The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
62
|
sequence length |
201
|
structure length |
190
|
Chain Sequence |
TECTIVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Recognition of hemi-methylated DNA by the SRA protein UHRF1 by a base-flipping mechanism
pubmed doi rcsb |
molecule tags |
Ligase
|
source organism |
Mus musculus
|
molecule keywords |
E3 ubiquitin-protein ligase UHRF1
|
total genus |
62
|
structure length |
190
|
sequence length |
201
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
2.3.2.27: RING-type E3 ubiquitin transferase. |
pdb deposition date | 2008-03-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02182 | SAD_SRA | SAD/SRA domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | PUA domain-like | SRA-YDG |
#chains in the Genus database with same CATH superfamily 3F8I A; 2PB7 A; 2ZO0 B; 2ZKF A; 3F8J B; 2ZO2 B; 4PW7 A; 4PW6 A; 2ZKE A; 3FDE A; 3OLN A; 4NJ5 A; 2ZKD A; 4PW5 A; 3DWH A; 2ZO1 B; 2ZKG A; 3CLZ A; 3BI7 A; #chains in the Genus database with same CATH topology 4F0P A; 4YGI A; 3F8I A; 2PB7 A; 2ZO0 B; 4OC8 A; 2ZKF A; 3Q0F A; 3F8J B; 2ZO2 B; 4PW7 A; 4PW6 A; 2ZKE A; 3Q0C A; 3FDE A; 3OLN A; 3Q0D A; 4F0Q A; 4NJ5 A; 2ZKD A; 4R28 A; 3Q0B X; 3DWH A; 4PW5 A; 4RZL A; 2ZO1 B; 2ZKG A; 3CLZ A; 3BI7 A; #chains in the Genus database with same CATH homology 3F8I A; 2PB7 A; 2ZO0 B; 2ZKF A; 3F8J B; 2ZO2 B; 4PW7 A; 4PW6 A; 2ZKE A; 3FDE A; 3OLN A; 4NJ5 A; 2ZKD A; 4PW5 A; 3DWH A; 2ZO1 B; 2ZKG A; 3CLZ A; 3BI7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...