KVV A;  1FDI A;  2E76 B;  4WLW A;  3B71 A;  2WQY C;  3C8V A;  2E75 D;  3AE7 C;  2V7Q J;  3AE1 C;  1PM6 A;  4J2N A;  4R22 B;  1HJ0 A;  2G8Y A;  5D90 A;  3AEB C;  4XFJ A;  1Q0A A;  2IDB A;  1PIX A;  4Y28 J;  1JB0 J;  1UIX A;  3ABV C;  2FYN C;  1VF5 B;  1FDO A;  2OQQ A;  3IN6 A;  2GOV A;  1KIL E;  5E01 A;  4LHF A;  3D6Z A;  3T97 B;  2E76 C;  3O6Q A;  5KCB A;  4AYZ A;  4YTP C;  4H0L B;  1Q08 A;  3LW5 J;  5KAW A;  3GMA A;  2QIW A;  2DG6 A;  5I41 B;  1KMI Z;  1PV3 A;  2OG0 A;  1GMJ A;  1Q90 D;  5D8C A;  1ZP0 C;  3FGA D;  4H13 D;  1VF5 C;  1PL5 A;  3AE4 C;  2ZHG A;  3D70 A;  2E76 D;  1EXJ A;  3GF3 A;  3EZ9 A;  2QJY C;  1BOW A;  1OW6 A;  3D71 A;  2JML A;  2ZHH A;  2E74 D;  4Z1M H;  4IL6 X;  1ZME C;  2P10 A;  3Q1M A;  2E74 B;  1MKM A;  1KOR A;  1KQF B;  3GP4 A;  1WMK A;  2WPV B;  1DD3 A;  2BEQ D;  1R8E A;  4H0L C;  2HVA A;  3GF7 A;  5L8R J;  1YQ4 C;  1VF5 D;  2MKV A;  3B49 A;  2BEZ F;  3SFD C;  2VZ4 A;  3GK6 A;  3R4Y A;  4I7Z B;  2G3A A;  1Q05 A;  3R8K A;  4AYZ B;  5GQQ A;  3EWK A;  1HF9 A;  2NZ2 A;  3AE9 C;  2JP3 A;  1JYH A;  3GLM A;  3Q3D A;  4U7J A;  4H13 C;  3AEA C;  4H0L D;  1D5Y A;  3AE6 C;  4KT0 J;  4WLS A;  2E74 C;  2J5U A;  4R4M A;  1RQU A;  5KLI C;  2JO1 A;  4YXD C;  1JBG A;  1K04 A;  2QJK C;  4PV1 B;  1NGM B;  1Y6U A;  3AED C;  3Q2Y A;  4OGQ B;  5KAT A;  2H89 C;  1OMI A;  2YIU C;  4I7Z C;  3EZ7 A;  4A1M A;  2WSF J;  3EZF A;  2ZT9 B;  2D2C B;  5I44 A;  4H44 B;  1ZOY C;  5KAX A;  1RH6 A;  1ZRT E;  3EZ2 A;  2K9Y A;  4R4L A;  2KCU A;  1OW7 A;  1VL2 A;  1IK7 A;  2O01 J;  3RK3 E;  3S9O A;  3G9R A;  2WSC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...