3QDQA

Complex between 4-hydroxybutyrate coa-transferase from clostridium aminobutyricum and coa
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
447
structure length
447
Chain Sequence
MDWKKIYEDRTCTADEAVKSIKSGDRVLFAHCVAEPPVLVEAMVANAAAYKNVTVSHMVTLGKGEYSKPEYKENFTFEGWFTSPSTRGSIAEGHGQFVPVFFHEVPSLIRKDIFHVDVFMVMVSPPDHNGFCCVGVSSDYTMQAIKSAKIVLAEVNDQVPVVYGDTFVHVSEIDKFVETSHPLPEIGLPKIGEVEAAIGKHCASLIEDGSTLQLGIGAIPDAVLSQLKDKKHLGIHSEMISDGVVDLYEAGVIDCSQKSIDKGKMAITFLMGTKRLYDFAANNPKVELKPVDYINHPSVVAQCSKMVCINACLQVDFMGQIVSDSIGTKQFSGVGGQVDFVRGASMSIDGKGKAIIAMPSVAKKKDGSMISKIVPFIDHGAAVTTSRNDADYVVTEYGIAEMKGKSLQDRARALINIAHPDFKDELKAEFEKRFNAAFSAWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 4-Hydroxybutyrate CoA-transferase
publication title Crystal structure of the complex between 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum and CoA.
pubmed doi rcsb
source organism Clostridium aminobutyricum
total genus 148
structure length 447
sequence length 447
ec nomenclature ec 2.8.3.-:
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain
A PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.70 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA 4-hydroxybutyrate coenzyme like domains 3qdqA02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3qdqA01
3.40.1080.20 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3qdqA03
3QDQA 1OOZA 5DBNA 3DLXA 2OASA 2NRCA 2AHVA 3OXOA 3GK7A 3CDKA 4KGBA 1K6DA 2NRBA 1XR4A 3RRLA 1POIA 2AHUA 3K6MA 5DBNB 1M3EA 1O9LA 2AHWA 2HJ0A 3CDKB 1OPEA 3EH7A 3RRLB 1OOYA 3D3UA 1POIB
chains in the Genus database with same CATH superfamily
2AS0A 3ZXNA 3V97A 3IH8A 2ZOAA 3DLXA 2OASA 3NY7A 3OIRA 3LLOA 2KA5A 2AHVA 1BPLA 3IHAA 4AE2A 1BUZA 4DGFA 5EUWA 1N6EA 2B78A 1FC7A 4L8KA 2AHUA 1O9LA 2AHWA 1VC1A 3IH9A 3DJAA 3DUPA 1POIB 1H4YA 1TILB 1OOZA 3C0KA 3AGEA 4QTPA 3K50A 1H4ZA 4JC0A 3GK7A 4KGBA 3DORA 1WXXA 1N6DA 1XR4A 1WXWA 3RRLA 1V0FA 2CWWA 4HYLA 3GVLA 1N6FA 1FC9A 3EH7A 3LDFA 3D03A 2DXLA 1V0EA 4GHNA 3JU4A 5EUZA 5DBNA 5EUXA 1FCFA 3GMFA 1J7XA 1FC6A 3OXOA 2KLNA 3CDKA 3F43A 2VY9A 1T6RA 3LKLA 3AGDA 2RRLA 4DGHA 4HIZA 3T6OA 1M3EA 3MGLA 3GVKA 2HJ0A 3MOGA 1OPEA 2DXNA 1THNB 4DMGA 3RRLB 3D3UA 3VSEA 3QDQA 4AEJA 4L1CA 1TIDB 1H4XA 3IHBA 2NRCA 1K32A 3IF5A 3OIZA 1TH8B 1K6DA 2ZO9B 3GVJA 2NRBA 1AUZA 1POIA 5DBNB 3K6MA 5EZBA 3ZTBA 5EUSA 3V8VA 3CDKB 3GHFA 1HF2A 5EUUA 1OOYA 1SBOA 4XS5A
chains in the Genus database with same CATH topology
3QDQA 1OOZA 5DBNA 3DLXA 2OASA 2NRCA 2AHVA 3OXOA 3GK7A 3CDKA 4KGBA 1K6DA 2NRBA 1XR4A 3RRLA 1POIA 2AHUA 3K6MA 5DBNB 1M3EA 1O9LA 2AHWA 2HJ0A 3CDKB 1OPEA 3EH7A 3RRLB 1OOYA 3D3UA 1POIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDQ A;  1OOZ A;  5DBN A;  3DLX A;  2OAS A;  2NRC A;  2AHV A;  3OXO A;  3GK7 A;  3CDK A;  4KGB A;  1K6D A;  2NRB A;  1XR4 A;  3RRL A;  1POI A;  2AHU A;  3K6M A;  5DBN B;  1M3E A;  1O9L A;  2AHW A;  2HJ0 A;  3CDK B;  1OPE A;  3EH7 A;  3RRL B;  1OOY A;  3D3U A;  1POI B; 
#chains in the Genus database with same CATH topology
 2AS0 A;  3ZXN A;  3V97 A;  3IH8 A;  2ZOA A;  3DLX A;  2OAS A;  3NY7 A;  3OIR A;  3LLO A;  2KA5 A;  2AHV A;  1BPL A;  3IHA A;  4AE2 A;  1BUZ A;  4DGF A;  5EUW A;  1N6E A;  2B78 A;  1FC7 A;  4L8K A;  2AHU A;  1O9L A;  2AHW A;  1VC1 A;  3IH9 A;  3DJA A;  3DUP A;  1POI B;  1H4Y A;  1TIL B;  1OOZ A;  3C0K A;  3AGE A;  4QTP A;  3K50 A;  1H4Z A;  4JC0 A;  3GK7 A;  4KGB A;  3DOR A;  1WXX A;  1N6D A;  1XR4 A;  1WXW A;  3RRL A;  1V0F A;  2CWW A;  4HYL A;  3GVL A;  1N6F A;  1FC9 A;  3EH7 A;  3LDF A;  3D03 A;  2DXL A;  1V0E A;  4GHN A;  3JU4 A;  5EUZ A;  5DBN A;  5EUX A;  1FCF A;  3GMF A;  1J7X A;  1FC6 A;  3OXO A;  2KLN A;  3CDK A;  3F43 A;  2VY9 A;  1T6R A;  3LKL A;  3AGD A;  2RRL A;  4DGH A;  4HIZ A;  3T6O A;  1M3E A;  3MGL A;  3GVK A;  2HJ0 A;  3MOG A;  1OPE A;  2DXN A;  1THN B;  4DMG A;  3RRL B;  3D3U A;  3VSE A;  3QDQ A;  4AEJ A;  4L1C A;  1TID B;  1H4X A;  3IHB A;  2NRC A;  1K32 A;  3IF5 A;  3OIZ A;  1TH8 B;  1K6D A;  2ZO9 B;  3GVJ A;  2NRB A;  1AUZ A;  1POI A;  5DBN B;  3K6M A;  5EZB A;  3ZTB A;  5EUS A;  3V8V A;  3CDK B;  3GHF A;  1HF2 A;  5EUU A;  1OOY A;  1SBO A;  4XS5 A; 
#chains in the Genus database with same CATH homology
 3QDQ A;  1OOZ A;  5DBN A;  3DLX A;  2OAS A;  2NRC A;  2AHV A;  3OXO A;  3GK7 A;  3CDK A;  4KGB A;  1K6D A;  2NRB A;  1XR4 A;  3RRL A;  1POI A;  2AHU A;  3K6M A;  5DBN B;  1M3E A;  1O9L A;  2AHW A;  2HJ0 A;  3CDK B;  1OPE A;  3EH7 A;  3RRL B;  1OOY A;  3D3U A;  1POI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...