3QDQA

Complex between 4-hydroxybutyrate coa-transferase from clostridium aminobutyricum and coa
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
447
structure length
447
Chain Sequence
MDWKKIYEDRTCTADEAVKSIKSGDRVLFAHCVAEPPVLVEAMVANAAAYKNVTVSHMVTLGKGEYSKPEYKENFTFEGWFTSPSTRGSIAEGHGQFVPVFFHEVPSLIRKDIFHVDVFMVMVSPPDHNGFCCVGVSSDYTMQAIKSAKIVLAEVNDQVPVVYGDTFVHVSEIDKFVETSHPLPEIGLPKIGEVEAAIGKHCASLIEDGSTLQLGIGAIPDAVLSQLKDKKHLGIHSEMISDGVVDLYEAGVIDCSQKSIDKGKMAITFLMGTKRLYDFAANNPKVELKPVDYINHPSVVAQCSKMVCINACLQVDFMGQIVSDSIGTKQFSGVGGQVDFVRGASMSIDGKGKAIIAMPSVAKKKDGSMISKIVPFIDHGAAVTTSRNDADYVVTEYGIAEMKGKSLQDRARALINIAHPDFKDELKAEFEKRFNAAFSAWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 4-Hydroxybutyrate CoA-transferase
publication title Crystal structure of the complex between 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum and CoA.
pubmed doi rcsb
source organism Clostridium aminobutyricum
molecule tags Transferase
total genus 148
structure length 447
sequence length 447
ec nomenclature ec 2.8.3.-:
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain
A PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.70 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA 4-hydroxybutyrate coenzyme like domains 3qdqA02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3qdqA01
3.40.1080.20 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3qdqA03
3K6MA 3CDKA 5DBNA 2OASA 1M3EA 2HJ0A 3RRLA 1POIB 2AHWA 2NRCA 1OPEA 1K6DA 1O9LA 1OOZA 3EH7A 2NRBA 3CDKB 1XR4A 3DLXA 3GK7A 3QDQA 5DBNB 3RRLB 1POIA 3D3UA 4KGBA 2AHUA 3OXOA 2AHVA 1OOYA
chains in the Genus database with same CATH superfamily
1K32A 2DXNA 4L1CA 3CDKA 2DXLA 2ZO9B 5DBNA 4HIZA 3MGLA 1POIB 2NRCA 1OPEA 3JU4A 4HYLA 3ZTBA 1FC9A 5EUXA 1O9LA 1TILB 2NRBA 3DUPA 3LKLA 3AGDA 1BPLA 3LLOA 4KGBA 4QTPA 1TH8B 1HF2A 1V0EA 5EUSA 1H4YA 1OOYA 1THNB 3GVLA 3K6MA 4DGHA 3C0KA 2HJ0A 5EZBA 3V97A 3GHFA 1FC7A 1TIDB 3IHBA 2AHWA 3IH8A 3EH7A 1T6RA 1WXXA 1N6DA 4L8KA 3DLXA 4GHNA 3GVJA 3GK7A 4DMGA 4XS5A 3QDQA 3RRLB 1POIA 3D3UA 2VY9A 2AHUA 1N6EA 3IF5A 3F43A 3IHAA 3DORA 4JC0A 1M3EA 1FCFA 4AE2A 2ZOAA 1J7XA 2KA5A 3K50A 1AUZA 3LDFA 1OOZA 2B78A 1FC6A 5EUUA 3DJAA 2CWWA 4DGFA 3CDKB 1XR4A 1H4XA 1V0FA 2AS0A 4AEJA 3OIZA 2RRLA 3VSEA 1N6FA 3IH9A 3AGEA 3V8VA 5EUZA 2OASA 3GVKA 3RRLA 3D03A 5EUWA 1SBOA 3ZXNA 1K6DA 1BUZA 3OIRA 3GMFA 5DBNB 1VC1A 3T6OA 1WXWA 3OXOA 1H4ZA 2KLNA 2AHVA 3MOGA 3NY7A
chains in the Genus database with same CATH topology
3K6MA 3CDKA 5DBNA 2OASA 1M3EA 2HJ0A 3RRLA 1POIB 2AHWA 2NRCA 1OPEA 1K6DA 1O9LA 1OOZA 3EH7A 2NRBA 3CDKB 1XR4A 3DLXA 3GK7A 3QDQA 5DBNB 3RRLB 1POIA 3D3UA 4KGBA 2AHUA 3OXOA 2AHVA 1OOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6M A;  3CDK A;  5DBN A;  2OAS A;  1M3E A;  2HJ0 A;  3RRL A;  1POI B;  2AHW A;  2NRC A;  1OPE A;  1K6D A;  1O9L A;  1OOZ A;  3EH7 A;  2NRB A;  3CDK B;  1XR4 A;  3DLX A;  3GK7 A;  3QDQ A;  5DBN B;  3RRL B;  1POI A;  3D3U A;  4KGB A;  2AHU A;  3OXO A;  2AHV A;  1OOY A; 
#chains in the Genus database with same CATH topology
 1K32 A;  2DXN A;  4L1C A;  3CDK A;  2DXL A;  2ZO9 B;  5DBN A;  4HIZ A;  3MGL A;  1POI B;  2NRC A;  1OPE A;  3JU4 A;  4HYL A;  3ZTB A;  1FC9 A;  5EUX A;  1O9L A;  1TIL B;  2NRB A;  3DUP A;  3LKL A;  3AGD A;  1BPL A;  3LLO A;  4KGB A;  4QTP A;  1TH8 B;  1HF2 A;  1V0E A;  5EUS A;  1H4Y A;  1OOY A;  1THN B;  3GVL A;  3K6M A;  4DGH A;  3C0K A;  2HJ0 A;  5EZB A;  3V97 A;  3GHF A;  1FC7 A;  1TID B;  3IHB A;  2AHW A;  3IH8 A;  3EH7 A;  1T6R A;  1WXX A;  1N6D A;  4L8K A;  3DLX A;  4GHN A;  3GVJ A;  3GK7 A;  4DMG A;  4XS5 A;  3QDQ A;  3RRL B;  1POI A;  3D3U A;  2VY9 A;  2AHU A;  1N6E A;  3IF5 A;  3F43 A;  3IHA A;  3DOR A;  4JC0 A;  1M3E A;  1FCF A;  4AE2 A;  2ZOA A;  1J7X A;  2KA5 A;  3K50 A;  1AUZ A;  3LDF A;  1OOZ A;  2B78 A;  1FC6 A;  5EUU A;  3DJA A;  2CWW A;  4DGF A;  3CDK B;  1XR4 A;  1H4X A;  1V0F A;  2AS0 A;  4AEJ A;  3OIZ A;  2RRL A;  3VSE A;  1N6F A;  3IH9 A;  3AGE A;  3V8V A;  5EUZ A;  2OAS A;  3GVK A;  3RRL A;  3D03 A;  5EUW A;  1SBO A;  3ZXN A;  1K6D A;  1BUZ A;  3OIR A;  3GMF A;  5DBN B;  1VC1 A;  3T6O A;  1WXW A;  3OXO A;  1H4Z A;  2KLN A;  2AHV A;  3MOG A;  3NY7 A; 
#chains in the Genus database with same CATH homology
 3K6M A;  3CDK A;  5DBN A;  2OAS A;  1M3E A;  2HJ0 A;  3RRL A;  1POI B;  2AHW A;  2NRC A;  1OPE A;  1K6D A;  1O9L A;  1OOZ A;  3EH7 A;  2NRB A;  3CDK B;  1XR4 A;  3DLX A;  3GK7 A;  3QDQ A;  5DBN B;  3RRL B;  1POI A;  3D3U A;  4KGB A;  2AHU A;  3OXO A;  2AHV A;  1OOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...