2ENXA

Structure of the family ii inorganic pyrophosphatase from streptococcus agalactiae at 2.8 resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
310
structure length
310
Chain Sequence
SKILVFGHQNPDSDAIGSSVAFAYLAKEAWGLDTEAVALGTPNEETAYVLDYFGVQAPRVVESAKAEGVETVILTDHNEFQQSISDIKDVTVYGVVDHHRVANFETANPLYMRLEPVGSASSIVYRMFKENGVSVPKELAGLLLSGLISDTLLLKSPTTHASDIPVAKELAELAGVNLEEYGLEMLKAGTNLSSKTAAELIDIDAKTFELNGEAVRVAQVNTVDINDILARQEEIEVAIQEAIVTEGYSDFVLMITDIVNSNSEILALGSNMAKVEAAFEFTLENNHAFLAGAVSRKKQVVPQLTESYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Streptococcus agalactiae family II inorganic pyrophosphatase at 2.80 A resolution
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Hydrolase
molecule keywords Manganese-dependent inorganic pyrophosphatase
total genus 103
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2enxA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2enxA01
1I74A 1WPPA 2QB6A 1K20A 2ENXA 1WPNA 3DEVA 2IW4A 1K23A 2HAWA 1WPMA 2EB0A 4RPAA 3W5WA 2QB7A 4PY9A 2QB8A 4LS9A
chains in the Genus database with same CATH superfamily
4J9WA 5GL2A 1U1VA 5ANPA 4K7GB 5H2GA 2GKJA 1W62A 1WPPA 4IJZA 1K20A 4JUUA 4K8LA 2ZXRA 5IWEA 1BWZA 1U1XA 1SDJA 3G98A 2H9FA 2MPBA 2ZVFA 4OA3A 5H2YA 4IK0A 3PW9A 1YM5A 2ZXPA 1TM0A 4LB0A 1WPMA 2YMAA 1IR6A 2IW4A 4Q60A 2OTNA 1WPNA 4J9XA 4PY9A 4LS9A 3EKMA 4Q2HA 2ENXA 3WQZA 4FC5A 4DWZA 2AZPA 2QB8A 2PVZA 1S7JA 1XUBA 3IGHX 3FVEA 4K7XA 2QB7A 2QB6A 1T6KA 1GQZA 2KW7A 4RPAA 2LT2A 1U1WA 5M47A 3DEVA 1U0KA 2HAWA 2EB0A 2PW0A 3EJXA 4JBDA 2Q9HA 1W61A 1K23A 2GKEA 2KPTA 3W5WA 4JD7A 4DUNA 3G7KA 3PTJA 3PVHA 5HA4A 5GL3A 4GL6A 3EDNA 2Q9JA 3ICJA 5GKXA 1QY9A 4LG3A 1QYAA 1XUAA 1I74A 5GL4A 4JCIA 2ZXOA
chains in the Genus database with same CATH topology
4J9WA 5GL2A 1U1VA 5ANPA 4K7GB 5H2GA 2GKJA 1W62A 1WPPA 4IJZA 1K20A 4JUUA 4K8LA 2ZXRA 5IWEA 1BWZA 1U1XA 1SDJA 3G98A 2H9FA 2MPBA 2ZVFA 4OA3A 5H2YA 4IK0A 3PW9A 1YM5A 2ZXPA 1TM0A 4LB0A 1WPMA 2YMAA 1IR6A 2IW4A 4Q60A 2OTNA 1WPNA 4J9XA 4PY9A 4LS9A 3EKMA 4Q2HA 2ENXA 3WQZA 4FC5A 4DWZA 2AZPA 2QB8A 2PVZA 1S7JA 1XUBA 3IGHX 3FVEA 4K7XA 2QB7A 2QB6A 1T6KA 1GQZA 2KW7A 4RPAA 2LT2A 1U1WA 5M47A 3DEVA 1U0KA 2HAWA 2EB0A 2PW0A 3EJXA 4JBDA 2Q9HA 1W61A 1K23A 2GKEA 2KPTA 3W5WA 4JD7A 4DUNA 3G7KA 3PTJA 3PVHA 5HA4A 5GL3A 4GL6A 3EDNA 2Q9JA 3ICJA 5GKXA 1QY9A 4LG3A 1QYAA 1XUAA 1I74A 5GL4A 4JCIA 2ZXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I74 A;  1WPP A;  2QB6 A;  1K20 A;  2ENX A;  1WPN A;  3DEV A;  2IW4 A;  1K23 A;  2HAW A;  1WPM A;  2EB0 A;  4RPA A;  3W5W A;  2QB7 A;  4PY9 A;  2QB8 A;  4LS9 A; 
#chains in the Genus database with same CATH topology
 4J9W A;  5GL2 A;  1U1V A;  5ANP A;  4K7G B;  5H2G A;  2GKJ A;  1W62 A;  1WPP A;  4IJZ A;  1K20 A;  4JUU A;  4K8L A;  2ZXR A;  5IWE A;  1BWZ A;  1U1X A;  1SDJ A;  3G98 A;  2H9F A;  2MPB A;  2ZVF A;  4OA3 A;  5H2Y A;  4IK0 A;  3PW9 A;  1YM5 A;  2ZXP A;  1TM0 A;  4LB0 A;  1WPM A;  2YMA A;  1IR6 A;  2IW4 A;  4Q60 A;  2OTN A;  1WPN A;  4J9X A;  4PY9 A;  4LS9 A;  3EKM A;  4Q2H A;  2ENX A;  3WQZ A;  4FC5 A;  4DWZ A;  2AZP A;  2QB8 A;  2PVZ A;  1S7J A;  1XUB A;  3IGH X;  3FVE A;  4K7X A;  2QB7 A;  2QB6 A;  1T6K A;  1GQZ A;  2KW7 A;  4RPA A;  2LT2 A;  1U1W A;  5M47 A;  3DEV A;  1U0K A;  2HAW A;  2EB0 A;  2PW0 A;  3EJX A;  4JBD A;  2Q9H A;  1W61 A;  1K23 A;  2GKE A;  2KPT A;  3W5W A;  4JD7 A;  4DUN A;  3G7K A;  3PTJ A;  3PVH A;  5HA4 A;  5GL3 A;  4GL6 A;  3EDN A;  2Q9J A;  3ICJ A;  5GKX A;  1QY9 A;  4LG3 A;  1QYA A;  1XUA A;  1I74 A;  5GL4 A;  4JCI A;  2ZXO A; 
#chains in the Genus database with same CATH homology
 4J9W A;  5GL2 A;  1U1V A;  5ANP A;  4K7G B;  5H2G A;  2GKJ A;  1W62 A;  1WPP A;  4IJZ A;  1K20 A;  4JUU A;  4K8L A;  2ZXR A;  5IWE A;  1BWZ A;  1U1X A;  1SDJ A;  3G98 A;  2H9F A;  2MPB A;  2ZVF A;  4OA3 A;  5H2Y A;  4IK0 A;  3PW9 A;  1YM5 A;  2ZXP A;  1TM0 A;  4LB0 A;  1WPM A;  2YMA A;  1IR6 A;  2IW4 A;  4Q60 A;  2OTN A;  1WPN A;  4J9X A;  4PY9 A;  4LS9 A;  3EKM A;  4Q2H A;  2ENX A;  3WQZ A;  4FC5 A;  4DWZ A;  2AZP A;  2QB8 A;  2PVZ A;  1S7J A;  1XUB A;  3IGH X;  3FVE A;  4K7X A;  2QB7 A;  2QB6 A;  1T6K A;  1GQZ A;  2KW7 A;  4RPA A;  2LT2 A;  1U1W A;  5M47 A;  3DEV A;  1U0K A;  2HAW A;  2EB0 A;  2PW0 A;  3EJX A;  4JBD A;  2Q9H A;  1W61 A;  1K23 A;  2GKE A;  2KPT A;  3W5W A;  4JD7 A;  4DUN A;  3G7K A;  3PTJ A;  3PVH A;  5HA4 A;  5GL3 A;  4GL6 A;  3EDN A;  2Q9J A;  3ICJ A;  5GKX A;  1QY9 A;  4LG3 A;  1QYA A;  1XUA A;  1I74 A;  5GL4 A;  4JCI A;  2ZXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...