3RRLA

Complex structure of 3-oxoadipate coa-transferase subunit a and b from helicobacter pylori 26695
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
230
structure length
230
Chain Sequence
MNKVITDLDKALSALKDGDTILVGGFGLCGIPEYAIDYIYKKGIKDLIVVSNNCGVDDFGLGILLEKKQIKKIIASYVGENKIFESQMLNGEIEVVLTPQGTLAENLHAGGAGIPAYYTPTGVGTLIAQGKESREFNGKEYILERAITGDYGLIKAYKSDTLGNLVFRKTARNFNPLCAMAAKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEKFEKRIEKITTRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
publication title Complex structure of 3-oxoadipate coA-transferase subunit A and B from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 64
structure length 230
sequence length 230
chains with identical sequence C
ec nomenclature ec 2.8.3.5: 3-oxoacid CoA-transferase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01144 CoA_trans Coenzyme A transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3rrlA01
1XR4A 2AHUA 1M3EA 3EH7A 2NRBA 3RRLB 3K6MA 3DLXA 2AHWA 3QDQA 5DBNB 1POIB 2NRCA 1OOYA 1OPEA 3CDKA 1K6DA 1O9LA 3OXOA 3D3UA 4KGBA 3GK7A 3RRLA 2HJ0A 5DBNA 1POIA 3CDKB 1OOZA 2OASA 2AHVA
chains in the Genus database with same CATH superfamily
1XR4A 2AHUA 1M3EA 3EH7A 2NRBA 3RRLB 3K6MA 3DLXA 2AHWA 3QDQA 5DBNB 1POIB 2NRCA 1OOYA 1OPEA 3CDKA 1K6DA 1O9LA 3OXOA 3D3UA 4KGBA 3GK7A 3RRLA 2HJ0A 5DBNA 1POIA 3CDKB 1OOZA 2OASA 2AHVA
chains in the Genus database with same CATH topology
1XR4A 2AHUA 1M3EA 3EH7A 2NRBA 3RRLB 3K6MA 3DLXA 2AHWA 3QDQA 5DBNB 1POIB 2NRCA 1OOYA 1OPEA 3CDKA 1K6DA 1O9LA 3OXOA 3D3UA 4KGBA 3GK7A 3RRLA 2HJ0A 5DBNA 1POIA 3CDKB 1OOZA 2OASA 2AHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XR4 A;  2AHU A;  1M3E A;  3EH7 A;  2NRB A;  3RRL B;  3K6M A;  3DLX A;  2AHW A;  3QDQ A;  5DBN B;  1POI B;  2NRC A;  1OOY A;  1OPE A;  3CDK A;  1K6D A;  1O9L A;  3OXO A;  3D3U A;  4KGB A;  3GK7 A;  3RRL A;  2HJ0 A;  5DBN A;  1POI A;  3CDK B;  1OOZ A;  2OAS A;  2AHV A; 
#chains in the Genus database with same CATH topology
 1XR4 A;  2AHU A;  1M3E A;  3EH7 A;  2NRB A;  3RRL B;  3K6M A;  3DLX A;  2AHW A;  3QDQ A;  5DBN B;  1POI B;  2NRC A;  1OOY A;  1OPE A;  3CDK A;  1K6D A;  1O9L A;  3OXO A;  3D3U A;  4KGB A;  3GK7 A;  3RRL A;  2HJ0 A;  5DBN A;  1POI A;  3CDK B;  1OOZ A;  2OAS A;  2AHV A; 
#chains in the Genus database with same CATH homology
 1XR4 A;  2AHU A;  1M3E A;  3EH7 A;  2NRB A;  3RRL B;  3K6M A;  3DLX A;  2AHW A;  3QDQ A;  5DBN B;  1POI B;  2NRC A;  1OOY A;  1OPE A;  3CDK A;  1K6D A;  1O9L A;  3OXO A;  3D3U A;  4KGB A;  3GK7 A;  3RRL A;  2HJ0 A;  5DBN A;  1POI A;  3CDK B;  1OOZ A;  2OAS A;  2AHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...