2OASA

Crystal structure of 4-hydroxybutyrate coenzyme a transferase (atoa) in complex with coa from shewanella oneidensis, northeast structural genomics target sor119.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
427
structure length
427
Chain Sequence
PAIVCQSALEAVSLIRSGETLWTHSMGATPKVLLDALAKHALTLDNITLLQLHTEGAESLSHPSLLGHLRHRCFFGGVPTRPLLQSGDADYVPIFLSEVPKLFRSGEQKIDTAIIQVSPPDKHGMCSLGISVEATLAACQVAGKIIAHINPQMPRTHGDGFIHIDRFAAVYEQSASLPIHSFATGDAVSLAIGQHVAELVRDGDCLQMGIGAIPDAVLSCLTGHKDLGVHTELFSDGILQLVEKGVINNTKKRFYPGKLVTGFALGSQKLYDYVDDNPAVIFMDIEQVNDTSIIRKNPNVMAINSALQVDLTGQVCADSIGTKIYSGVGGQMDFIRGAGLSEGGRSVIALPSTAAGGRISRIASVLSPGAGVVTTRAHVHYIVTEYGAANLKGRSLRERAQALINIAHPDFREQLSRDAFEVWGLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 4-hydroxybutyrate coenzyme A transferase
publication title Crystal Structure of 4-hydroxybutyrate coenzyme A transferase (AtoA) from Shewanella oneidensis in complex with CoA, Northeast Structural Genomics Target SoR119.
rcsb
source organism Shewanella oneidensis
molecule tags Transferase
total genus 134
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain
A PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.70 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA 4-hydroxybutyrate coenzyme like domains 2oasA02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 2oasA01
3.40.1080.20 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 2oasA03
2NRCA 1M3EA 2AHWA 1O9LA 3OXOA 2NRBA 3RRLB 1POIA 3DLXA 5DBNA 2OASA 1K6DA 2AHVA 3EH7A 4KGBA 3CDKA 3K6MA 3QDQA 3D3UA 2HJ0A 1OOYA 3RRLA 1POIB 1XR4A 5DBNB 1OOZA 3GK7A 1OPEA 3CDKB 2AHUA
chains in the Genus database with same CATH superfamily
3ZTBA 4HIZA 2ZOAA 2AHWA 1AUZA 3OIRA 5EUZA 4L1CA 3D03A 1T6RA 4AE2A 1H4XA 1HF2A 3OIZA 2OASA 3MOGA 4GHNA 1VC1A 1TIDB 3CDKA 1TILB 3F43A 3LKLA 2RRLA 1H4YA 2VY9A 3D3UA 2CWWA 3V97A 3RRLA 1POIB 4DGHA 3AGEA 5DBNB 3JU4A 1WXWA 2AHUA 3IH8A 5EUUA 4L8KA 4DGFA 5DBNA 1N6EA 2KA5A 3GVKA 3DUPA 2AHVA 3V8VA 3QDQA 3IHAA 1N6FA 1OOYA 2B78A 3IH9A 2DXNA 5EUWA 5EUSA 1XR4A 3C0KA 1TH8B 3GVJA 1FC6A 1FCFA 1V0FA 2NRCA 1M3EA 1WXXA 3LDFA 1O9LA 1K32A 3T6OA 1POIA 2AS0A 3DLXA 1FC7A 1BUZA 3GVLA 4QTPA 3IF5A 1V0EA 3DORA 3VSEA 5EUXA 3AGDA 2KLNA 3GMFA 2ZO9B 3GK7A 3CDKB 3IHBA 4JC0A 4AEJA 3OXOA 2NRBA 3DJAA 3RRLB 4HYLA 3MGLA 3GHFA 2DXLA 1THNB 1K6DA 3EH7A 4KGBA 5EZBA 1N6DA 3K6MA 1FC9A 2HJ0A 1SBOA 4DMGA 3NY7A 1H4ZA 3K50A 3ZXNA 1J7XA 3LLOA 1OOZA 4XS5A 1OPEA 1BPLA
chains in the Genus database with same CATH topology
2NRCA 1M3EA 2AHWA 1O9LA 3OXOA 2NRBA 3RRLB 1POIA 3DLXA 5DBNA 2OASA 1K6DA 2AHVA 3EH7A 4KGBA 3CDKA 3K6MA 3QDQA 3D3UA 2HJ0A 1OOYA 3RRLA 1POIB 1XR4A 5DBNB 1OOZA 3GK7A 1OPEA 3CDKB 2AHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRC A;  1M3E A;  2AHW A;  1O9L A;  3OXO A;  2NRB A;  3RRL B;  1POI A;  3DLX A;  5DBN A;  2OAS A;  1K6D A;  2AHV A;  3EH7 A;  4KGB A;  3CDK A;  3K6M A;  3QDQ A;  3D3U A;  2HJ0 A;  1OOY A;  3RRL A;  1POI B;  1XR4 A;  5DBN B;  1OOZ A;  3GK7 A;  1OPE A;  3CDK B;  2AHU A; 
#chains in the Genus database with same CATH topology
 3ZTB A;  4HIZ A;  2ZOA A;  2AHW A;  1AUZ A;  3OIR A;  5EUZ A;  4L1C A;  3D03 A;  1T6R A;  4AE2 A;  1H4X A;  1HF2 A;  3OIZ A;  2OAS A;  3MOG A;  4GHN A;  1VC1 A;  1TID B;  3CDK A;  1TIL B;  3F43 A;  3LKL A;  2RRL A;  1H4Y A;  2VY9 A;  3D3U A;  2CWW A;  3V97 A;  3RRL A;  1POI B;  4DGH A;  3AGE A;  5DBN B;  3JU4 A;  1WXW A;  2AHU A;  3IH8 A;  5EUU A;  4L8K A;  4DGF A;  5DBN A;  1N6E A;  2KA5 A;  3GVK A;  3DUP A;  2AHV A;  3V8V A;  3QDQ A;  3IHA A;  1N6F A;  1OOY A;  2B78 A;  3IH9 A;  2DXN A;  5EUW A;  5EUS A;  1XR4 A;  3C0K A;  1TH8 B;  3GVJ A;  1FC6 A;  1FCF A;  1V0F A;  2NRC A;  1M3E A;  1WXX A;  3LDF A;  1O9L A;  1K32 A;  3T6O A;  1POI A;  2AS0 A;  3DLX A;  1FC7 A;  1BUZ A;  3GVL A;  4QTP A;  3IF5 A;  1V0E A;  3DOR A;  3VSE A;  5EUX A;  3AGD A;  2KLN A;  3GMF A;  2ZO9 B;  3GK7 A;  3CDK B;  3IHB A;  4JC0 A;  4AEJ A;  3OXO A;  2NRB A;  3DJA A;  3RRL B;  4HYL A;  3MGL A;  3GHF A;  2DXL A;  1THN B;  1K6D A;  3EH7 A;  4KGB A;  5EZB A;  1N6D A;  3K6M A;  1FC9 A;  2HJ0 A;  1SBO A;  4DMG A;  3NY7 A;  1H4Z A;  3K50 A;  3ZXN A;  1J7X A;  3LLO A;  1OOZ A;  4XS5 A;  1OPE A;  1BPL A; 
#chains in the Genus database with same CATH homology
 2NRC A;  1M3E A;  2AHW A;  1O9L A;  3OXO A;  2NRB A;  3RRL B;  1POI A;  3DLX A;  5DBN A;  2OAS A;  1K6D A;  2AHV A;  3EH7 A;  4KGB A;  3CDK A;  3K6M A;  3QDQ A;  3D3U A;  2HJ0 A;  1OOY A;  3RRL A;  1POI B;  1XR4 A;  5DBN B;  1OOZ A;  3GK7 A;  1OPE A;  3CDK B;  2AHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...