4PW5A

Structure of uhrf2-sra in complex with a 5hmc-containing dna, complex i
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
189
Chain Sequence
b'IVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF2
publication title Structural Basis for Hydroxymethylcytosine Recognition by the SRA Domain of UHRF2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna
total genus 59
structure length 189
sequence length 201
chains with identical sequence B, E, F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 4pw5A01
2ZKGA 2PB7A 2ZKDA 2ZO1B 4PW7A 3F8JB 3F8IA 3OLNA 3BI7A 2ZO2B 2ZO0B 4PW6A 3CLZA 3FDEA 2ZKEA 4PW5A 3DWHA 4NJ5A 2ZKFA
chains in the Genus database with same CATH superfamily
2ZKGA 2PB7A 4F0QA 2ZKDA 3Q0CA 4R28A 2ZO1B 4PW7A 3F8JB 4YGIA 3Q0DA 3F8IA 3OLNA 3Q0BX 3BI7A 2ZO2B 3Q0FA 2ZO0B 4PW6A 3CLZA 3FDEA 4OC8A 2ZKEA 4RZLA 3DWHA 4F0PA 4PW5A 4NJ5A 2ZKFA
chains in the Genus database with same CATH topology
2ZKGA 2PB7A 2ZKDA 2ZO1B 4PW7A 3F8JB 3F8IA 3OLNA 3BI7A 2ZO2B 2ZO0B 4PW6A 3CLZA 3FDEA 2ZKEA 4PW5A 3DWHA 4NJ5A 2ZKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZKG A;  2PB7 A;  2ZKD A;  2ZO1 B;  4PW7 A;  3F8J B;  3F8I A;  3OLN A;  3BI7 A;  2ZO2 B;  2ZO0 B;  4PW6 A;  3CLZ A;  3FDE A;  2ZKE A;  4PW5 A;  3DWH A;  4NJ5 A;  2ZKF A; 
#chains in the Genus database with same CATH topology
 2ZKG A;  2PB7 A;  4F0Q A;  2ZKD A;  3Q0C A;  4R28 A;  2ZO1 B;  4PW7 A;  3F8J B;  4YGI A;  3Q0D A;  3F8I A;  3OLN A;  3Q0B X;  3BI7 A;  2ZO2 B;  3Q0F A;  2ZO0 B;  4PW6 A;  3CLZ A;  3FDE A;  4OC8 A;  2ZKE A;  4RZL A;  3DWH A;  4F0P A;  4PW5 A;  4NJ5 A;  2ZKF A; 
#chains in the Genus database with same CATH homology
 2ZKG A;  2PB7 A;  2ZKD A;  2ZO1 B;  4PW7 A;  3F8J B;  3F8I A;  3OLN A;  3BI7 A;  2ZO2 B;  2ZO0 B;  4PW6 A;  3CLZ A;  3FDE A;  2ZKE A;  4PW5 A;  3DWH A;  4NJ5 A;  2ZKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...