The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
156
|
structure length |
153
|
Chain Sequence |
ENLYFQGMNISEINGFEVTGFVVRTTNADEMNPMTAKIGNLWEKFYLNAAPKLTDKSKVYGLYTNYESDFTGAFDVIACSDTLSPQLLSESVKTKVSSGKYVTFSATGEMPQVVIDLWNEVWNYFACPHKRAYTTDFEYYKSANTVEISIAVR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of an Integron Gene Cassette-Associated Protein from Vibrio cholerae Identifies a Cationic Drug-Binding Module.
pubmed doi rcsb |
| molecule keywords |
Integron cassette protein VCH_CASS2
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Vibrio cholerae
|
| total genus |
36
|
| structure length |
153
|
| sequence length |
156
|
| ec nomenclature | |
| pdb deposition date | 2009-03-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF14526 | Cass2 | Integron-associated effector binding protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Barrel | Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A | Regulatory factor, effector binding domain |
#chains in the Genus database with same CATH superfamily 3D70 A; 4AYZ A; 3D71 A; 1EXJ A; 2GOV A; 3R8J A; 3IAO A; 2BOW A; 3Q2Y A; 3Q3D A; 3Q5P A; 2KCU A; 5GQQ A; 3Q5R A; 1R8E A; 3E0H A; 5KAX A; 3GK6 A; 1BOW A; 3Q5S A; 5KAV A; 4B0Y A; 5KAU A; 3R8K A; 3D6Z A; 4A1M A; 1EXI A; 5KCB A; 3D6Y A; 3LUR A; 5KAW A; 2HVA A; 3B49 A; 3Q1M A; 1D5Y A; 5KAT A; 1JYH A; 4AYZ B; #chains in the Genus database with same CATH topology 3D70 A; 4AYZ A; 3D71 A; 1EXJ A; 2GOV A; 3R8J A; 3IAO A; 2BOW A; 3Q2Y A; 3Q3D A; 3Q5P A; 2KCU A; 5GQQ A; 3Q5R A; 1R8E A; 3E0H A; 5KAX A; 3GK6 A; 1BOW A; 3Q5S A; 5KAV A; 4B0Y A; 5KAU A; 3R8K A; 3D6Z A; 4A1M A; 1EXI A; 5KCB A; 3D6Y A; 3LUR A; 5KAW A; 2HVA A; 3B49 A; 3Q1M A; 1D5Y A; 5KAT A; 1JYH A; 4AYZ B; #chains in the Genus database with same CATH homology 3D70 A; 4AYZ A; 3D71 A; 1EXJ A; 2GOV A; 3R8J A; 3IAO A; 2BOW A; 3Q2Y A; 3Q3D A; 3Q5P A; 2KCU A; 5GQQ A; 3Q5R A; 1R8E A; 3E0H A; 5KAX A; 3GK6 A; 1BOW A; 3Q5S A; 5KAV A; 4B0Y A; 5KAU A; 3R8K A; 3D6Z A; 4A1M A; 1EXI A; 5KCB A; 3D6Y A; 3LUR A; 5KAW A; 2HVA A; 3B49 A; 3Q1M A; 1D5Y A; 5KAT A; 1JYH A; 4AYZ B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...