The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
73
|
sequence length |
187
|
structure length |
187
|
Chain Sequence |
EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Studies of Metal Ions in Family II Pyrophosphatases: The Requirement for a Janus Ion
pubmed doi rcsb |
| molecule keywords |
Manganese-dependent inorganic pyrophosphatase
|
| molecule tags |
Hydrolase
|
| source organism |
Bacillus subtilis
|
| total genus |
73
|
| structure length |
187
|
| sequence length |
187
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.6.1.1: Inorganic diphosphatase. |
| pdb deposition date | 2004-09-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01368 | DHH | DHH family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | inorganic pyrophosphatase (n-terminal core) | inorganic pyrophosphatase (n-terminal core) |
#chains in the Genus database with same CATH superfamily 4PY9 A; 2EB0 A; 1WPP A; 1WPN A; 2IW4 A; 2QB7 A; 1K23 A; 4RPA A; 1WPM A; 2HAW A; 3W5W A; 2QB6 A; 4LS9 A; 3DEV A; 1K20 A; 2QB8 A; 1I74 A; 2ENX A; #chains in the Genus database with same CATH topology 4PY9 A; 2EB0 A; 1WPN A; 3W5W A; 1K23 A; 1WPM A; 4LS9 A; 2ZXR A; 5GL4 A; 4FC5 A; 4DWZ A; 2ZXP A; 2QB7 A; 4RPA A; 5GL3 A; 2ENX A; 1IR6 A; 2IW4 A; 2HAW A; 3DEV A; 2QB8 A; 2QB6 A; 5GL2 A; 5GKX A; 1WPP A; 2ZXO A; 1K20 A; 1I74 A; #chains in the Genus database with same CATH homology 4PY9 A; 2EB0 A; 1WPN A; 3W5W A; 1K23 A; 1WPM A; 4LS9 A; 2ZXR A; 5GL4 A; 4FC5 A; 4DWZ A; 2ZXP A; 2QB7 A; 4RPA A; 5GL3 A; 2ENX A; 1IR6 A; 2IW4 A; 2HAW A; 3DEV A; 2QB8 A; 2QB6 A; 5GL2 A; 5GKX A; 1WPP A; 2ZXO A; 1K20 A; 1I74 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...