3Q0CA

Crystal structure of suvh5 sra-fully methylated cg dna complex in space group p6122
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
162
structure length
144
Chain Sequence
b'QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title A dual flip-out mechanism for 5mC recognition by the Arabidopsis SUVH5 SRA domain and its impact on DNA methylation and H3K9 dimethylation in vivo.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase/dna
total genus 32
structure length 144
sequence length 162
chains with identical sequence X
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.30 Mainly Beta Roll PUA domain-like PUA domain-like 3q0cA00
3Q0DA 4YGIA 3Q0CA 3Q0FA 3Q0BX
chains in the Genus database with same CATH superfamily
3Q0DA 4R28A 2ZKEA 2PB7A 2ZO0B 4RZLA 2ZKFA 4PW6A 4F0QA 4OC8A 2ZKDA 2ZKGA 3BI7A 3OLNA 3Q0BX 3CLZA 4PW5A 3F8IA 4F0PA 4PW7A 3F8JB 3DWHA 2ZO2B 4YGIA 3Q0CA 3FDEA 2ZO1B 3Q0FA 4NJ5A
chains in the Genus database with same CATH topology
4F0QA 3Q0DA 4R28A 4OC8A 4F0PA 4YGIA 3Q0CA 4RZLA 3Q0FA 3Q0BX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0D A;  4YGI A;  3Q0C A;  3Q0F A;  3Q0B X; 
#chains in the Genus database with same CATH topology
 3Q0D A;  4R28 A;  2ZKE A;  2PB7 A;  2ZO0 B;  4RZL A;  2ZKF A;  4PW6 A;  4F0Q A;  4OC8 A;  2ZKD A;  2ZKG A;  3BI7 A;  3OLN A;  3Q0B X;  3CLZ A;  4PW5 A;  3F8I A;  4F0P A;  4PW7 A;  3F8J B;  3DWH A;  2ZO2 B;  4YGI A;  3Q0C A;  3FDE A;  2ZO1 B;  3Q0F A;  4NJ5 A; 
#chains in the Genus database with same CATH homology
 4F0Q A;  3Q0D A;  4R28 A;  4OC8 A;  4F0P A;  4YGI A;  3Q0C A;  4RZL A;  3Q0F A;  3Q0B X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...