2QB8A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, atp complex
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
393
Chain Sequence
b'RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exopolyphosphatase
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 135
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb8A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb8A01
1WPNA 1I74A 1WPPA 1K20A 4PY9A 3W5WA 2QB8A 1WPMA 2ENXA 2HAWA 4RPAA 4LS9A 3DEVA 2QB7A 2IW4A 1K23A 2EB0A 2QB6A
chains in the Genus database with same CATH superfamily
2PVZA 3EJXA 4LS9A 2IW4A 3PVHA 4K7XA 2AZPA 5GL2A 5GL3A 2HAWA 2ZVFA 3PTJA 2KPTA 1BWZA 4RPAA 4LB0A 2QB7A 4DWZA 2QB6A 2Q9HA 3FVEA 1S7JA 1XUBA 5IWEA 3EKMA 2GKJA 4IJZA 4FC5A 2GKEA 1WPMA 4JD7A 4OA3A 2Q9JA 1SDJA 3WQZA 2PW0A 2KW7A 1U1XA 4Q2HA 5GL4A 1YM5A 4DUNA 4GL6A 1U1WA 2EB0A 5M47A 1IR6A 1TM0A 4LG3A 3G98A 1K23A 3EDNA 1U0KA 1WPPA 3ICJA 2ZXOA 1QY9A 3W5WA 2ZXRA 2ZXPA 4JUUA 1W62A 2MPBA 1GQZA 3PW9A 2OTNA 1XUAA 1WPNA 1K20A 4Q60A 4JBDA 4IK0A 1U1VA 2YMAA 4JCIA 1W61A 2QB8A 1T6KA 5H2YA 3DEVA 4K8LA 1QYAA 2LT2A 2H9FA 5H2GA 4J9WA 3IGHX 4K7GB 4J9XA 1I74A 4PY9A 5HA4A 5ANPA 2ENXA 3G7KA 5GKXA
chains in the Genus database with same CATH topology
2PVZA 3EJXA 4LS9A 2IW4A 3PVHA 4K7XA 2AZPA 5GL2A 5GL3A 2HAWA 2ZVFA 3PTJA 2KPTA 1BWZA 4RPAA 4LB0A 2QB7A 4DWZA 2QB6A 2Q9HA 3FVEA 1S7JA 1XUBA 5IWEA 3EKMA 2GKJA 4IJZA 4FC5A 2GKEA 1WPMA 4JD7A 4OA3A 2Q9JA 1SDJA 3WQZA 2PW0A 2KW7A 1U1XA 4Q2HA 5GL4A 1YM5A 4DUNA 4GL6A 1U1WA 2EB0A 5M47A 1IR6A 1TM0A 4LG3A 3G98A 1K23A 3EDNA 1U0KA 1WPPA 3ICJA 2ZXOA 1QY9A 3W5WA 2ZXRA 2ZXPA 4JUUA 1W62A 2MPBA 1GQZA 3PW9A 2OTNA 1XUAA 1WPNA 1K20A 4Q60A 4JBDA 4IK0A 1U1VA 2YMAA 4JCIA 1W61A 2QB8A 1T6KA 5H2YA 3DEVA 4K8LA 1QYAA 2LT2A 2H9FA 5H2GA 4J9WA 3IGHX 4K7GB 4J9XA 1I74A 4PY9A 5HA4A 5ANPA 2ENXA 3G7KA 5GKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPN A;  1I74 A;  1WPP A;  1K20 A;  4PY9 A;  3W5W A;  2QB8 A;  1WPM A;  2ENX A;  2HAW A;  4RPA A;  4LS9 A;  3DEV A;  2QB7 A;  2IW4 A;  1K23 A;  2EB0 A;  2QB6 A; 
#chains in the Genus database with same CATH topology
 2PVZ A;  3EJX A;  4LS9 A;  2IW4 A;  3PVH A;  4K7X A;  2AZP A;  5GL2 A;  5GL3 A;  2HAW A;  2ZVF A;  3PTJ A;  2KPT A;  1BWZ A;  4RPA A;  4LB0 A;  2QB7 A;  4DWZ A;  2QB6 A;  2Q9H A;  3FVE A;  1S7J A;  1XUB A;  5IWE A;  3EKM A;  2GKJ A;  4IJZ A;  4FC5 A;  2GKE A;  1WPM A;  4JD7 A;  4OA3 A;  2Q9J A;  1SDJ A;  3WQZ A;  2PW0 A;  2KW7 A;  1U1X A;  4Q2H A;  5GL4 A;  1YM5 A;  4DUN A;  4GL6 A;  1U1W A;  2EB0 A;  5M47 A;  1IR6 A;  1TM0 A;  4LG3 A;  3G98 A;  1K23 A;  3EDN A;  1U0K A;  1WPP A;  3ICJ A;  2ZXO A;  1QY9 A;  3W5W A;  2ZXR A;  2ZXP A;  4JUU A;  1W62 A;  2MPB A;  1GQZ A;  3PW9 A;  2OTN A;  1XUA A;  1WPN A;  1K20 A;  4Q60 A;  4JBD A;  4IK0 A;  1U1V A;  2YMA A;  4JCI A;  1W61 A;  2QB8 A;  1T6K A;  5H2Y A;  3DEV A;  4K8L A;  1QYA A;  2LT2 A;  2H9F A;  5H2G A;  4J9W A;  3IGH X;  4K7G B;  4J9X A;  1I74 A;  4PY9 A;  5HA4 A;  5ANP A;  2ENX A;  3G7K A;  5GKX A; 
#chains in the Genus database with same CATH homology
 2PVZ A;  3EJX A;  4LS9 A;  2IW4 A;  3PVH A;  4K7X A;  2AZP A;  5GL2 A;  5GL3 A;  2HAW A;  2ZVF A;  3PTJ A;  2KPT A;  1BWZ A;  4RPA A;  4LB0 A;  2QB7 A;  4DWZ A;  2QB6 A;  2Q9H A;  3FVE A;  1S7J A;  1XUB A;  5IWE A;  3EKM A;  2GKJ A;  4IJZ A;  4FC5 A;  2GKE A;  1WPM A;  4JD7 A;  4OA3 A;  2Q9J A;  1SDJ A;  3WQZ A;  2PW0 A;  2KW7 A;  1U1X A;  4Q2H A;  5GL4 A;  1YM5 A;  4DUN A;  4GL6 A;  1U1W A;  2EB0 A;  5M47 A;  1IR6 A;  1TM0 A;  4LG3 A;  3G98 A;  1K23 A;  3EDN A;  1U0K A;  1WPP A;  3ICJ A;  2ZXO A;  1QY9 A;  3W5W A;  2ZXR A;  2ZXP A;  4JUU A;  1W62 A;  2MPB A;  1GQZ A;  3PW9 A;  2OTN A;  1XUA A;  1WPN A;  1K20 A;  4Q60 A;  4JBD A;  4IK0 A;  1U1V A;  2YMA A;  4JCI A;  1W61 A;  2QB8 A;  1T6K A;  5H2Y A;  3DEV A;  4K8L A;  1QYA A;  2LT2 A;  2H9F A;  5H2G A;  4J9W A;  3IGH X;  4K7G B;  4J9X A;  1I74 A;  4PY9 A;  5HA4 A;  5ANP A;  2ENX A;  3G7K A;  5GKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...