2QB7A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, phosphate complex
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
393
structure length
393
Chain Sequence
RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Exopolyphosphatase
total genus 142
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb7A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb7A01
1K23A 4RPAA 2ENXA 2QB6A 3DEVA 1WPMA 1WPNA 2QB8A 4LS9A 4PY9A 2IW4A 2QB7A 1WPPA 1I74A 2HAWA 3W5WA 1K20A 2EB0A
chains in the Genus database with same CATH superfamily
5H2GA 4K7XA 3ICJA 2GKEA 4K8LA 1W62A 2QB8A 5GKXA 2HAWA 2ZXPA 5H2YA 4DUNA 4PY9A 3IGHX 1WPMA 1WPPA 1K20A 2MPBA 3PVHA 3W5WA 2QB6A 1U0KA 2EB0A 4FC5A 5GL4A 1T6KA 2AZPA 2IW4A 2H9FA 2Q9JA 2ENXA 4IK0A 5HA4A 3EJXA 1YM5A 3G7KA 2OTNA 4J9WA 4GL6A 4RPAA 4J9XA 4IJZA 4JCIA 1TM0A 1QYAA 4OA3A 1XUBA 3DEVA 2KPTA 5GL3A 1U1WA 1U1XA 3PTJA 3FVEA 2LT2A 5GL2A 4K7GB 2ZXOA 1QY9A 4LS9A 2Q9HA 4LG3A 1K23A 2PW0A 1GQZA 5IWEA 5M47A 1S7JA 4LB0A 1WPNA 2YMAA 1W61A 1IR6A 2PVZA 1U1VA 2ZXRA 4DWZA 4Q60A 3PW9A 1BWZA 4JBDA 1XUAA 2GKJA 3G98A 4JUUA 3EDNA 3EKMA 2ZVFA 1SDJA 1I74A 4Q2HA 5ANPA 4JD7A 2KW7A 2QB7A 3WQZA
chains in the Genus database with same CATH topology
5H2GA 4K7XA 3ICJA 2GKEA 4K8LA 1W62A 2QB8A 5GKXA 2HAWA 2ZXPA 5H2YA 4DUNA 4PY9A 3IGHX 1WPMA 1WPPA 1K20A 2MPBA 3PVHA 3W5WA 2QB6A 1U0KA 2EB0A 4FC5A 5GL4A 1T6KA 2AZPA 2IW4A 2H9FA 2Q9JA 2ENXA 4IK0A 5HA4A 3EJXA 1YM5A 3G7KA 2OTNA 4J9WA 4GL6A 4RPAA 4J9XA 4IJZA 4JCIA 1TM0A 1QYAA 4OA3A 1XUBA 3DEVA 2KPTA 5GL3A 1U1WA 1U1XA 3PTJA 3FVEA 2LT2A 5GL2A 4K7GB 2ZXOA 1QY9A 4LS9A 2Q9HA 4LG3A 1K23A 2PW0A 1GQZA 5IWEA 5M47A 1S7JA 4LB0A 1WPNA 2YMAA 1W61A 1IR6A 2PVZA 1U1VA 2ZXRA 4DWZA 4Q60A 3PW9A 1BWZA 4JBDA 1XUAA 2GKJA 3G98A 4JUUA 3EDNA 3EKMA 2ZVFA 1SDJA 1I74A 4Q2HA 5ANPA 4JD7A 2KW7A 2QB7A 3WQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K23 A;  4RPA A;  2ENX A;  2QB6 A;  3DEV A;  1WPM A;  1WPN A;  2QB8 A;  4LS9 A;  4PY9 A;  2IW4 A;  2QB7 A;  1WPP A;  1I74 A;  2HAW A;  3W5W A;  1K20 A;  2EB0 A; 
#chains in the Genus database with same CATH topology
 5H2G A;  4K7X A;  3ICJ A;  2GKE A;  4K8L A;  1W62 A;  2QB8 A;  5GKX A;  2HAW A;  2ZXP A;  5H2Y A;  4DUN A;  4PY9 A;  3IGH X;  1WPM A;  1WPP A;  1K20 A;  2MPB A;  3PVH A;  3W5W A;  2QB6 A;  1U0K A;  2EB0 A;  4FC5 A;  5GL4 A;  1T6K A;  2AZP A;  2IW4 A;  2H9F A;  2Q9J A;  2ENX A;  4IK0 A;  5HA4 A;  3EJX A;  1YM5 A;  3G7K A;  2OTN A;  4J9W A;  4GL6 A;  4RPA A;  4J9X A;  4IJZ A;  4JCI A;  1TM0 A;  1QYA A;  4OA3 A;  1XUB A;  3DEV A;  2KPT A;  5GL3 A;  1U1W A;  1U1X A;  3PTJ A;  3FVE A;  2LT2 A;  5GL2 A;  4K7G B;  2ZXO A;  1QY9 A;  4LS9 A;  2Q9H A;  4LG3 A;  1K23 A;  2PW0 A;  1GQZ A;  5IWE A;  5M47 A;  1S7J A;  4LB0 A;  1WPN A;  2YMA A;  1W61 A;  1IR6 A;  2PVZ A;  1U1V A;  2ZXR A;  4DWZ A;  4Q60 A;  3PW9 A;  1BWZ A;  4JBD A;  1XUA A;  2GKJ A;  3G98 A;  4JUU A;  3EDN A;  3EKM A;  2ZVF A;  1SDJ A;  1I74 A;  4Q2H A;  5ANP A;  4JD7 A;  2KW7 A;  2QB7 A;  3WQZ A; 
#chains in the Genus database with same CATH homology
 5H2G A;  4K7X A;  3ICJ A;  2GKE A;  4K8L A;  1W62 A;  2QB8 A;  5GKX A;  2HAW A;  2ZXP A;  5H2Y A;  4DUN A;  4PY9 A;  3IGH X;  1WPM A;  1WPP A;  1K20 A;  2MPB A;  3PVH A;  3W5W A;  2QB6 A;  1U0K A;  2EB0 A;  4FC5 A;  5GL4 A;  1T6K A;  2AZP A;  2IW4 A;  2H9F A;  2Q9J A;  2ENX A;  4IK0 A;  5HA4 A;  3EJX A;  1YM5 A;  3G7K A;  2OTN A;  4J9W A;  4GL6 A;  4RPA A;  4J9X A;  4IJZ A;  4JCI A;  1TM0 A;  1QYA A;  4OA3 A;  1XUB A;  3DEV A;  2KPT A;  5GL3 A;  1U1W A;  1U1X A;  3PTJ A;  3FVE A;  2LT2 A;  5GL2 A;  4K7G B;  2ZXO A;  1QY9 A;  4LS9 A;  2Q9H A;  4LG3 A;  1K23 A;  2PW0 A;  1GQZ A;  5IWE A;  5M47 A;  1S7J A;  4LB0 A;  1WPN A;  2YMA A;  1W61 A;  1IR6 A;  2PVZ A;  1U1V A;  2ZXR A;  4DWZ A;  4Q60 A;  3PW9 A;  1BWZ A;  4JBD A;  1XUA A;  2GKJ A;  3G98 A;  4JUU A;  3EDN A;  3EKM A;  2ZVF A;  1SDJ A;  1I74 A;  4Q2H A;  5ANP A;  4JD7 A;  2KW7 A;  2QB7 A;  3WQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...