3Q5SA

Crystal structure of bmrr bound to acetylcholine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGLGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Multidrug-efflux transporter 1 regulator
publication title Structural contributions to multidrug recognition in the multidrug resistance (MDR) gene regulator, BmrR.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 78
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3q5sA01
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3q5sA02
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 3q5sA03
1Q06A 1EXIA 1Q09A 3Q5RA 2JMLA 1JBGA 4AYZA 2J5UA 3GPVA 2VZ4A 5E01A 4R4EA 4R4LA 2ZHHA 3G9RA 4AYZB 3Q1MA 1BOWA 5GQQA 5KATA 5I44A 5KAXA 2KCUA 1R8DA 3Q5PA 2OQQA 3D70A 4WLWA 3T97B 5KAVA 5KAWA 3B49A 4R22B 1D5YA 4B0YA 1EXJA 3D6ZA 3D71A 5D8CA 5KCBA 3GK6A 1Q07A 3IAOA 3R8KA 3HH0A 3R8JA 1Q08A 3Q2YA 2DG6A 4A1MA 2ZHGA 1DIPA 2HVAA 5D90A 4R24B 3Q3DA 3Q5SA 3E0HA 3UCSA 4WLSA 4R4MA 3D6YA 2BOWA 5KAUA 3GP4A 3LURA 1Q05A 1Q0AA 3QAOA 5I41B 1JYHA 2GOVA 4J2NA 1R8EA
chains in the Genus database with same CATH superfamily
1G2CA 2KNCA 2O01J 4HJGH 1KB9D 3TF5A 4PV1B 3GHGB 1RF0A 3NMDA 3MP7B 5I44A 4OVNF 1NH4A 2K9YA 2NPSA 2WSCH 3RK3D 1H8AA 1EZVI 2AEMA 1S5LE 2KIKA 1ZV8A 1W2BO 1SQQD 1WMKA 3PH0A 1JYHA 2FYUK 2GUVA 1NAYA 4AYZA 4Z1MH 1FZEA 1NTZE 4EIJA 1NU1G 3CCMP 1IFNA 3B5NA 5KLVD 1BGYJ 1GU4A 4H0LD 5BU8B 1N2DC 2QA4P 5GTIE 4NPDA 5B5EE 4H44B 3ZDMA 4C46A 2OYIB 3TGUG 1RQUA 1OMIA 4D6TJ 1KC8Q 3M9QA 1N7SD 1BCCJ 2FXMA 2AEJA 2ZJSE 1P84E 2WQYC 2M3BA 2E75D 3CWBD 1BE3G 5AVSB 1L0NK 1GZLA 1VQPP 4DCKA 1YTZI 3JCUH 4W7ZA 3PRJA 1SQPJ 2IFNA 4ASWA 1JY2P 5EFWB 1PPJD 2IBZI 2A06G 3QH9A 1LTSC 2XNDH 3P32A 1T8ZA 3L73E 3P8CD 2JP3A 5KAXA 1ZRTD 1RY3A 3HE4A 2K1AA 5KLVJ 2WT7B 3H1IE 5KKZC 1RH5B 2LR2A 1R5SA 1OWAA 3CCSP 3MD0A 2KSJA 4TT3H 2LXCB 4PV1D 2Q5UA 4WBAA 3CCLP 1DD3A 1Q81Q 2BEZF 1KQFB 1L0LG 3KZIE 1G1JA 2E42A 5AVQB 3I56P 3CWBJ 2R44A 1Y47A 1FOSE 1X22A 1A02J 1PGQA 2D2CC 1T6AA 3A7OA 5AW8B 1FBMA 1GW3A 1JB0J 1YHQP 1SFCB 3Q1MA 2K37A 1NU1D 3L71E 5CJ4A 3GK6A 2W6BA 2WSEJ 5TJHA 1OXZA 2ZAEB 3GG2A 1S5LH 4J2NA 3QWOC 3CD6P 1FDMA 4H44D 1VF5B 1HH0A 3L72E 1VQKP 3TGUD 1SQVK 1JTHB 2MJZA 1LWUB 3UIAA 1DIPA 1OVUA 3WMM0 1FDOA 2ZYGA 1NWQA 2IZ1A 1EZVE 2VZ4A 5E79H 4I2LC 2HPCA 5GTIH 3WUVA 1FJKA 3IF4A 5DJUB 4AYCA 4C7NB 1OVVA 5APYA 3H1JD 1JY2O 2A06D 2N1TB 1VDFA 2XV5A 1BGYE 3L70G 1P84H 3VMZA 1HGVA 2HYNA 1NU1J 1YI2P 4EI2A 2FYNC 4OGQB 5KLIB 3G6EP 2OTJP 1PV3A 1JMMA 2B88A 3CI9A 1GL2B 2VRSA 2RN0A 4D6TE 2IEFA 1BCCE 4YXDC 4ZMDA 1GW4A 3H1LD 3TGUJ 3A0BH 1KZUB 4CPGA 1KB9E 3S4RA 3G4SP 1L0LD 3CPWO 2C9LY 1OFCX 2R5DA 3RK3E 2W90A 1BE3J 1FS0E 2JJLA 1N73C 1M90Q 3AE7C 3HRNA 1JY3P 1SFCD 2ZFCA 3H1HD 5C39A 5TISE 1TU3F 2YXQB 2JWAA 1VQ4P 2HODA 2FFDB 1AFOA 2W27A 1GK6A 5AW6B 5KLVE 5AW3B 2E74B 1AVYA 2KS1A 3KZIH 2O3JA 2YXRB 2DW3A 3BCCG 1VF5D 1Q86Q 2HFED 1J1DC 1BOWA 2POHA 4HYTB 1FZAA 3GW6A 3H1KD 3AE4C 1KFNA 1PP9D 1EDIA 2A45I 1NVOA 4EOTA 1XTCC 2I1JA 3CWBE 1HBWA 1SQXD 4PJ0H 1YIJP 2I8DA 3D70A 1L0LJ 1IK7A 3EZ2A 2Q1KA 4PD4H 1KQGB 1KQSO 4I7ZC 1N73A 2N1TD 5CCHD 2IX7C 4GDOA 4RJTA 4N78E 3CXHE 4IFDK 5AW9B 4OGQD 3L75D 3EWKA 1DX7A 2YIUC 1Q07A 2SPZA 1ZRTE 3VMAA 3V2PA 1AV1A 3NXSA 1GL2D 1JY2N 3C9IA 1SLQA 2KB7P 4WY4D 4M3LA 3T97A 5KTBA 1LTTC 5APUA 1VQ7P 2E5TA 1URQB 2ZVNB 1SS1A 1QX8A 3EFGA 3CC4P 1L2PA 2QM7A 5KAFE 3LIDA 1RE3C 5GQQA 1KILB 4U3FD 1LTBC 1ZN5A 4GIFA 1ZP0C 4I6MC 2ZHGA 1NU1E 4A7PA 2QG4A 3L70J 2E74D 1SQQG 2CPSA 1X8YA 3O6QB 4L76A 2OYOA 1X9VA 1ZW0A 1LTGC 2W8ZA 3EZ7A 3AEFC 1IFJA 2IPPA 4C7RA 3TGUE 4YXWH 2C9NY 2H89C 1S2EA 3TDKA 4EDFA 4HB1A 2KP8A 1BE3E 1VQ6P 3ITKA 1LTJC 5CCGD 4GT1A 2K88A 1KYOI 3HH0A 3KDPB 1LGHB 1NTMG 3AEBC 1YITP 4PD4D 2LKMA 3WUTA 5AVRB 1JNMA 1VL2A 2A06E 1RE3A 2B9BA 2Q7CA 2RH0A 1NTKG 2E76C 3CMEP 1L4AB 1GTWA 1D5YA 1LT9B 2WVRA 2CK3H 3B5NC 3V4WA 3OA7A 1PPJG 3L74D 3D6YA 3V6IA 3M0AA 4BRYA 2GOVA 2WPSA 5APWA 1ZLLA 3BCCJ 5KLVK 4R4EA 1FZBA 2Q9IA 3D71A 1ZR2A 1URQD 2B87A 3IAOA 2UWJE 3CXHH 3HTKA 3IR9A 1L0LE 3TK1A 3LURA 1IFMA 1HTLC 4AUWA 2AXTE 3PHLA 4IL6X 1HUCA 2QJKC 3AE5C 1KILD 3RK3C 3F89A 1LTJA 3A3YB 5KAIE 1CI6B 3GF7A 1U7MA 3H1HE 2O1KA 4NPFX 2KLUA 1XTGB 1KTMA 3CX5D 5E01A 1FZCB 2OYHB 1KFMA 3L4FA 4H13B 2ITAA 5K5GB 1JY3N 3FXDA 3BVHA 2ZVOB 3C8VA 4H0LC 3R8JA 3SWFA 3KYQA 2V7QJ 1LNQA 2QJPC 4YTPC 2IBZD 3H1KE 3BASA 3AEEC 1IJDB 1FZFA 1GMJA 3A5TA 2IYPA 1Q7YQ 2FY8A 3SSUA 5KCBA 4N3YB 4Y99B 2P7JA 3KQGA 2E75C 1NTMD 1LP1B 1KB9I 3FWLA 4GKGA 5CJ0A 4UB8E 2Z5IA 3HD7B 1NTKD 1N7LA 3FX0A 3L70E 3SWYA 4LC1A 1L4AD 2WSSH 5CBNA 1EXJA 2BEQD 2QRXA 1VQNP 3H1JG 3V2QA 2HVAA 2OARA 2BOWA 3MUDC 1SQQJ 3E7KA 1NU1K 3NTNA 1JCDA 2BCCG 4KT0J 1QL2A 2FYUD 3M9BA 4UB6H 1VQ8P 3EZ9A 3H32B 1NGMB 3W67A 3OW2O 3IN6A 3AE8C 1EDLA 3G71P 1Q09A 4PV1C 3VTPC 2JMLA 3GHGC 5B66E 3AE1C 2I1KA 4IL6E 4XA4A 1KYOE 2W83C 3H1LG 2XU6A 2ZXXA 3TNUA 3HE5A 4BWNA 2R32A 1VQLP 1N7SA 1YBKA 2M0BA 3CLQA 1FU1A 3O8ZA 5AVYB 3C1LA 4U3FE 3S1KA 3MIWA 1NTMJ 2L91A 2R3SA 3RK2B 2A45H 5CBOA 2M8RA 3CCUP 2WZ7A 1NTKJ 1RF1B 2R3CA 4ZKPA 4H13D 1QEXA 1WRGA 2IDBA 3BCCE 3H1HG 3AE3C 2P67A 3W68A 5BVZA 3CXHI 3MUDA 2O01N 2J59M 1NO4A 5KAIH 3A0HE 4H44C 3AE6C 2OYIC 4U7JA 1JUNA 2H7HA 1R8DA 3MZWB 3I5CA 2MKVA 5L8RJ 2ZT9B 1QLED 1JMBA 4BXLA 3H1KG 4WVZA 1GK4A 1H0TA 1AQ5A 1PP9G 2YKQA 3CCRP 2K9JB 1L0LK 3GHGA 3HD7D 1SQXG 1FDIA 4I1LA 1JCCA 5B5EH 2Z4EA 1T2KD 1PGPA 1CZQA 2FKWB 2GUSA 5AW5B 5KJ7D 1U7JA 2M3EA 1Q90D 3EQ2A 3HUSB 1K8AQ 2BCCD 3M9HA 1R5LA 2W6AA 3P8MC 3L75G 1BSNA 2GM4A 3R4YA 2OYIA 1X79B 1UIIA 1SP4A 1QVGO 4WY4B 1NKNA 3Q5PA 3L36A 1M1JB 4IFMA 1KILE 2DG6A 3RK2D 2Q6QA 1SQVD 1LTIC 3VMXA 1EXIA 1AA0A 1SFCC 1OIPA 5GTHE 1SQQE 4U3FG 3CX5E 2KLVA 5B66H 4IL6H 1LX8A 1KYOH 2M5AB 4IFFA 3H1JJ 2KSEA 5APTA 2YMKA 2QEXP 1VF5C 3E1IA 2N9BA 2BCCJ 1J1EB 2KCUA 1SQBD 2ZT9D 2WT7A 2KVVA 1LWUC 2YO3A 2ZYAA 5AVVB 1NTZD 1OW7A 1N8RQ 2KZIA 2QE7H 1NTME 3H1LJ 3MHVA 1VQOP 2YKOA 1Z56A 3KHUA 1E5WA 1NTKE 5AW7B 2WSFJ 2N1TC 3WU2E 5CCHC 1Q05A 2O01H 1PPJE 1G2CB 2KNCB 1SFCA 1IFIA 4ASVA 2Y9YA 1P84D 1PL5A 5KAWA 3H1HJ 3PP5A 3JC22 4OGQC 4YPCA 5KLIC 2NPSB 3P8CE 2WWWA 1LT1A 1AVOA 3RL0B 1GL2C 5BU5A 4QMAA 3L74G 5KAUA 1FJPA 3Q5RA 1S72P 4DZOA 4AYZB 1QVFO 2QJYB 1LJ2A 1JTHA 2Q3IA 2V7QH 1LWUA 1E79H 3H1KJ 3L73D 1PP9J 4ZKUA 1JM0A 1EDKA 3AEDC 2CPBA 3PTZA 3USSA 3OJAB 1SQXJ 4WWIA 3AE9C 3H1ID 3H25A 1JY3O 4C7NA 1HJ0A 4O9BA 3V2RA 3B8EB 2FFDC 2N1TA 2KZJA 2E74C 5CCHA 1Y6UA 1KB9H 1FAVA 2HG5D 1YJ9P 2AXCA 4DT0A 3CCVP 4GOEA 1SQPG 3L75J 1NKZB 1GL2A 1W2EA 1BSHA 2B89A 5TISH 2IBZG 2RMZA 3L71D 2QIWA 5CCGC 3HE4B 1OW6A 3L72D 2Y0DA 2QJPB 3M06A 1NAFA 4OH8B 3H1JE 3EFFK 2HR3A 4U3FJ 3CCJP 3L37A 3B49A 3LIEA 1SQQK 4WB4A 2NPSD 2BCCE 3JSVC 1K05A 2FFDA 1G1IA 3RL0D 1Q08A 5AVTB 1EZVD 2IZ0A 3UCSA 2YMYA 5CHXA 1IK9A 3CC2P 2G8YA 4L75A 5KAVA 2C0XA 1RQVA 2FYUG 1URQC 3H1LE 4LLHA 1JOCA 1BGYD 2WSEH 2ZXEB 3B5ND 4HKZH 4EYYQ 3CCQP 2QSIA 2BASA 2R5BA 1JBGA 1KILC 2KK7A 1NTMK 4RO0A 5CCGA 4R22B 4D6TD 1Y8AA 1BCCD 1T3JA 5KKZB 4KHXA 1EDJA 1NTKK 4Y28J 2YO2A 1W5CE 2Z5HA 1JO5A 2FXPA 1KN7A 1UIXA 2V4HA 2HPCB 2IFMA 4WLWA 2KXPB 1GDTA 1SQPD 2Y0EA 5KAFH 3AEAC 3KXDA 1L0NG 3L74J 1MUUA 1SQBE 3Q5SA 1AJYA 2FXOA 4B86A 2YKPA 3TYYA 5AW4B 1M7LA 5AVXB 1PFIA 2KOGA 2D2CB 3EZFA 4HH2A 1QGKB 1PGJA 3AECC 1PP9E 5KATA 1S4XA 4JBZA 1NOHA 2KYVA 1URQA 1N7SC 1SQXE 2JEEA 3S9OA 5H2FE 3VP9A 5E79E 4A1MA 1GU5A 3IFMA 3U59A 1PZQA 1S3JA 3VP8A 1R8EA 1QL1A 1VQ5P 2J5UA 1KILA 3G9RA 2JWDA 1L4AC 4W80A 1JEKA 1LT9C 3U1CA 4RESB 1IZNB 1M8OB 2JKVA 3N7NA 1Q0AA 3L75E 3CX5I 3MTUE 3O6QA 1DEBA 2E5YA 4LHFA 1KORA 1NHLA 1YJWP 1NYHA 3R8KA 3PJSK 4N78D 2XKMA 2HODB 3A0BE 1M56D 4WLSA 4DOJA 3CXHD 3SFEC 2NZ2A 3M91A 4JPZB 2OG0A 1VPCA 2KS1B 3L35A 3VN0A 1S9KD 1Q82Q 5AW1B 2H43A 3LW5J 2FYNB 2OTLP 5APXA 1NJIQ 1KMIZ 2KI7B 3FWNA 1ZR4A 4K3AA 3GF3A 3GP4A 2N9YB 1SQVG 1ZMEC 1FZCC 2OYHC 2A45G 2WPRA 4H13C 1RE4C 1L4AA 1LT9A 3TSIA 2AXTH 4W7YA 2WSFH 1T3UA 4GODA 1L0ND 1IC2A 3Q3DA 3GMAA 3BATA 1N73B 3RL0g 2D2CD 3GPVA 4JF7A 1S1CX 2FYZA 2FYUJ 1OVRA 2FBWC 1SQBG 4Y99C 3CMAP 4KJMA 2GA1A 1HGZA 4PJ0E 3NFQA 2Q3EA 3MGNA 3RBZA 1NTZG 1DH3A 3KPEA 3HD7C 3K5BA 3OAKA 3GLMA 4PD4E 1J1DB 1YYCA 3T97B 1X0TA 2E43A 1T2KC 3V5BA 1EQ7A 2AEFA 1CI6A 2WSCJ 5KJ7C 2WPVB 5APVA 1BE3D 3V2NA 1FOSF 1KD1Q 5APSA 3CCEP 5H2FH 1FZCA 2OYHA 1KQLA 3L74E 4JYCA 1IFDA 1RE4A 3R2PA 2P2UA 4UB8H 1L0NJ 3VYIA 3SWKA 5D90A 5AW0B 3E0HA 2L5GB 4I7ZB 4MN4C 5I41B 1SQBK 1SVFA 2P58A 2WITA 3CC7P 4IOIH 1M1KQ 1NTZK 1OW8A 2WPQA 2YIUB 1LP1A 3RK2C 3L73G 5CMZA 1SQXK 2HLOA 2KUBA 2QM8A 1HWTC 2NRGA 2YNYA 5DJTB 3II6A 3HD7A 1RF1C 3H1IG 1VQ9P 4B0YA 5KJ7A 1N86A 3Q2YA 1BDDA 1SQPE 1YJNP 3B4SA 2LXBA 1GD2E 2P10A 1MFZA 4L73A 5AVZB 4JYBA 2IBZE 1YQ3C 1ZXGA 2ZT9C 2QVAA 2PGDA 3B71A 5D8CA 3H32A 1PIXA 2XZRA 1YTZT 4DJGA 4BRYB 3L71G 3CL3D 1HVVA 1K9MQ 1MKMA 3U1AA 1USEA 1PM6A 3SFDC 3A0HH 1MV8A 2B87B 4GOFA 2ZYDA 2H88C 4XFJA 1H89A 3L72G 3HTKB 1SQVJ 2JO1A 1USDA 3HUSC 1RF1A 1IFPA 1PGOA 2PRRA 1LTJB 1RHZB 1Y9BA 2FYUE 1EZVG 3WUUA 3L70D 3H6PA 4NPEA 4RKUJ 1BDCA 2K3RA 3I55P 4R4LA 4WY4C 1AQTA 1H88A 1M1JC 2E76B 1SQBJ 1S9KE 2OGUA 2PFXA 3B5NB 1BGYG 1NTZJ 3AEGC 2K9JA 4OWFA 4N6JA 5M1BA 3VMYA 1Q06A 3VOPA 3A2AA 2H8PD 3ABVC 1WT6A 1A02F 4D6TG 1HF9A 1CSBA 2JR8A 1BCCG 1KYOD 1K04A 3HUSA 1L0NE 1IO4A 1P84I 1EC5A 1J1EC 3BRVB 2QJKB 1U57A 1K73Q 1ZOYC 3RK3B 2JDIH 2PAJA 3V4QA 1FC2C 2P1JA 2C0WA 3E1RA 1S5LX 1DEEG 5GTHH 1OZHA 4K35A 3N4XA 3M0DC 1MFTA 4R24B 2WMMA 1OX3A 3CX5H 1RH6A 3BCCD 2PP6A 4WY4A 1J2JB 2O1JA 4AQRD 3EZ6A 1M1JA 4DCZA 1HJBA 2W6JH 3D6ZA 5KLVG 4H0LB 3L73J 4JQ0D 1DD4A 3JCUE 3BRTB 2Y9ZA 2XDJA 3P7KA 3G3ZA 3LW5H 2J58A 1RF0C 3H1IJ 1M57D 1YQ4C 4XE5B 3TNUB 4LGDE 2NPSC 3HE5B 3RGUA 2M5AA 1N7SB 3RBXA 2Y0CA 3RL0C 2E75B 1LTAC 3CWBG 2WTYA 3F5HA 4L74A 1SQPK 1MZ9A 4UB6E 2IYOA 3WU2H 2OQQA 2QJYC 2E76D 4ZNCA 1CW5A 4TLFA 3AE2C 2OTKE 1VQMP 5AVWB 3M0DA 4R4MA 5APQA 1KV4A 1FE6A 3L71J 3FXEA 2RKLA 5AVUB 1D7MA 1FZGA 2ZHHA 1SQVE 2XNXA 3FGAD 5AW2B 4PD4I 3L72J 2G3AA 1Q2NA 3PLNA 3QAOA 1H0TB
chains in the Genus database with same CATH topology
4H44C 1RH6A 1EXIA 2O01J 3Q5RA 1ZMEC 2D2CB 3EZFA 3AE6C 4PV1B 1VF5D 2VZ4A 4R4EA 4U7JA 2JP3A 3AECC 4AYZB 4H13C 1BOWA 5GQQA 5I44A 5KATA 5KAXA 1R8DA 2K9YA 3EZ6A 4DCZA 2MKVA 3B49A 5L8RJ 2ZT9B 1EXJA 3D6ZA 3D71A 1ZP0C 1K05A 1LX8A 1OW8A 3IAOA 2BEQD 3S9OA 5KKZC 4H0LB 1Q08A 1Y9BA 4A1MA 2ZHGA 3AE4C 2HVAA 1DD4A 3Q3DA 3UCSA 2BOWA 3GMAA 1WMKA 3LURA 4TT3H 2E74D 2YMKA 1R8EA 1JYHA 3AEDC 3RL0g 1VF5C 4RKUJ 2D2CD 4AYZA 2J5UA 3GPVA 4PV1D 4IL6X 4Z1MH 2QJKC 4R4LA 3AE5C 3G9RA 1S1CX 3AE9C 4KT0J 3EZ7A 3AEFC 2G8YA 1YQ4C 2KCUA 3H25A 1DD3A 1FDIA 3D70A 5KAVA 2FYNC 2E76B 1RQVA 1HJ0A 2BEZF 4OGQB 2FBWC 2ZT9D 4B0YA 1KQFB 1IK7A 3EZ2A 2KVVA 1PV3A 3GF7A 3EZ9A 3Q2YA 4H0LD 1NGMB 1KQGB 2E75B 2H89C 4I7ZC 3IN6A 2E74C 1Q90D 1Y6UA 3AEGC 1Q0AA 1OW7A 3AE8C 3O6QA 2IEFA 2P10A 2QSIA 4GDOA 5M1BA 1Q06A 4LHFA 2D2CC 4YXDC 1Q09A 4PV1C 4H44B 2JMLA 1KTMA 1JBGA 3AE1C 5E01A 1JB0J 3GLMA 3ABVC 3Q1MA 1RQUA 1KORA 4H13B 1NYHA 1OMIA 2OQQA 3T97B 2QJYC 1YQ3C 2ZT9C 2E76D 4R22B 4OGQD 3B71A 5D8CA 3AE2C 3C8VA 3EWKA 1HF9A 2YIUC 1Q07A 3GK6A 4H0LC 2WSCJ 3R8KA 1PIXA 3HH0A 3R8JA 1ZRTE 2WSEJ 2V7QJ 2WQYC 2WPVB 3R4YA 2WSFJ 3RK3E 2E75D 3AEBC 4WLSA 4R4MA 4Y28J 2QJPC 1Q05A 1K04A 4YTPC 3SFEC 2NZ2A 3AE7C 4J2NA 2OG0A 2FXPA 1VL2A 4H44D 1VF5B 3AEEC 1UIXA 2QIWA 2ZHHA 1MKMA 3Q5PA 1U57A 2E76C 1GMJA 4H13D 4WLWA 1PL5A 3LW5J 1PM6A 1ZOYC 5KAWA 2IDBA 4OGQC 3SFDC 1D5YA 5KLIC 1TU3F 1KMIZ 3AE3C 5KCBA 3AEAC 3FGAD 1S5LX 1KILE 2E75C 2DG6A 1DIPA 2H88C 1OW6A 2G3AA 5D90A 4R24B 4XFJA 3Q5SA 3E0HA 1AJYA 3D6YA 1FDOA 5KAUA 4I7ZB 3GF3A 3GP4A 2E74B 5I41B 3QAOA 2JO1A 2GOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q06 A;  1EXI A;  1Q09 A;  3Q5R A;  2JML A;  1JBG A;  4AYZ A;  2J5U A;  3GPV A;  2VZ4 A;  5E01 A;  4R4E A;  4R4L A;  2ZHH A;  3G9R A;  4AYZ B;  3Q1M A;  1BOW A;  5GQQ A;  5KAT A;  5I44 A;  5KAX A;  2KCU A;  1R8D A;  3Q5P A;  2OQQ A;  3D70 A;  4WLW A;  3T97 B;  5KAV A;  5KAW A;  3B49 A;  4R22 B;  1D5Y A;  4B0Y A;  1EXJ A;  3D6Z A;  3D71 A;  5D8C A;  5KCB A;  3GK6 A;  1Q07 A;  3IAO A;  3R8K A;  3HH0 A;  3R8J A;  1Q08 A;  3Q2Y A;  2DG6 A;  4A1M A;  2ZHG A;  1DIP A;  2HVA A;  5D90 A;  4R24 B;  3Q3D A;  3Q5S A;  3E0H A;  3UCS A;  4WLS A;  4R4M A;  3D6Y A;  2BOW A;  5KAU A;  3GP4 A;  3LUR A;  1Q05 A;  1Q0A A;  3QAO A;  5I41 B;  1JYH A;  2GOV A;  4J2N A;  1R8E A; 
#chains in the Genus database with same CATH topology
 1G2C A;  2KNC A;  2O01 J;  4HJG H;  1KB9 D;  3TF5 A;  4PV1 B;  3GHG B;  1RF0 A;  3NMD A;  3MP7 B;  5I44 A;  4OVN F;  1NH4 A;  2K9Y A;  2NPS A;  2WSC H;  3RK3 D;  1H8A A;  1EZV I;  2AEM A;  1S5L E;  2KIK A;  1ZV8 A;  1W2B O;  1SQQ D;  1WMK A;  3PH0 A;  1JYH A;  2FYU K;  2GUV A;  1NAY A;  4AYZ A;  4Z1M H;  1FZE A;  1NTZ E;  4EIJ A;  1NU1 G;  3CCM P;  1IFN A;  3B5N A;  5KLV D;  1BGY J;  1GU4 A;  4H0L D;  5BU8 B;  1N2D C;  2QA4 P;  5GTI E;  4NPD A;  5B5E E;  4H44 B;  3ZDM A;  4C46 A;  2OYI B;  3TGU G;  1RQU A;  1OMI A;  4D6T J;  1KC8 Q;  3M9Q A;  1N7S D;  1BCC J;  2FXM A;  2AEJ A;  2ZJS E;  1P84 E;  2WQY C;  2M3B A;  2E75 D;  3CWB D;  1BE3 G;  5AVS B;  1L0N K;  1GZL A;  1VQP P;  4DCK A;  1YTZ I;  3JCU H;  4W7Z A;  3PRJ A;  1SQP J;  2IFN A;  4ASW A;  1JY2 P;  5EFW B;  1PPJ D;  2IBZ I;  2A06 G;  3QH9 A;  1LTS C;  2XND H;  3P32 A;  1T8Z A;  3L73 E;  3P8C D;  2JP3 A;  5KAX A;  1ZRT D;  1RY3 A;  3HE4 A;  2K1A A;  5KLV J;  2WT7 B;  3H1I E;  5KKZ C;  1RH5 B;  2LR2 A;  1R5S A;  1OWA A;  3CCS P;  3MD0 A;  2KSJ A;  4TT3 H;  2LXC B;  4PV1 D;  2Q5U A;  4WBA A;  3CCL P;  1DD3 A;  1Q81 Q;  2BEZ F;  1KQF B;  1L0L G;  3KZI E;  1G1J A;  2E42 A;  5AVQ B;  3I56 P;  3CWB J;  2R44 A;  1Y47 A;  1FOS E;  1X22 A;  1A02 J;  1PGQ A;  2D2C C;  1T6A A;  3A7O A;  5AW8 B;  1FBM A;  1GW3 A;  1JB0 J;  1YHQ P;  1SFC B;  3Q1M A;  2K37 A;  1NU1 D;  3L71 E;  5CJ4 A;  3GK6 A;  2W6B A;  2WSE J;  5TJH A;  1OXZ A;  2ZAE B;  3GG2 A;  1S5L H;  4J2N A;  3QWO C;  3CD6 P;  1FDM A;  4H44 D;  1VF5 B;  1HH0 A;  3L72 E;  1VQK P;  3TGU D;  1SQV K;  1JTH B;  2MJZ A;  1LWU B;  3UIA A;  1DIP A;  1OVU A;  3WMM 0;  1FDO A;  2ZYG A;  1NWQ A;  2IZ1 A;  1EZV E;  2VZ4 A;  5E79 H;  4I2L C;  2HPC A;  5GTI H;  3WUV A;  1FJK A;  3IF4 A;  5DJU B;  4AYC A;  4C7N B;  1OVV A;  5APY A;  3H1J D;  1JY2 O;  2A06 D;  2N1T B;  1VDF A;  2XV5 A;  1BGY E;  3L70 G;  1P84 H;  3VMZ A;  1HGV A;  2HYN A;  1NU1 J;  1YI2 P;  4EI2 A;  2FYN C;  4OGQ B;  5KLI B;  3G6E P;  2OTJ P;  1PV3 A;  1JMM A;  2B88 A;  3CI9 A;  1GL2 B;  2VRS A;  2RN0 A;  4D6T E;  2IEF A;  1BCC E;  4YXD C;  4ZMD A;  1GW4 A;  3H1L D;  3TGU J;  3A0B H;  1KZU B;  4CPG A;  1KB9 E;  3S4R A;  3G4S P;  1L0L D;  3CPW O;  2C9L Y;  1OFC X;  2R5D A;  3RK3 E;  2W90 A;  1BE3 J;  1FS0 E;  2JJL A;  1N73 C;  1M90 Q;  3AE7 C;  3HRN A;  1JY3 P;  1SFC D;  2ZFC A;  3H1H D;  5C39 A;  5TIS E;  1TU3 F;  2YXQ B;  2JWA A;  1VQ4 P;  2HOD A;  2FFD B;  1AFO A;  2W27 A;  1GK6 A;  5AW6 B;  5KLV E;  5AW3 B;  2E74 B;  1AVY A;  2KS1 A;  3KZI H;  2O3J A;  2YXR B;  2DW3 A;  3BCC G;  1VF5 D;  1Q86 Q;  2HFE D;  1J1D C;  1BOW A;  2POH A;  4HYT B;  1FZA A;  3GW6 A;  3H1K D;  3AE4 C;  1KFN A;  1PP9 D;  1EDI A;  2A45 I;  1NVO A;  4EOT A;  1XTC C;  2I1J A;  3CWB E;  1HBW A;  1SQX D;  4PJ0 H;  1YIJ P;  2I8D A;  3D70 A;  1L0L J;  1IK7 A;  3EZ2 A;  2Q1K A;  4PD4 H;  1KQG B;  1KQS O;  4I7Z C;  1N73 A;  2N1T D;  5CCH D;  2IX7 C;  4GDO A;  4RJT A;  4N78 E;  3CXH E;  4IFD K;  5AW9 B;  4OGQ D;  3L75 D;  3EWK A;  1DX7 A;  2YIU C;  1Q07 A;  2SPZ A;  1ZRT E;  3VMA A;  3V2P A;  1AV1 A;  3NXS A;  1GL2 D;  1JY2 N;  3C9I A;  1SLQ A;  2KB7 P;  4WY4 D;  4M3L A;  3T97 A;  5KTB A;  1LTT C;  5APU A;  1VQ7 P;  2E5T A;  1URQ B;  2ZVN B;  1SS1 A;  1QX8 A;  3EFG A;  3CC4 P;  1L2P A;  2QM7 A;  5KAF E;  3LID A;  1RE3 C;  5GQQ A;  1KIL B;  4U3F D;  1LTB C;  1ZN5 A;  4GIF A;  1ZP0 C;  4I6M C;  2ZHG A;  1NU1 E;  4A7P A;  2QG4 A;  3L70 J;  2E74 D;  1SQQ G;  2CPS A;  1X8Y A;  3O6Q B;  4L76 A;  2OYO A;  1X9V A;  1ZW0 A;  1LTG C;  2W8Z A;  3EZ7 A;  3AEF C;  1IFJ A;  2IPP A;  4C7R A;  3TGU E;  4YXW H;  2C9N Y;  2H89 C;  1S2E A;  3TDK A;  4EDF A;  4HB1 A;  2KP8 A;  1BE3 E;  1VQ6 P;  3ITK A;  1LTJ C;  5CCG D;  4GT1 A;  2K88 A;  1KYO I;  3HH0 A;  3KDP B;  1LGH B;  1NTM G;  3AEB C;  1YIT P;  4PD4 D;  2LKM A;  3WUT A;  5AVR B;  1JNM A;  1VL2 A;  2A06 E;  1RE3 A;  2B9B A;  2Q7C A;  2RH0 A;  1NTK G;  2E76 C;  3CME P;  1L4A B;  1GTW A;  1D5Y A;  1LT9 B;  2WVR A;  2CK3 H;  3B5N C;  3V4W A;  3OA7 A;  1PPJ G;  3L74 D;  3D6Y A;  3V6I A;  3M0A A;  4BRY A;  2GOV A;  2WPS A;  5APW A;  1ZLL A;  3BCC J;  5KLV K;  4R4E A;  1FZB A;  2Q9I A;  3D71 A;  1ZR2 A;  1URQ D;  2B87 A;  3IAO A;  2UWJ E;  3CXH H;  3HTK A;  3IR9 A;  1L0L E;  3TK1 A;  3LUR A;  1IFM A;  1HTL C;  4AUW A;  2AXT E;  3PHL A;  4IL6 X;  1HUC A;  2QJK C;  3AE5 C;  1KIL D;  3RK3 C;  3F89 A;  1LTJ A;  3A3Y B;  5KAI E;  1CI6 B;  3GF7 A;  1U7M A;  3H1H E;  2O1K A;  4NPF X;  2KLU A;  1XTG B;  1KTM A;  3CX5 D;  5E01 A;  1FZC B;  2OYH B;  1KFM A;  3L4F A;  4H13 B;  2ITA A;  5K5G B;  1JY3 N;  3FXD A;  3BVH A;  2ZVO B;  3C8V A;  4H0L C;  3R8J A;  3SWF A;  3KYQ A;  2V7Q J;  1LNQ A;  2QJP C;  4YTP C;  2IBZ D;  3H1K E;  3BAS A;  3AEE C;  1IJD B;  1FZF A;  1GMJ A;  3A5T A;  2IYP A;  1Q7Y Q;  2FY8 A;  3SSU A;  5KCB A;  4N3Y B;  4Y99 B;  2P7J A;  3KQG A;  2E75 C;  1NTM D;  1LP1 B;  1KB9 I;  3FWL A;  4GKG A;  5CJ0 A;  4UB8 E;  2Z5I A;  3HD7 B;  1NTK D;  1N7L A;  3FX0 A;  3L70 E;  3SWY A;  4LC1 A;  1L4A D;  2WSS H;  5CBN A;  1EXJ A;  2BEQ D;  2QRX A;  1VQN P;  3H1J G;  3V2Q A;  2HVA A;  2OAR A;  2BOW A;  3MUD C;  1SQQ J;  3E7K A;  1NU1 K;  3NTN A;  1JCD A;  2BCC G;  4KT0 J;  1QL2 A;  2FYU D;  3M9B A;  4UB6 H;  1VQ8 P;  3EZ9 A;  3H32 B;  1NGM B;  3W67 A;  3OW2 O;  3IN6 A;  3AE8 C;  1EDL A;  3G71 P;  1Q09 A;  4PV1 C;  3VTP C;  2JML A;  3GHG C;  5B66 E;  3AE1 C;  2I1K A;  4IL6 E;  4XA4 A;  1KYO E;  2W83 C;  3H1L G;  2XU6 A;  2ZXX A;  3TNU A;  3HE5 A;  4BWN A;  2R32 A;  1VQL P;  1N7S A;  1YBK A;  2M0B A;  3CLQ A;  1FU1 A;  3O8Z A;  5AVY B;  3C1L A;  4U3F E;  3S1K A;  3MIW A;  1NTM J;  2L91 A;  2R3S A;  3RK2 B;  2A45 H;  5CBO A;  2M8R A;  3CCU P;  2WZ7 A;  1NTK J;  1RF1 B;  2R3C A;  4ZKP A;  4H13 D;  1QEX A;  1WRG A;  2IDB A;  3BCC E;  3H1H G;  3AE3 C;  2P67 A;  3W68 A;  5BVZ A;  3CXH I;  3MUD A;  2O01 N;  2J59 M;  1NO4 A;  5KAI H;  3A0H E;  4H44 C;  3AE6 C;  2OYI C;  4U7J A;  1JUN A;  2H7H A;  1R8D A;  3MZW B;  3I5C A;  2MKV A;  5L8R J;  2ZT9 B;  1QLE D;  1JMB A;  4BXL A;  3H1K G;  4WVZ A;  1GK4 A;  1H0T A;  1AQ5 A;  1PP9 G;  2YKQ A;  3CCR P;  2K9J B;  1L0L K;  3GHG A;  3HD7 D;  1SQX G;  1FDI A;  4I1L A;  1JCC A;  5B5E H;  2Z4E A;  1T2K D;  1PGP A;  1CZQ A;  2FKW B;  2GUS A;  5AW5 B;  5KJ7 D;  1U7J A;  2M3E A;  1Q90 D;  3EQ2 A;  3HUS B;  1K8A Q;  2BCC D;  3M9H A;  1R5L A;  2W6A A;  3P8M C;  3L75 G;  1BSN A;  2GM4 A;  3R4Y A;  2OYI A;  1X79 B;  1UII A;  1SP4 A;  1QVG O;  4WY4 B;  1NKN A;  3Q5P A;  3L36 A;  1M1J B;  4IFM A;  1KIL E;  2DG6 A;  3RK2 D;  2Q6Q A;  1SQV D;  1LTI C;  3VMX A;  1EXI A;  1AA0 A;  1SFC C;  1OIP A;  5GTH E;  1SQQ E;  4U3F G;  3CX5 E;  2KLV A;  5B66 H;  4IL6 H;  1LX8 A;  1KYO H;  2M5A B;  4IFF A;  3H1J J;  2KSE A;  5APT A;  2YMK A;  2QEX P;  1VF5 C;  3E1I A;  2N9B A;  2BCC J;  1J1E B;  2KCU A;  1SQB D;  2ZT9 D;  2WT7 A;  2KVV A;  1LWU C;  2YO3 A;  2ZYA A;  5AVV B;  1NTZ D;  1OW7 A;  1N8R Q;  2KZI A;  2QE7 H;  1NTM E;  3H1L J;  3MHV A;  1VQO P;  2YKO A;  1Z56 A;  3KHU A;  1E5W A;  1NTK E;  5AW7 B;  2WSF J;  2N1T C;  3WU2 E;  5CCH C;  1Q05 A;  2O01 H;  1PPJ E;  1G2C B;  2KNC B;  1SFC A;  1IFI A;  4ASV A;  2Y9Y A;  1P84 D;  1PL5 A;  5KAW A;  3H1H J;  3PP5 A;  3JC2 2;  4OGQ C;  4YPC A;  5KLI C;  2NPS B;  3P8C E;  2WWW A;  1LT1 A;  1AVO A;  3RL0 B;  1GL2 C;  5BU5 A;  4QMA A;  3L74 G;  5KAU A;  1FJP A;  3Q5R A;  1S72 P;  4DZO A;  4AYZ B;  1QVF O;  2QJY B;  1LJ2 A;  1JTH A;  2Q3I A;  2V7Q H;  1LWU A;  1E79 H;  3H1K J;  3L73 D;  1PP9 J;  4ZKU A;  1JM0 A;  1EDK A;  3AED C;  2CPB A;  3PTZ A;  3USS A;  3OJA B;  1SQX J;  4WWI A;  3AE9 C;  3H1I D;  3H25 A;  1JY3 O;  4C7N A;  1HJ0 A;  4O9B A;  3V2R A;  3B8E B;  2FFD C;  2N1T A;  2KZJ A;  2E74 C;  5CCH A;  1Y6U A;  1KB9 H;  1FAV A;  2HG5 D;  1YJ9 P;  2AXC A;  4DT0 A;  3CCV P;  4GOE A;  1SQP G;  3L75 J;  1NKZ B;  1GL2 A;  1W2E A;  1BSH A;  2B89 A;  5TIS H;  2IBZ G;  2RMZ A;  3L71 D;  2QIW A;  5CCG C;  3HE4 B;  1OW6 A;  3L72 D;  2Y0D A;  2QJP B;  3M06 A;  1NAF A;  4OH8 B;  3H1J E;  3EFF K;  2HR3 A;  4U3F J;  3CCJ P;  3L37 A;  3B49 A;  3LIE A;  1SQQ K;  4WB4 A;  2NPS D;  2BCC E;  3JSV C;  1K05 A;  2FFD A;  1G1I A;  3RL0 D;  1Q08 A;  5AVT B;  1EZV D;  2IZ0 A;  3UCS A;  2YMY A;  5CHX A;  1IK9 A;  3CC2 P;  2G8Y A;  4L75 A;  5KAV A;  2C0X A;  1RQV A;  2FYU G;  1URQ C;  3H1L E;  4LLH A;  1JOC A;  1BGY D;  2WSE H;  2ZXE B;  3B5N D;  4HKZ H;  4EYY Q;  3CCQ P;  2QSI A;  2BAS A;  2R5B A;  1JBG A;  1KIL C;  2KK7 A;  1NTM K;  4RO0 A;  5CCG A;  4R22 B;  4D6T D;  1Y8A A;  1BCC D;  1T3J A;  5KKZ B;  4KHX A;  1EDJ A;  1NTK K;  4Y28 J;  2YO2 A;  1W5C E;  2Z5H A;  1JO5 A;  2FXP A;  1KN7 A;  1UIX A;  2V4H A;  2HPC B;  2IFM A;  4WLW A;  2KXP B;  1GDT A;  1SQP D;  2Y0E A;  5KAF H;  3AEA C;  3KXD A;  1L0N G;  3L74 J;  1MUU A;  1SQB E;  3Q5S A;  1AJY A;  2FXO A;  4B86 A;  2YKP A;  3TYY A;  5AW4 B;  1M7L A;  5AVX B;  1PFI A;  2KOG A;  2D2C B;  3EZF A;  4HH2 A;  1QGK B;  1PGJ A;  3AEC C;  1PP9 E;  5KAT A;  1S4X A;  4JBZ A;  1NOH A;  2KYV A;  1URQ A;  1N7S C;  1SQX E;  2JEE A;  3S9O A;  5H2F E;  3VP9 A;  5E79 E;  4A1M A;  1GU5 A;  3IFM A;  3U59 A;  1PZQ A;  1S3J A;  3VP8 A;  1R8E A;  1QL1 A;  1VQ5 P;  2J5U A;  1KIL A;  3G9R A;  2JWD A;  1L4A C;  4W80 A;  1JEK A;  1LT9 C;  3U1C A;  4RES B;  1IZN B;  1M8O B;  2JKV A;  3N7N A;  1Q0A A;  3L75 E;  3CX5 I;  3MTU E;  3O6Q A;  1DEB A;  2E5Y A;  4LHF A;  1KOR A;  1NHL A;  1YJW P;  1NYH A;  3R8K A;  3PJS K;  4N78 D;  2XKM A;  2HOD B;  3A0B E;  1M56 D;  4WLS A;  4DOJ A;  3CXH D;  3SFE C;  2NZ2 A;  3M91 A;  4JPZ B;  2OG0 A;  1VPC A;  2KS1 B;  3L35 A;  3VN0 A;  1S9K D;  1Q82 Q;  5AW1 B;  2H43 A;  3LW5 J;  2FYN B;  2OTL P;  5APX A;  1NJI Q;  1KMI Z;  2KI7 B;  3FWN A;  1ZR4 A;  4K3A A;  3GF3 A;  3GP4 A;  2N9Y B;  1SQV G;  1ZME C;  1FZC C;  2OYH C;  2A45 G;  2WPR A;  4H13 C;  1RE4 C;  1L4A A;  1LT9 A;  3TSI A;  2AXT H;  4W7Y A;  2WSF H;  1T3U A;  4GOD A;  1L0N D;  1IC2 A;  3Q3D A;  3GMA A;  3BAT A;  1N73 B;  3RL0 g;  2D2C D;  3GPV A;  4JF7 A;  1S1C X;  2FYZ A;  2FYU J;  1OVR A;  2FBW C;  1SQB G;  4Y99 C;  3CMA P;  4KJM A;  2GA1 A;  1HGZ A;  4PJ0 E;  3NFQ A;  2Q3E A;  3MGN A;  3RBZ A;  1NTZ G;  1DH3 A;  3KPE A;  3HD7 C;  3K5B A;  3OAK A;  3GLM A;  4PD4 E;  1J1D B;  1YYC A;  3T97 B;  1X0T A;  2E43 A;  1T2K C;  3V5B A;  1EQ7 A;  2AEF A;  1CI6 A;  2WSC J;  5KJ7 C;  2WPV B;  5APV A;  1BE3 D;  3V2N A;  1FOS F;  1KD1 Q;  5APS A;  3CCE P;  5H2F H;  1FZC A;  2OYH A;  1KQL A;  3L74 E;  4JYC A;  1IFD A;  1RE4 A;  3R2P A;  2P2U A;  4UB8 H;  1L0N J;  3VYI A;  3SWK A;  5D90 A;  5AW0 B;  3E0H A;  2L5G B;  4I7Z B;  4MN4 C;  5I41 B;  1SQB K;  1SVF A;  2P58 A;  2WIT A;  3CC7 P;  4IOI H;  1M1K Q;  1NTZ K;  1OW8 A;  2WPQ A;  2YIU B;  1LP1 A;  3RK2 C;  3L73 G;  5CMZ A;  1SQX K;  2HLO A;  2KUB A;  2QM8 A;  1HWT C;  2NRG A;  2YNY A;  5DJT B;  3II6 A;  3HD7 A;  1RF1 C;  3H1I G;  1VQ9 P;  4B0Y A;  5KJ7 A;  1N86 A;  3Q2Y A;  1BDD A;  1SQP E;  1YJN P;  3B4S A;  2LXB A;  1GD2 E;  2P10 A;  1MFZ A;  4L73 A;  5AVZ B;  4JYB A;  2IBZ E;  1YQ3 C;  1ZXG A;  2ZT9 C;  2QVA A;  2PGD A;  3B71 A;  5D8C A;  3H32 A;  1PIX A;  2XZR A;  1YTZ T;  4DJG A;  4BRY B;  3L71 G;  3CL3 D;  1HVV A;  1K9M Q;  1MKM A;  3U1A A;  1USE A;  1PM6 A;  3SFD C;  3A0H H;  1MV8 A;  2B87 B;  4GOF A;  2ZYD A;  2H88 C;  4XFJ A;  1H89 A;  3L72 G;  3HTK B;  1SQV J;  2JO1 A;  1USD A;  3HUS C;  1RF1 A;  1IFP A;  1PGO A;  2PRR A;  1LTJ B;  1RHZ B;  1Y9B A;  2FYU E;  1EZV G;  3WUU A;  3L70 D;  3H6P A;  4NPE A;  4RKU J;  1BDC A;  2K3R A;  3I55 P;  4R4L A;  4WY4 C;  1AQT A;  1H88 A;  1M1J C;  2E76 B;  1SQB J;  1S9K E;  2OGU A;  2PFX A;  3B5N B;  1BGY G;  1NTZ J;  3AEG C;  2K9J A;  4OWF A;  4N6J A;  5M1B A;  3VMY A;  1Q06 A;  3VOP A;  3A2A A;  2H8P D;  3ABV C;  1WT6 A;  1A02 F;  4D6T G;  1HF9 A;  1CSB A;  2JR8 A;  1BCC G;  1KYO D;  1K04 A;  3HUS A;  1L0N E;  1IO4 A;  1P84 I;  1EC5 A;  1J1E C;  3BRV B;  2QJK B;  1U57 A;  1K73 Q;  1ZOY C;  3RK3 B;  2JDI H;  2PAJ A;  3V4Q A;  1FC2 C;  2P1J A;  2C0W A;  3E1R A;  1S5L X;  1DEE G;  5GTH H;  1OZH A;  4K35 A;  3N4X A;  3M0D C;  1MFT A;  4R24 B;  2WMM A;  1OX3 A;  3CX5 H;  1RH6 A;  3BCC D;  2PP6 A;  4WY4 A;  1J2J B;  2O1J A;  4AQR D;  3EZ6 A;  1M1J A;  4DCZ A;  1HJB A;  2W6J H;  3D6Z A;  5KLV G;  4H0L B;  3L73 J;  4JQ0 D;  1DD4 A;  3JCU E;  3BRT B;  2Y9Z A;  2XDJ A;  3P7K A;  3G3Z A;  3LW5 H;  2J58 A;  1RF0 C;  3H1I J;  1M57 D;  1YQ4 C;  4XE5 B;  3TNU B;  4LGD E;  2NPS C;  3HE5 B;  3RGU A;  2M5A A;  1N7S B;  3RBX A;  2Y0C A;  3RL0 C;  2E75 B;  1LTA C;  3CWB G;  2WTY A;  3F5H A;  4L74 A;  1SQP K;  1MZ9 A;  4UB6 E;  2IYO A;  3WU2 H;  2OQQ A;  2QJY C;  2E76 D;  4ZNC A;  1CW5 A;  4TLF A;  3AE2 C;  2OTK E;  1VQM P;  5AVW B;  3M0D A;  4R4M A;  5APQ A;  1KV4 A;  1FE6 A;  3L71 J;  3FXE A;  2RKL A;  5AVU B;  1D7M A;  1FZG A;  2ZHH A;  1SQV E;  2XNX A;  3FGA D;  5AW2 B;  4PD4 I;  3L72 J;  2G3A A;  1Q2N A;  3PLN A;  3QAO A;  1H0T B; 
#chains in the Genus database with same CATH homology
 4H44 C;  1RH6 A;  1EXI A;  2O01 J;  3Q5R A;  1ZME C;  2D2C B;  3EZF A;  3AE6 C;  4PV1 B;  1VF5 D;  2VZ4 A;  4R4E A;  4U7J A;  2JP3 A;  3AEC C;  4AYZ B;  4H13 C;  1BOW A;  5GQQ A;  5I44 A;  5KAT A;  5KAX A;  1R8D A;  2K9Y A;  3EZ6 A;  4DCZ A;  2MKV A;  3B49 A;  5L8R J;  2ZT9 B;  1EXJ A;  3D6Z A;  3D71 A;  1ZP0 C;  1K05 A;  1LX8 A;  1OW8 A;  3IAO A;  2BEQ D;  3S9O A;  5KKZ C;  4H0L B;  1Q08 A;  1Y9B A;  4A1M A;  2ZHG A;  3AE4 C;  2HVA A;  1DD4 A;  3Q3D A;  3UCS A;  2BOW A;  3GMA A;  1WMK A;  3LUR A;  4TT3 H;  2E74 D;  2YMK A;  1R8E A;  1JYH A;  3AED C;  3RL0 g;  1VF5 C;  4RKU J;  2D2C D;  4AYZ A;  2J5U A;  3GPV A;  4PV1 D;  4IL6 X;  4Z1M H;  2QJK C;  4R4L A;  3AE5 C;  3G9R A;  1S1C X;  3AE9 C;  4KT0 J;  3EZ7 A;  3AEF C;  2G8Y A;  1YQ4 C;  2KCU A;  3H25 A;  1DD3 A;  1FDI A;  3D70 A;  5KAV A;  2FYN C;  2E76 B;  1RQV A;  1HJ0 A;  2BEZ F;  4OGQ B;  2FBW C;  2ZT9 D;  4B0Y A;  1KQF B;  1IK7 A;  3EZ2 A;  2KVV A;  1PV3 A;  3GF7 A;  3EZ9 A;  3Q2Y A;  4H0L D;  1NGM B;  1KQG B;  2E75 B;  2H89 C;  4I7Z C;  3IN6 A;  2E74 C;  1Q90 D;  1Y6U A;  3AEG C;  1Q0A A;  1OW7 A;  3AE8 C;  3O6Q A;  2IEF A;  2P10 A;  2QSI A;  4GDO A;  5M1B A;  1Q06 A;  4LHF A;  2D2C C;  4YXD C;  1Q09 A;  4PV1 C;  4H44 B;  2JML A;  1KTM A;  1JBG A;  3AE1 C;  5E01 A;  1JB0 J;  3GLM A;  3ABV C;  3Q1M A;  1RQU A;  1KOR A;  4H13 B;  1NYH A;  1OMI A;  2OQQ A;  3T97 B;  2QJY C;  1YQ3 C;  2ZT9 C;  2E76 D;  4R22 B;  4OGQ D;  3B71 A;  5D8C A;  3AE2 C;  3C8V A;  3EWK A;  1HF9 A;  2YIU C;  1Q07 A;  3GK6 A;  4H0L C;  2WSC J;  3R8K A;  1PIX A;  3HH0 A;  3R8J A;  1ZRT E;  2WSE J;  2V7Q J;  2WQY C;  2WPV B;  3R4Y A;  2WSF J;  3RK3 E;  2E75 D;  3AEB C;  4WLS A;  4R4M A;  4Y28 J;  2QJP C;  1Q05 A;  1K04 A;  4YTP C;  3SFE C;  2NZ2 A;  3AE7 C;  4J2N A;  2OG0 A;  2FXP A;  1VL2 A;  4H44 D;  1VF5 B;  3AEE C;  1UIX A;  2QIW A;  2ZHH A;  1MKM A;  3Q5P A;  1U57 A;  2E76 C;  1GMJ A;  4H13 D;  4WLW A;  1PL5 A;  3LW5 J;  1PM6 A;  1ZOY C;  5KAW A;  2IDB A;  4OGQ C;  3SFD C;  1D5Y A;  5KLI C;  1TU3 F;  1KMI Z;  3AE3 C;  5KCB A;  3AEA C;  3FGA D;  1S5L X;  1KIL E;  2E75 C;  2DG6 A;  1DIP A;  2H88 C;  1OW6 A;  2G3A A;  5D90 A;  4R24 B;  4XFJ A;  3Q5S A;  3E0H A;  1AJY A;  3D6Y A;  1FDO A;  5KAU A;  4I7Z B;  3GF3 A;  3GP4 A;  2E74 B;  5I41 B;  3QAO A;  2JO1 A;  2GOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...