2QB8A

Saccharomyces cerevisiae cytosolic exopolyphosphatase, atp complex
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
393
Chain Sequence
RKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Exopolyphosphatase
total genus 135
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature ec 3.6.1.11: Exopolyphosphatase.
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2qb8A02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2qb8A01
3W5WA 2QB7A 1WPPA 2HAWA 3DEVA 4LS9A 2QB8A 4PY9A 2IW4A 1I74A 1WPNA 2EB0A 2QB6A 4RPAA 1K20A 2ENXA 1WPMA 1K23A
chains in the Genus database with same CATH superfamily
3DEVA 1U1XA 1WPNA 1YM5A 4RPAA 3G98A 1BWZA 4LS9A 1W61A 3EJXA 1K23A 2ZXPA 3PTJA 2OTNA 1U0KA 4DUNA 2KW7A 5IWEA 4FC5A 4LG3A 3WQZA 1IR6A 1T6KA 2MPBA 4Q2HA 1U1VA 4DWZA 4LB0A 4JBDA 1QYAA 1WPPA 4IK0A 1U1WA 3PVHA 5GKXA 5GL3A 4J9WA 3EKMA 4OA3A 5GL4A 1W62A 4JUUA 2ENXA 4Q60A 2AZPA 4PY9A 2IW4A 4K8LA 2PVZA 4J9XA 5H2YA 4K7GB 1TM0A 3G7KA 1SDJA 2QB6A 1WPMA 3IGHX 2EB0A 3EDNA 5ANPA 2Q9JA 5M47A 3W5WA 1XUBA 4K7XA 2Q9HA 1S7JA 2LT2A 4JCIA 2PW0A 1GQZA 2ZXRA 2GKJA 2ZVFA 2QB8A 2H9FA 2KPTA 2YMAA 2ZXOA 4IJZA 5GL2A 1XUAA 1I74A 2QB7A 5HA4A 3PW9A 5H2GA 3ICJA 2HAWA 4GL6A 4JD7A 2GKEA 1QY9A 1K20A 3FVEA
chains in the Genus database with same CATH topology
3DEVA 1U1XA 1WPNA 1YM5A 4RPAA 3G98A 1BWZA 4LS9A 1W61A 3EJXA 1K23A 2ZXPA 3PTJA 2OTNA 1U0KA 4DUNA 2KW7A 5IWEA 4FC5A 4LG3A 3WQZA 1IR6A 1T6KA 2MPBA 4Q2HA 1U1VA 4DWZA 4LB0A 4JBDA 1QYAA 1WPPA 4IK0A 1U1WA 3PVHA 5GKXA 5GL3A 4J9WA 3EKMA 4OA3A 5GL4A 1W62A 4JUUA 2ENXA 4Q60A 2AZPA 4PY9A 2IW4A 4K8LA 2PVZA 4J9XA 5H2YA 4K7GB 1TM0A 3G7KA 1SDJA 2QB6A 1WPMA 3IGHX 2EB0A 3EDNA 5ANPA 2Q9JA 5M47A 3W5WA 1XUBA 4K7XA 2Q9HA 1S7JA 2LT2A 4JCIA 2PW0A 1GQZA 2ZXRA 2GKJA 2ZVFA 2QB8A 2H9FA 2KPTA 2YMAA 2ZXOA 4IJZA 5GL2A 1XUAA 1I74A 2QB7A 5HA4A 3PW9A 5H2GA 3ICJA 2HAWA 4GL6A 4JD7A 2GKEA 1QY9A 1K20A 3FVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5W A;  2QB7 A;  1WPP A;  2HAW A;  3DEV A;  4LS9 A;  2QB8 A;  4PY9 A;  2IW4 A;  1I74 A;  1WPN A;  2EB0 A;  2QB6 A;  4RPA A;  1K20 A;  2ENX A;  1WPM A;  1K23 A; 
#chains in the Genus database with same CATH topology
 3DEV A;  1U1X A;  1WPN A;  1YM5 A;  4RPA A;  3G98 A;  1BWZ A;  4LS9 A;  1W61 A;  3EJX A;  1K23 A;  2ZXP A;  3PTJ A;  2OTN A;  1U0K A;  4DUN A;  2KW7 A;  5IWE A;  4FC5 A;  4LG3 A;  3WQZ A;  1IR6 A;  1T6K A;  2MPB A;  4Q2H A;  1U1V A;  4DWZ A;  4LB0 A;  4JBD A;  1QYA A;  1WPP A;  4IK0 A;  1U1W A;  3PVH A;  5GKX A;  5GL3 A;  4J9W A;  3EKM A;  4OA3 A;  5GL4 A;  1W62 A;  4JUU A;  2ENX A;  4Q60 A;  2AZP A;  4PY9 A;  2IW4 A;  4K8L A;  2PVZ A;  4J9X A;  5H2Y A;  4K7G B;  1TM0 A;  3G7K A;  1SDJ A;  2QB6 A;  1WPM A;  3IGH X;  2EB0 A;  3EDN A;  5ANP A;  2Q9J A;  5M47 A;  3W5W A;  1XUB A;  4K7X A;  2Q9H A;  1S7J A;  2LT2 A;  4JCI A;  2PW0 A;  1GQZ A;  2ZXR A;  2GKJ A;  2ZVF A;  2QB8 A;  2H9F A;  2KPT A;  2YMA A;  2ZXO A;  4IJZ A;  5GL2 A;  1XUA A;  1I74 A;  2QB7 A;  5HA4 A;  3PW9 A;  5H2G A;  3ICJ A;  2HAW A;  4GL6 A;  4JD7 A;  2GKE A;  1QY9 A;  1K20 A;  3FVE A; 
#chains in the Genus database with same CATH homology
 3DEV A;  1U1X A;  1WPN A;  1YM5 A;  4RPA A;  3G98 A;  1BWZ A;  4LS9 A;  1W61 A;  3EJX A;  1K23 A;  2ZXP A;  3PTJ A;  2OTN A;  1U0K A;  4DUN A;  2KW7 A;  5IWE A;  4FC5 A;  4LG3 A;  3WQZ A;  1IR6 A;  1T6K A;  2MPB A;  4Q2H A;  1U1V A;  4DWZ A;  4LB0 A;  4JBD A;  1QYA A;  1WPP A;  4IK0 A;  1U1W A;  3PVH A;  5GKX A;  5GL3 A;  4J9W A;  3EKM A;  4OA3 A;  5GL4 A;  1W62 A;  4JUU A;  2ENX A;  4Q60 A;  2AZP A;  4PY9 A;  2IW4 A;  4K8L A;  2PVZ A;  4J9X A;  5H2Y A;  4K7G B;  1TM0 A;  3G7K A;  1SDJ A;  2QB6 A;  1WPM A;  3IGH X;  2EB0 A;  3EDN A;  5ANP A;  2Q9J A;  5M47 A;  3W5W A;  1XUB A;  4K7X A;  2Q9H A;  1S7J A;  2LT2 A;  4JCI A;  2PW0 A;  1GQZ A;  2ZXR A;  2GKJ A;  2ZVF A;  2QB8 A;  2H9F A;  2KPT A;  2YMA A;  2ZXO A;  4IJZ A;  5GL2 A;  1XUA A;  1I74 A;  2QB7 A;  5HA4 A;  3PW9 A;  5H2G A;  3ICJ A;  2HAW A;  4GL6 A;  4JD7 A;  2GKE A;  1QY9 A;  1K20 A;  3FVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...