2ZO0B

Mouse np95 sra domain dna specific complex 1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
209
structure length
209
Chain Sequence
b'HMPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYLEALANKEKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title The SRA domain of UHRF1 flips 5-methylcytosine out of the DNA helix
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/dna
total genus 60
structure length 209
sequence length 209
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 2zo0B01
2ZO0B 3OLNA 3F8IA 2ZO2B 4PW7A 3FDEA 2ZKEA 3F8JB 4PW6A 3BI7A 2ZO1B 2ZKDA 2PB7A 2ZKFA 3CLZA 2ZKGA 4PW5A 4NJ5A 3DWHA
chains in the Genus database with same CATH superfamily
4OC8A 4F0PA 2ZO0B 3OLNA 3Q0CA 3F8IA 2ZO2B 4PW7A 3FDEA 4RZLA 2ZKEA 3F8JB 3Q0BX 4R28A 3Q0FA 4PW6A 4F0QA 4YGIA 3BI7A 2ZO1B 2ZKDA 2PB7A 2ZKFA 3CLZA 2ZKGA 4PW5A 4NJ5A 3Q0DA 3DWHA
chains in the Genus database with same CATH topology
2ZO0B 3OLNA 3F8IA 2ZO2B 4PW7A 3FDEA 2ZKEA 3F8JB 4PW6A 3BI7A 2ZO1B 2ZKDA 2PB7A 2ZKFA 3CLZA 2ZKGA 4PW5A 4NJ5A 3DWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZO0 B;  3OLN A;  3F8I A;  2ZO2 B;  4PW7 A;  3FDE A;  2ZKE A;  3F8J B;  4PW6 A;  3BI7 A;  2ZO1 B;  2ZKD A;  2PB7 A;  2ZKF A;  3CLZ A;  2ZKG A;  4PW5 A;  4NJ5 A;  3DWH A; 
#chains in the Genus database with same CATH topology
 4OC8 A;  4F0P A;  2ZO0 B;  3OLN A;  3Q0C A;  3F8I A;  2ZO2 B;  4PW7 A;  3FDE A;  4RZL A;  2ZKE A;  3F8J B;  3Q0B X;  4R28 A;  3Q0F A;  4PW6 A;  4F0Q A;  4YGI A;  3BI7 A;  2ZO1 B;  2ZKD A;  2PB7 A;  2ZKF A;  3CLZ A;  2ZKG A;  4PW5 A;  4NJ5 A;  3Q0D A;  3DWH A; 
#chains in the Genus database with same CATH homology
 2ZO0 B;  3OLN A;  3F8I A;  2ZO2 B;  4PW7 A;  3FDE A;  2ZKE A;  3F8J B;  4PW6 A;  3BI7 A;  2ZO1 B;  2ZKD A;  2PB7 A;  2ZKF A;  3CLZ A;  2ZKG A;  4PW5 A;  4NJ5 A;  3DWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...