2QB7A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, phosphate complex
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
393
structure length
393
Chain Sequence
RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Exopolyphosphatase
total genus 142
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb7A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb7A01
1WPNA 4LS9A 2HAWA 2QB8A 2QB7A 2IW4A 4RPAA 2EB0A 4PY9A 1WPPA 1K20A 2ENXA 1WPMA 3W5WA 2QB6A 1I74A 3DEVA 1K23A
chains in the Genus database with same CATH superfamily
4JBDA 1XUAA 2EB0A 4J9WA 5GL4A 2MPBA 4IJZA 1TM0A 1IR6A 5GKXA 3PVHA 2KPTA 2ZXPA 4LG3A 3G7KA 4J9XA 4LS9A 1WPMA 2PVZA 1W61A 1I74A 2QB7A 4K7XA 5ANPA 4LB0A 2KW7A 4DWZA 5GL3A 4JUUA 3DEVA 2Q9JA 1WPNA 1QYAA 1XUBA 2H9FA 1SDJA 4JCIA 3FVEA 1QY9A 1K20A 1WPPA 4Q60A 2ENXA 3PTJA 1K23A 2ZXRA 2HAWA 1BWZA 2QB8A 4PY9A 3G98A 3ICJA 1GQZA 4JD7A 3W5WA 2GKJA 1T6KA 3EJXA 2AZPA 4RPAA 1YM5A 2ZXOA 1U1WA 2QB6A 1S7JA 5H2YA 2LT2A 4K8LA 5HA4A 4GL6A 5M47A 4OA3A 2OTNA 1U1XA 5GL2A 1U1VA 3EKMA 2YMAA 1U0KA 4FC5A 3PW9A 2PW0A 4IK0A 2IW4A 1W62A 2GKEA 2Q9HA 5IWEA 4DUNA 3IGHX 4K7GB 4Q2HA 5H2GA 3EDNA 3WQZA 2ZVFA
chains in the Genus database with same CATH topology
4JBDA 1XUAA 2EB0A 4J9WA 5GL4A 2MPBA 4IJZA 1TM0A 1IR6A 5GKXA 3PVHA 2KPTA 2ZXPA 4LG3A 3G7KA 4J9XA 4LS9A 1WPMA 2PVZA 1W61A 1I74A 2QB7A 4K7XA 5ANPA 4LB0A 2KW7A 4DWZA 5GL3A 4JUUA 3DEVA 2Q9JA 1WPNA 1QYAA 1XUBA 2H9FA 1SDJA 4JCIA 3FVEA 1QY9A 1K20A 1WPPA 4Q60A 2ENXA 3PTJA 1K23A 2ZXRA 2HAWA 1BWZA 2QB8A 4PY9A 3G98A 3ICJA 1GQZA 4JD7A 3W5WA 2GKJA 1T6KA 3EJXA 2AZPA 4RPAA 1YM5A 2ZXOA 1U1WA 2QB6A 1S7JA 5H2YA 2LT2A 4K8LA 5HA4A 4GL6A 5M47A 4OA3A 2OTNA 1U1XA 5GL2A 1U1VA 3EKMA 2YMAA 1U0KA 4FC5A 3PW9A 2PW0A 4IK0A 2IW4A 1W62A 2GKEA 2Q9HA 5IWEA 4DUNA 3IGHX 4K7GB 4Q2HA 5H2GA 3EDNA 3WQZA 2ZVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPN A;  4LS9 A;  2HAW A;  2QB8 A;  2QB7 A;  2IW4 A;  4RPA A;  2EB0 A;  4PY9 A;  1WPP A;  1K20 A;  2ENX A;  1WPM A;  3W5W A;  2QB6 A;  1I74 A;  3DEV A;  1K23 A; 
#chains in the Genus database with same CATH topology
 4JBD A;  1XUA A;  2EB0 A;  4J9W A;  5GL4 A;  2MPB A;  4IJZ A;  1TM0 A;  1IR6 A;  5GKX A;  3PVH A;  2KPT A;  2ZXP A;  4LG3 A;  3G7K A;  4J9X A;  4LS9 A;  1WPM A;  2PVZ A;  1W61 A;  1I74 A;  2QB7 A;  4K7X A;  5ANP A;  4LB0 A;  2KW7 A;  4DWZ A;  5GL3 A;  4JUU A;  3DEV A;  2Q9J A;  1WPN A;  1QYA A;  1XUB A;  2H9F A;  1SDJ A;  4JCI A;  3FVE A;  1QY9 A;  1K20 A;  1WPP A;  4Q60 A;  2ENX A;  3PTJ A;  1K23 A;  2ZXR A;  2HAW A;  1BWZ A;  2QB8 A;  4PY9 A;  3G98 A;  3ICJ A;  1GQZ A;  4JD7 A;  3W5W A;  2GKJ A;  1T6K A;  3EJX A;  2AZP A;  4RPA A;  1YM5 A;  2ZXO A;  1U1W A;  2QB6 A;  1S7J A;  5H2Y A;  2LT2 A;  4K8L A;  5HA4 A;  4GL6 A;  5M47 A;  4OA3 A;  2OTN A;  1U1X A;  5GL2 A;  1U1V A;  3EKM A;  2YMA A;  1U0K A;  4FC5 A;  3PW9 A;  2PW0 A;  4IK0 A;  2IW4 A;  1W62 A;  2GKE A;  2Q9H A;  5IWE A;  4DUN A;  3IGH X;  4K7G B;  4Q2H A;  5H2G A;  3EDN A;  3WQZ A;  2ZVF A; 
#chains in the Genus database with same CATH homology
 4JBD A;  1XUA A;  2EB0 A;  4J9W A;  5GL4 A;  2MPB A;  4IJZ A;  1TM0 A;  1IR6 A;  5GKX A;  3PVH A;  2KPT A;  2ZXP A;  4LG3 A;  3G7K A;  4J9X A;  4LS9 A;  1WPM A;  2PVZ A;  1W61 A;  1I74 A;  2QB7 A;  4K7X A;  5ANP A;  4LB0 A;  2KW7 A;  4DWZ A;  5GL3 A;  4JUU A;  3DEV A;  2Q9J A;  1WPN A;  1QYA A;  1XUB A;  2H9F A;  1SDJ A;  4JCI A;  3FVE A;  1QY9 A;  1K20 A;  1WPP A;  4Q60 A;  2ENX A;  3PTJ A;  1K23 A;  2ZXR A;  2HAW A;  1BWZ A;  2QB8 A;  4PY9 A;  3G98 A;  3ICJ A;  1GQZ A;  4JD7 A;  3W5W A;  2GKJ A;  1T6K A;  3EJX A;  2AZP A;  4RPA A;  1YM5 A;  2ZXO A;  1U1W A;  2QB6 A;  1S7J A;  5H2Y A;  2LT2 A;  4K8L A;  5HA4 A;  4GL6 A;  5M47 A;  4OA3 A;  2OTN A;  1U1X A;  5GL2 A;  1U1V A;  3EKM A;  2YMA A;  1U0K A;  4FC5 A;  3PW9 A;  2PW0 A;  4IK0 A;  2IW4 A;  1W62 A;  2GKE A;  2Q9H A;  5IWE A;  4DUN A;  3IGH X;  4K7G B;  4Q2H A;  5H2G A;  3EDN A;  3WQZ A;  2ZVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...