The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
206
|
structure length |
194
|
Chain Sequence |
PSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANAH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis for recognition of hemi-methylated DNA by the SRA domain of human UHRF1.
pubmed doi rcsb |
| molecule keywords |
E3 ubiquitin-protein ligase UHRF1
|
| molecule tags |
Ligase
|
| source organism |
Homo sapiens
|
| total genus |
57
|
| structure length |
194
|
| sequence length |
206
|
| ec nomenclature |
ec
2.3.2.27: RING-type E3 ubiquitin transferase. |
| pdb deposition date | 2007-11-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02182 | SAD_SRA | SAD/SRA domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | PUA domain-like | SRA-YDG |
#chains in the Genus database with same CATH superfamily 4NJ5 A; 3F8I A; 4PW6 A; 2ZKG A; 3OLN A; 3CLZ A; 4PW5 A; 2ZO1 B; 2PB7 A; 2ZKD A; 3FDE A; 2ZO2 B; 2ZO0 B; 3F8J B; 3BI7 A; 2ZKE A; 4PW7 A; 2ZKF A; 3DWH A; #chains in the Genus database with same CATH topology 4NJ5 A; 3F8I A; 4PW6 A; 2ZKG A; 3OLN A; 3CLZ A; 3Q0B X; 4PW5 A; 4YGI A; 2ZO1 B; 4R28 A; 2PB7 A; 2ZKD A; 4F0P A; 3FDE A; 3Q0C A; 3Q0F A; 2ZO2 B; 4F0Q A; 2ZO0 B; 3F8J B; 3BI7 A; 4OC8 A; 2ZKE A; 3Q0D A; 2ZKF A; 3DWH A; 4RZL A; 4PW7 A; #chains in the Genus database with same CATH homology 4NJ5 A; 3F8I A; 4PW6 A; 2ZKG A; 3OLN A; 3CLZ A; 4PW5 A; 2ZO1 B; 2PB7 A; 2ZKD A; 3FDE A; 2ZO2 B; 2ZO0 B; 3F8J B; 3BI7 A; 2ZKE A; 4PW7 A; 2ZKF A; 3DWH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
