2ENXA

Structure of the family ii inorganic pyrophosphatase from streptococcus agalactiae at 2.8 resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
310
structure length
310
Chain Sequence
b'SKILVFGHQNPDSDAIGSSVAFAYLAKEAWGLDTEAVALGTPNEETAYVLDYFGVQAPRVVESAKAEGVETVILTDHNEFQQSISDIKDVTVYGVVDHHRVANFETANPLYMRLEPVGSASSIVYRMFKENGVSVPKELAGLLLSGLISDTLLLKSPTTHASDIPVAKELAELAGVNLEEYGLEMLKAGTNLSSKTAAELIDIDAKTFELNGEAVRVAQVNTVDINDILARQEEIEVAIQEAIVTEGYSDFVLMITDIVNSNSEILALGSNMAKVEAAFEFTLENNHAFLAGAVSRKKQVVPQLTESYNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese-dependent inorganic pyrophosphatase
publication title Structure of the Streptococcus agalactiae family II inorganic pyrophosphatase at 2.80 A resolution
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Hydrolase
total genus 103
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2enxA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2enxA01
3W5WA 2HAWA 2QB8A 2IW4A 2QB7A 4RPAA 1K23A 3DEVA 2ENXA 1I74A 4PY9A 1K20A 2EB0A 1WPPA 2QB6A 4LS9A 1WPMA 1WPNA
chains in the Genus database with same CATH superfamily
3EJXA 1XUAA 2PW0A 1K20A 2KW7A 1WPPA 1GQZA 1BWZA 1I74A 3EKMA 1IR6A 4JD7A 4DWZA 2MPBA 4RPAA 2IW4A 1XUBA 4Q2HA 2Q9HA 3G7KA 1T6KA 4K7GB 4LB0A 2GKJA 1QYAA 4JBDA 3EDNA 3IGHX 1YM5A 2ZVFA 5H2YA 4PY9A 2H9FA 4J9WA 2GKEA 2ZXRA 4IJZA 2ZXPA 2PVZA 3ICJA 4LS9A 1SDJA 3WQZA 2HAWA 2Q9JA 3PVHA 1TM0A 1S7JA 3W5WA 3PW9A 5M47A 4J9XA 4JUUA 4Q60A 5HA4A 1K23A 2EB0A 4K7XA 5H2GA 3FVEA 2QB8A 3DEVA 1W61A 2ENXA 1W62A 4LG3A 2LT2A 3PTJA 4FC5A 5GL3A 5GKXA 4IK0A 4GL6A 5IWEA 2YMAA 4K8LA 2QB6A 5GL4A 1WPMA 1U0KA 1WPNA 5ANPA 2KPTA 1QY9A 1U1XA 2AZPA 2OTNA 2ZXOA 5GL2A 3G98A 2QB7A 1U1WA 4JCIA 4OA3A 4DUNA 1U1VA
chains in the Genus database with same CATH topology
3EJXA 1XUAA 2PW0A 1K20A 2KW7A 1WPPA 1GQZA 1BWZA 1I74A 3EKMA 1IR6A 4JD7A 4DWZA 2MPBA 4RPAA 2IW4A 1XUBA 4Q2HA 2Q9HA 3G7KA 1T6KA 4K7GB 4LB0A 2GKJA 1QYAA 4JBDA 3EDNA 3IGHX 1YM5A 2ZVFA 5H2YA 4PY9A 2H9FA 4J9WA 2GKEA 2ZXRA 4IJZA 2ZXPA 2PVZA 3ICJA 4LS9A 1SDJA 3WQZA 2HAWA 2Q9JA 3PVHA 1TM0A 1S7JA 3W5WA 3PW9A 5M47A 4J9XA 4JUUA 4Q60A 5HA4A 1K23A 2EB0A 4K7XA 5H2GA 3FVEA 2QB8A 3DEVA 1W61A 2ENXA 1W62A 4LG3A 2LT2A 3PTJA 4FC5A 5GL3A 5GKXA 4IK0A 4GL6A 5IWEA 2YMAA 4K8LA 2QB6A 5GL4A 1WPMA 1U0KA 1WPNA 5ANPA 2KPTA 1QY9A 1U1XA 2AZPA 2OTNA 2ZXOA 5GL2A 3G98A 2QB7A 1U1WA 4JCIA 4OA3A 4DUNA 1U1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5W A;  2HAW A;  2QB8 A;  2IW4 A;  2QB7 A;  4RPA A;  1K23 A;  3DEV A;  2ENX A;  1I74 A;  4PY9 A;  1K20 A;  2EB0 A;  1WPP A;  2QB6 A;  4LS9 A;  1WPM A;  1WPN A; 
#chains in the Genus database with same CATH topology
 3EJX A;  1XUA A;  2PW0 A;  1K20 A;  2KW7 A;  1WPP A;  1GQZ A;  1BWZ A;  1I74 A;  3EKM A;  1IR6 A;  4JD7 A;  4DWZ A;  2MPB A;  4RPA A;  2IW4 A;  1XUB A;  4Q2H A;  2Q9H A;  3G7K A;  1T6K A;  4K7G B;  4LB0 A;  2GKJ A;  1QYA A;  4JBD A;  3EDN A;  3IGH X;  1YM5 A;  2ZVF A;  5H2Y A;  4PY9 A;  2H9F A;  4J9W A;  2GKE A;  2ZXR A;  4IJZ A;  2ZXP A;  2PVZ A;  3ICJ A;  4LS9 A;  1SDJ A;  3WQZ A;  2HAW A;  2Q9J A;  3PVH A;  1TM0 A;  1S7J A;  3W5W A;  3PW9 A;  5M47 A;  4J9X A;  4JUU A;  4Q60 A;  5HA4 A;  1K23 A;  2EB0 A;  4K7X A;  5H2G A;  3FVE A;  2QB8 A;  3DEV A;  1W61 A;  2ENX A;  1W62 A;  4LG3 A;  2LT2 A;  3PTJ A;  4FC5 A;  5GL3 A;  5GKX A;  4IK0 A;  4GL6 A;  5IWE A;  2YMA A;  4K8L A;  2QB6 A;  5GL4 A;  1WPM A;  1U0K A;  1WPN A;  5ANP A;  2KPT A;  1QY9 A;  1U1X A;  2AZP A;  2OTN A;  2ZXO A;  5GL2 A;  3G98 A;  2QB7 A;  1U1W A;  4JCI A;  4OA3 A;  4DUN A;  1U1V A; 
#chains in the Genus database with same CATH homology
 3EJX A;  1XUA A;  2PW0 A;  1K20 A;  2KW7 A;  1WPP A;  1GQZ A;  1BWZ A;  1I74 A;  3EKM A;  1IR6 A;  4JD7 A;  4DWZ A;  2MPB A;  4RPA A;  2IW4 A;  1XUB A;  4Q2H A;  2Q9H A;  3G7K A;  1T6K A;  4K7G B;  4LB0 A;  2GKJ A;  1QYA A;  4JBD A;  3EDN A;  3IGH X;  1YM5 A;  2ZVF A;  5H2Y A;  4PY9 A;  2H9F A;  4J9W A;  2GKE A;  2ZXR A;  4IJZ A;  2ZXP A;  2PVZ A;  3ICJ A;  4LS9 A;  1SDJ A;  3WQZ A;  2HAW A;  2Q9J A;  3PVH A;  1TM0 A;  1S7J A;  3W5W A;  3PW9 A;  5M47 A;  4J9X A;  4JUU A;  4Q60 A;  5HA4 A;  1K23 A;  2EB0 A;  4K7X A;  5H2G A;  3FVE A;  2QB8 A;  3DEV A;  1W61 A;  2ENX A;  1W62 A;  4LG3 A;  2LT2 A;  3PTJ A;  4FC5 A;  5GL3 A;  5GKX A;  4IK0 A;  4GL6 A;  5IWE A;  2YMA A;  4K8L A;  2QB6 A;  5GL4 A;  1WPM A;  1U0K A;  1WPN A;  5ANP A;  2KPT A;  1QY9 A;  1U1X A;  2AZP A;  2OTN A;  2ZXO A;  5GL2 A;  3G98 A;  2QB7 A;  1U1W A;  4JCI A;  4OA3 A;  4DUN A;  1U1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...