The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
163
|
structure length |
148
|
Chain Sequence |
QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELPW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A dual flip-out mechanism for 5mC recognition by the Arabidopsis SUVH5 SRA domain and its impact on DNA methylation and H3K9 dimethylation in vivo.
pubmed doi rcsb |
| molecule tags |
Transferase/dna
|
| source organism |
Arabidopsis thaliana
|
| molecule keywords |
Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
|
| total genus |
35
|
| structure length |
148
|
| sequence length |
163
|
| ec nomenclature |
ec
2.1.1.43: Histone-lysine N-methyltransferase. |
| pdb deposition date | 2010-12-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| X | PF02182 | SAD_SRA | SAD/SRA domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | PUA domain-like | PUA domain-like |
#chains in the Genus database with same CATH superfamily 3Q0D A; 3Q0C A; 4YGI A; 3Q0B X; 3Q0F A; #chains in the Genus database with same CATH topology 3F8J B; 4OC8 A; 4NJ5 A; 2ZKF A; 2ZKE A; 3Q0F A; 4PW7 A; 4YGI A; 2PB7 A; 3OLN A; 2ZO2 B; 4F0P A; 3BI7 A; 3FDE A; 3F8I A; 2ZKG A; 3CLZ A; 3Q0C A; 4RZL A; 2ZKD A; 3DWH A; 4PW5 A; 3Q0D A; 4R28 A; 4F0Q A; 4PW6 A; 2ZO0 B; 3Q0B X; 2ZO1 B; #chains in the Genus database with same CATH homology 4OC8 A; 3Q0D A; 4R28 A; 4F0Q A; 3Q0C A; 4RZL A; 4YGI A; 3Q0B X; 4F0P A; 3Q0F A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
