2QB7A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, phosphate complex
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
393
structure length
393
Chain Sequence
b'RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exopolyphosphatase
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 142
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb7A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb7A01
2EB0A 1K20A 2ENXA 2HAWA 2QB7A 4RPAA 1I74A 1WPMA 1WPNA 2QB8A 1WPPA 2QB6A 3DEVA 4LS9A 3W5WA 4PY9A 2IW4A 1K23A
chains in the Genus database with same CATH superfamily
2H9FA 3PTJA 1TM0A 1GQZA 4DUNA 1WPMA 3PVHA 5GL4A 2YMAA 1XUAA 3EJXA 2PW0A 4J9XA 4JD7A 1S7JA 1K23A 2Q9HA 1YM5A 3W5WA 4GL6A 1U1VA 4JCIA 1T6KA 2ZXPA 3WQZA 2ZXOA 2QB7A 2KPTA 3IGHX 2ZXRA 5GL2A 3G98A 4LB0A 1IR6A 2GKJA 5H2GA 2LT2A 3EDNA 2IW4A 2MPBA 2HAWA 4K7XA 1WPNA 2PVZA 2GKEA 1U0KA 5GKXA 4LS9A 3PW9A 4DWZA 1U1XA 1K20A 5H2YA 2KW7A 1BWZA 4PY9A 4K8LA 4RPAA 4K7GB 1QY9A 3DEVA 3EKMA 2AZPA 1SDJA 4J9WA 1U1WA 4IJZA 1W62A 4JUUA 1W61A 1QYAA 5IWEA 2ENXA 2Q9JA 1I74A 5M47A 4OA3A 2QB8A 1WPPA 4Q2HA 5GL3A 4LG3A 3FVEA 4JBDA 1XUBA 2QB6A 2ZVFA 3G7KA 4Q60A 2OTNA 2EB0A 4IK0A 4FC5A 5HA4A 5ANPA 3ICJA
chains in the Genus database with same CATH topology
2H9FA 3PTJA 1TM0A 1GQZA 4DUNA 1WPMA 3PVHA 5GL4A 2YMAA 1XUAA 3EJXA 2PW0A 4J9XA 4JD7A 1S7JA 1K23A 2Q9HA 1YM5A 3W5WA 4GL6A 1U1VA 4JCIA 1T6KA 2ZXPA 3WQZA 2ZXOA 2QB7A 2KPTA 3IGHX 2ZXRA 5GL2A 3G98A 4LB0A 1IR6A 2GKJA 5H2GA 2LT2A 3EDNA 2IW4A 2MPBA 2HAWA 4K7XA 1WPNA 2PVZA 2GKEA 1U0KA 5GKXA 4LS9A 3PW9A 4DWZA 1U1XA 1K20A 5H2YA 2KW7A 1BWZA 4PY9A 4K8LA 4RPAA 4K7GB 1QY9A 3DEVA 3EKMA 2AZPA 1SDJA 4J9WA 1U1WA 4IJZA 1W62A 4JUUA 1W61A 1QYAA 5IWEA 2ENXA 2Q9JA 1I74A 5M47A 4OA3A 2QB8A 1WPPA 4Q2HA 5GL3A 4LG3A 3FVEA 4JBDA 1XUBA 2QB6A 2ZVFA 3G7KA 4Q60A 2OTNA 2EB0A 4IK0A 4FC5A 5HA4A 5ANPA 3ICJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EB0 A;  1K20 A;  2ENX A;  2HAW A;  2QB7 A;  4RPA A;  1I74 A;  1WPM A;  1WPN A;  2QB8 A;  1WPP A;  2QB6 A;  3DEV A;  4LS9 A;  3W5W A;  4PY9 A;  2IW4 A;  1K23 A; 
#chains in the Genus database with same CATH topology
 2H9F A;  3PTJ A;  1TM0 A;  1GQZ A;  4DUN A;  1WPM A;  3PVH A;  5GL4 A;  2YMA A;  1XUA A;  3EJX A;  2PW0 A;  4J9X A;  4JD7 A;  1S7J A;  1K23 A;  2Q9H A;  1YM5 A;  3W5W A;  4GL6 A;  1U1V A;  4JCI A;  1T6K A;  2ZXP A;  3WQZ A;  2ZXO A;  2QB7 A;  2KPT A;  3IGH X;  2ZXR A;  5GL2 A;  3G98 A;  4LB0 A;  1IR6 A;  2GKJ A;  5H2G A;  2LT2 A;  3EDN A;  2IW4 A;  2MPB A;  2HAW A;  4K7X A;  1WPN A;  2PVZ A;  2GKE A;  1U0K A;  5GKX A;  4LS9 A;  3PW9 A;  4DWZ A;  1U1X A;  1K20 A;  5H2Y A;  2KW7 A;  1BWZ A;  4PY9 A;  4K8L A;  4RPA A;  4K7G B;  1QY9 A;  3DEV A;  3EKM A;  2AZP A;  1SDJ A;  4J9W A;  1U1W A;  4IJZ A;  1W62 A;  4JUU A;  1W61 A;  1QYA A;  5IWE A;  2ENX A;  2Q9J A;  1I74 A;  5M47 A;  4OA3 A;  2QB8 A;  1WPP A;  4Q2H A;  5GL3 A;  4LG3 A;  3FVE A;  4JBD A;  1XUB A;  2QB6 A;  2ZVF A;  3G7K A;  4Q60 A;  2OTN A;  2EB0 A;  4IK0 A;  4FC5 A;  5HA4 A;  5ANP A;  3ICJ A; 
#chains in the Genus database with same CATH homology
 2H9F A;  3PTJ A;  1TM0 A;  1GQZ A;  4DUN A;  1WPM A;  3PVH A;  5GL4 A;  2YMA A;  1XUA A;  3EJX A;  2PW0 A;  4J9X A;  4JD7 A;  1S7J A;  1K23 A;  2Q9H A;  1YM5 A;  3W5W A;  4GL6 A;  1U1V A;  4JCI A;  1T6K A;  2ZXP A;  3WQZ A;  2ZXO A;  2QB7 A;  2KPT A;  3IGH X;  2ZXR A;  5GL2 A;  3G98 A;  4LB0 A;  1IR6 A;  2GKJ A;  5H2G A;  2LT2 A;  3EDN A;  2IW4 A;  2MPB A;  2HAW A;  4K7X A;  1WPN A;  2PVZ A;  2GKE A;  1U0K A;  5GKX A;  4LS9 A;  3PW9 A;  4DWZ A;  1U1X A;  1K20 A;  5H2Y A;  2KW7 A;  1BWZ A;  4PY9 A;  4K8L A;  4RPA A;  4K7G B;  1QY9 A;  3DEV A;  3EKM A;  2AZP A;  1SDJ A;  4J9W A;  1U1W A;  4IJZ A;  1W62 A;  4JUU A;  1W61 A;  1QYA A;  5IWE A;  2ENX A;  2Q9J A;  1I74 A;  5M47 A;  4OA3 A;  2QB8 A;  1WPP A;  4Q2H A;  5GL3 A;  4LG3 A;  3FVE A;  4JBD A;  1XUB A;  2QB6 A;  2ZVF A;  3G7K A;  4Q60 A;  2OTN A;  2EB0 A;  4IK0 A;  4FC5 A;  5HA4 A;  5ANP A;  3ICJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...