2OASA

Crystal structure of 4-hydroxybutyrate coenzyme a transferase (atoa) in complex with coa from shewanella oneidensis, northeast structural genomics target sor119.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
427
structure length
427
Chain Sequence
b'PAIVCQSALEAVSLIRSGETLWTHSMGATPKVLLDALAKHALTLDNITLLQLHTEGAESLSHPSLLGHLRHRCFFGGVPTRPLLQSGDADYVPIFLSEVPKLFRSGEQKIDTAIIQVSPPDKHGMCSLGISVEATLAACQVAGKIIAHINPQMPRTHGDGFIHIDRFAAVYEQSASLPIHSFATGDAVSLAIGQHVAELVRDGDCLQMGIGAIPDAVLSCLTGHKDLGVHTELFSDGILQLVEKGVINNTKKRFYPGKLVTGFALGSQKLYDYVDDNPAVIFMDIEQVNDTSIIRKNPNVMAINSALQVDLTGQVCADSIGTKIYSGVGGQMDFIRGAGLSEGGRSVIALPSTAAGGRISRIASVLSPGAGVVTTRAHVHYIVTEYGAANLKGRSLRERAQALINIAHPDFREQLSRDAFEVWGLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 4-hydroxybutyrate coenzyme A transferase
publication title Crystal Structure of 4-hydroxybutyrate coenzyme A transferase (AtoA) from Shewanella oneidensis in complex with CoA, Northeast Structural Genomics Target SoR119.
rcsb
source organism Shewanella oneidensis
molecule tags Transferase
total genus 134
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain
A PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.70 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA 4-hydroxybutyrate coenzyme like domains 2oasA02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 2oasA01
3.40.1080.20 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 2oasA03
3RRLA 1O9LA 3K6MA 2AHUA 2NRCA 3D3UA 3QDQA 3RRLB 1M3EA 2OASA 2NRBA 3CDKA 3CDKB 2HJ0A 1OPEA 2AHVA 1OOYA 3GK7A 3DLXA 2AHWA 1POIA 1K6DA 3OXOA 5DBNA 1POIB 1XR4A 4KGBA 5DBNB 3EH7A 1OOZA
chains in the Genus database with same CATH superfamily
3V97A 3NY7A 3D3UA 1BUZA 3RRLB 3DJAA 3IHBA 2OASA 3T6OA 3CDKA 3GHFA 1TILB 3IH9A 4L8KA 3IH8A 2ZO9B 3D03A 4HYLA 2AHVA 1T6RA 3DLXA 1N6DA 1POIA 2DXNA 3OIRA 2B78A 4KGBA 1J7XA 1WXWA 2ZOAA 3GMFA 1V0FA 2DXLA 1HF2A 5EZBA 1O9LA 1TIDB 4L1CA 2AHUA 3K6MA 1H4XA 1N6FA 5EUXA 3MGLA 4QTPA 4DMGA 1OPEA 4HIZA 1THNB 2AS0A 5DBNA 3IHAA 1H4YA 1K32A 4DGHA 1FC9A 1FCFA 4AE2A 1OOZA 3RRLA 3GVJA 3ZXNA 3MOGA 3LLOA 1M3EA 2NRBA 3OIZA 3CDKB 1VC1A 4GHNA 1H4ZA 2KLNA 1BPLA 3GK7A 3V8VA 4DGFA 3GVLA 3AGEA 3OXOA 1POIB 5EUSA 1V0EA 5DBNB 1WXXA 3ZTBA 5EUUA 1AUZA 1SBOA 2NRCA 3QDQA 3LDFA 5EUWA 2RRLA 3VSEA 4JC0A 1N6EA 3LKLA 4XS5A 3GVKA 2HJ0A 2CWWA 4AEJA 3C0KA 1OOYA 1TH8B 2AHWA 1FC6A 3AGDA 3JU4A 1K6DA 1XR4A 3DUPA 2VY9A 5EUZA 3DORA 3IF5A 3F43A 1FC7A 2KA5A 3EH7A 3K50A
chains in the Genus database with same CATH topology
3RRLA 1O9LA 3K6MA 2AHUA 2NRCA 3D3UA 3QDQA 3RRLB 1M3EA 2OASA 2NRBA 3CDKA 3CDKB 2HJ0A 1OPEA 2AHVA 1OOYA 3GK7A 3DLXA 2AHWA 1POIA 1K6DA 3OXOA 5DBNA 1POIB 1XR4A 4KGBA 5DBNB 3EH7A 1OOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRL A;  1O9L A;  3K6M A;  2AHU A;  2NRC A;  3D3U A;  3QDQ A;  3RRL B;  1M3E A;  2OAS A;  2NRB A;  3CDK A;  3CDK B;  2HJ0 A;  1OPE A;  2AHV A;  1OOY A;  3GK7 A;  3DLX A;  2AHW A;  1POI A;  1K6D A;  3OXO A;  5DBN A;  1POI B;  1XR4 A;  4KGB A;  5DBN B;  3EH7 A;  1OOZ A; 
#chains in the Genus database with same CATH topology
 3V97 A;  3NY7 A;  3D3U A;  1BUZ A;  3RRL B;  3DJA A;  3IHB A;  2OAS A;  3T6O A;  3CDK A;  3GHF A;  1TIL B;  3IH9 A;  4L8K A;  3IH8 A;  2ZO9 B;  3D03 A;  4HYL A;  2AHV A;  1T6R A;  3DLX A;  1N6D A;  1POI A;  2DXN A;  3OIR A;  2B78 A;  4KGB A;  1J7X A;  1WXW A;  2ZOA A;  3GMF A;  1V0F A;  2DXL A;  1HF2 A;  5EZB A;  1O9L A;  1TID B;  4L1C A;  2AHU A;  3K6M A;  1H4X A;  1N6F A;  5EUX A;  3MGL A;  4QTP A;  4DMG A;  1OPE A;  4HIZ A;  1THN B;  2AS0 A;  5DBN A;  3IHA A;  1H4Y A;  1K32 A;  4DGH A;  1FC9 A;  1FCF A;  4AE2 A;  1OOZ A;  3RRL A;  3GVJ A;  3ZXN A;  3MOG A;  3LLO A;  1M3E A;  2NRB A;  3OIZ A;  3CDK B;  1VC1 A;  4GHN A;  1H4Z A;  2KLN A;  1BPL A;  3GK7 A;  3V8V A;  4DGF A;  3GVL A;  3AGE A;  3OXO A;  1POI B;  5EUS A;  1V0E A;  5DBN B;  1WXX A;  3ZTB A;  5EUU A;  1AUZ A;  1SBO A;  2NRC A;  3QDQ A;  3LDF A;  5EUW A;  2RRL A;  3VSE A;  4JC0 A;  1N6E A;  3LKL A;  4XS5 A;  3GVK A;  2HJ0 A;  2CWW A;  4AEJ A;  3C0K A;  1OOY A;  1TH8 B;  2AHW A;  1FC6 A;  3AGD A;  3JU4 A;  1K6D A;  1XR4 A;  3DUP A;  2VY9 A;  5EUZ A;  3DOR A;  3IF5 A;  3F43 A;  1FC7 A;  2KA5 A;  3EH7 A;  3K50 A; 
#chains in the Genus database with same CATH homology
 3RRL A;  1O9L A;  3K6M A;  2AHU A;  2NRC A;  3D3U A;  3QDQ A;  3RRL B;  1M3E A;  2OAS A;  2NRB A;  3CDK A;  3CDK B;  2HJ0 A;  1OPE A;  2AHV A;  1OOY A;  3GK7 A;  3DLX A;  2AHW A;  1POI A;  1K6D A;  3OXO A;  5DBN A;  1POI B;  1XR4 A;  4KGB A;  5DBN B;  3EH7 A;  1OOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...