2ZO1B

Mouse np95 sra domain dna specific complex 2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
206
Chain Sequence
b'HMPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYLEALANK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DTP*DCP*DCP*DAP*DTP*DGP*DCP*DGP*DCP*DTP*DGP*DAP*D
publication title The SRA domain of UHRF1 flips 5-methylcytosine out of the DNA helix
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/dna
total genus 60
structure length 206
sequence length 206
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 2zo1B01
2ZO2B 2ZO0B 2ZO1B 4PW7A 3OLNA 4PW6A 4PW5A 3DWHA 2ZKGA 2ZKEA 4NJ5A 3CLZA 3F8IA 2PB7A 2ZKFA 3FDEA 2ZKDA 3F8JB 3BI7A
chains in the Genus database with same CATH superfamily
4OC8A 4R28A 4F0PA 2ZO2B 2ZO0B 2ZO1B 3Q0CA 3Q0DA 4PW7A 3Q0BX 3OLNA 4YGIA 4PW6A 4PW5A 3DWHA 2ZKGA 2ZKEA 4F0QA 4NJ5A 3CLZA 4RZLA 3F8IA 2PB7A 2ZKFA 3FDEA 2ZKDA 3Q0FA 3F8JB 3BI7A
chains in the Genus database with same CATH topology
2ZO2B 2ZO0B 2ZO1B 4PW7A 3OLNA 4PW6A 4PW5A 3DWHA 2ZKGA 2ZKEA 4NJ5A 3CLZA 3F8IA 2PB7A 2ZKFA 3FDEA 2ZKDA 3F8JB 3BI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZO2 B;  2ZO0 B;  2ZO1 B;  4PW7 A;  3OLN A;  4PW6 A;  4PW5 A;  3DWH A;  2ZKG A;  2ZKE A;  4NJ5 A;  3CLZ A;  3F8I A;  2PB7 A;  2ZKF A;  3FDE A;  2ZKD A;  3F8J B;  3BI7 A; 
#chains in the Genus database with same CATH topology
 4OC8 A;  4R28 A;  4F0P A;  2ZO2 B;  2ZO0 B;  2ZO1 B;  3Q0C A;  3Q0D A;  4PW7 A;  3Q0B X;  3OLN A;  4YGI A;  4PW6 A;  4PW5 A;  3DWH A;  2ZKG A;  2ZKE A;  4F0Q A;  4NJ5 A;  3CLZ A;  4RZL A;  3F8I A;  2PB7 A;  2ZKF A;  3FDE A;  2ZKD A;  3Q0F A;  3F8J B;  3BI7 A; 
#chains in the Genus database with same CATH homology
 2ZO2 B;  2ZO0 B;  2ZO1 B;  4PW7 A;  3OLN A;  4PW6 A;  4PW5 A;  3DWH A;  2ZKG A;  2ZKE A;  4NJ5 A;  3CLZ A;  3F8I A;  2PB7 A;  2ZKF A;  3FDE A;  2ZKD A;  3F8J B;  3BI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...